Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039408.267ON1101103856e-49
Ecym_43038.267ON109532362e-26
TPHA0A017708.267ON104512302e-25
ZYRO0C01540g8.267ON97532241e-24
KLLA0F19250g8.267ON116532242e-24
Kpol_543.428.267ON112512209e-24
AGR081C8.267ON130532182e-23
KLTH0G13574g8.267ON112532163e-23
Kwal_56.237768.267ON130532165e-23
SAKL0H16918g8.267ON111532147e-23
Smik_4.3598.267ON105522042e-21
Skud_4.3758.267ON105522032e-21
Suva_2.2748.267ON105522023e-21
YDR115W8.267ON105522015e-21
NCAS0B038208.267ON115532009e-21
TBLA0E044708.267ON94521921e-19
KAFR0B054908.267ON85501911e-19
CAGL0B01793g8.267ON98511892e-19
KNAG0H032208.267ON86511874e-19
NDAI0J013408.267ON141521872e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03940
         (110 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   152   6e-49
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    96   2e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    93   2e-25
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    91   1e-24
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    91   2e-24
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    89   9e-24
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    89   2e-23
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    88   3e-23
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    88   5e-23
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    87   7e-23
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    83   2e-21
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    83   2e-21
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    82   3e-21
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    82   5e-21
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    82   9e-21
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    79   1e-19
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    78   1e-19
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    77   2e-19
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    77   4e-19
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    77   2e-18

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  152 bits (385), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 81/110 (73%), Positives = 81/110 (73%)

Query: 1   MSFLARKPLQLNAXXXXXXXXXXXXXXXXXAQNKSQGLLGVPETHXXXXXXXXXXXXGIM 60
           MSFLARKPLQLNA                 AQNKSQGLLGVPETH            GIM
Sbjct: 1   MSFLARKPLQLNARRTLTSLSSFSPLRSLFAQNKSQGLLGVPETHSPLSSISLLFPFGIM 60

Query: 61  QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY
Sbjct: 61  QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 45/53 (84%), Positives = 50/53 (94%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G+ QRRWKSRGNTFQPSTLKRKRR+GFLARARSKTG ++L+RRK KGRWYLTY
Sbjct: 57  GLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 93.2 bits (230), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 50/51 (98%)

Query: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           +QRRWKSRGNT+QPSTLKRKRRIGFLARARSK G+++L+RRKAKGRWYLT+
Sbjct: 54  LQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G+ QRRWKSRGNTFQPSTLKRKRR+GFLARARSK GS++LQRRK KGRW+LT+
Sbjct: 45  GMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 90.9 bits (224), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
            + QRRWKSRGNTFQPSTLKRKRR+GFLARARS++G ++L+RRK KGRWYLTY
Sbjct: 64  DLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 89.4 bits (220), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 50/51 (98%)

Query: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           +QRRWKSRGNT+QPSTLKRKR+ GFLARARS++GS++L+RRKAKGRWYL++
Sbjct: 62  LQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 88.6 bits (218), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 49/53 (92%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G+ Q+RWKSRGNT+QPSTLKRKRR+GFLARARS+TG  +L+RR+ KGRWYLT+
Sbjct: 78  GLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 87.8 bits (216), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (90%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G  QRRWKSRGNT+QPSTLKRKRR+GFLARA+SK G +VL+RR+ KGRWYLT+
Sbjct: 60  GFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 87.8 bits (216), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 49/53 (92%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G+ Q+RWKSRGNT+QPSTLKRKRR+GFLAR +SK GS++L+RR+ KGRWYLT+
Sbjct: 78  GLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 87.0 bits (214), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 48/53 (90%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           G+ QRRWKSRGNT+QPSTLKRKRR+GFLARA++K  S++L+ RK KGRWYLT+
Sbjct: 59  GLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 83.2 bits (204), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KGRW+L++
Sbjct: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.8 bits (203), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KGRW+L++
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.4 bits (202), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KGRW+L++
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 82.0 bits (201), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KGRW+L++
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 81.6 bits (200), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 37/53 (69%), Positives = 46/53 (86%)

Query: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           GI+QRRWKSRGNT+QPSTLKRKR+ GFLA+AR     ++L+RR+ KGRWYLT+
Sbjct: 63  GILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 78.6 bits (192), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 47/52 (90%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I  RRWKSRGNT+QPSTLKRKR+ GFL+RA+S T +++L+RRKAKGRW+L++
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 78.2 bits (191), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%)

Query: 61  QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           Q+RWKSRGNT+QPSTLKRKR+ GFL+RA+SK  S++L+ RK KGRWYL++
Sbjct: 36  QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 77.4 bits (189), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 45/51 (88%)

Query: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           +QRRWKSRGNT+QPSTLKRKR+ GFLAR  +K  +++++RRK KGRWYLT+
Sbjct: 48  LQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 76.6 bits (187), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 44/51 (86%)

Query: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           + RRWKSRGNT+QPSTLKRKR+ GFLAR R+   S+VL+RRK KGRWYL++
Sbjct: 36  LTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 76.6 bits (187), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (86%)

Query: 59  IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110
           I Q+RWKSRGNT+QPSTLKRKR+ GFL+R R +  S++L+RRK KGRW+L++
Sbjct: 90  INQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,315,872
Number of extensions: 188259
Number of successful extensions: 286
Number of sequences better than 10.0: 20
Number of HSP's gapped: 285
Number of HSP's successfully gapped: 20
Length of query: 110
Length of database: 53,481,399
Length adjustment: 80
Effective length of query: 30
Effective length of database: 44,308,119
Effective search space: 1329243570
Effective search space used: 1329243570
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)