Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039308.266ON28028014790.0
ZYRO0C01562g8.266ON2772755602e-70
SAKL0H16940g8.266ON3032915482e-68
Kwal_56.237778.266ON2672545244e-65
KLTH0G13596g8.266ON2672044635e-56
NDAI0B020108.266ON2812714306e-51
AGR082C8.266ON2662524001e-46
Kpol_392.48.266ON2812653758e-43
YLR091W (GEP5)8.266ON2932813645e-41
Suva_10.1758.266ON2992893482e-38
NCAS0B050408.266ON2732773443e-38
Ecym_43048.266ON2892773392e-37
Smik_12.1508.266ON2922733342e-36
Skud_12.1598.266ON2942843299e-36
KAFR0B027408.266ON2562663163e-34
KLLA0F19228g8.266ON3052273107e-33
KNAG0G020608.266ON2862801871e-15
TPHA0J007608.266ON2492341605e-12
CAGL0L12320g8.266ON2782001102e-05
Smik_16.485.51ON103336712.1
ZYRO0A02266g2.302ON40848702.1
KAFR0I015104.9ON70567684.7
KAFR0B017108.83ON118267667.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03930
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   574   0.0  
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   220   2e-70
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   215   2e-68
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   206   4e-65
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   182   5e-56
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   170   6e-51
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   158   1e-46
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   149   8e-43
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   144   5e-41
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   138   2e-38
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   137   3e-38
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   135   2e-37
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   133   2e-36
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   131   9e-36
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   126   3e-34
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   124   7e-33
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    77   1e-15
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    66   5e-12
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    47   2e-05
Smik_16.48 Chr16 (86657..89758) [3102 bp, 1033 aa] {ON} YGR258C ...    32   2.1  
ZYRO0A02266g Chr1 (180349..181575) [1227 bp, 408 aa] {ON} simila...    32   2.1  
KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9...    31   4.7  
KAFR0B01710 Chr2 complement(332533..336081) [3549 bp, 1182 aa] {...    30   7.2  

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/280 (100%), Positives = 280/280 (100%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIK 60
           MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIK
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIK 60

Query: 61  ALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWED 120
           ALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWED
Sbjct: 61  ALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWED 120

Query: 121 SSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPI 180
           SSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPI
Sbjct: 121 SSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPI 180

Query: 181 PIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRK 240
           PIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRK
Sbjct: 181 PIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRK 240

Query: 241 QRRLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLLLNI 280
           QRRLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLLLNI
Sbjct: 241 QRRLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLLLNI 280

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  220 bits (560), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 172/275 (62%), Gaps = 8/275 (2%)

Query: 3   QQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIKAL 62
           Q+L+  L +++ +LPLH +T  +L    +    K++++  A+ +S  E         K L
Sbjct: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLV--AQDISEFEKHNDH----KYL 60

Query: 63  ESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSS 122
           E++I  THF+W +PLP  LK FQ ++ ++  HWPYE  RS+L+M  PR  S  Y W D  
Sbjct: 61  EALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGK 120

Query: 123 KTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPI 182
           +  LS   + K+ W ++NI+ ++L+  Q   L HS+F  Y FLK++ RLC N R +P+PI
Sbjct: 121 ELALSNLRFEKHRWADENII-ERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPI 179

Query: 183 VEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRKQR 242
           VEIP+RP+GND+A  RI+NLFK K A  + +LA EN  LS  +E +L EII+ + +R  R
Sbjct: 180 VEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMR 239

Query: 243 RLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLL 277
           RLYQ + +RAYV+  ++G+  N L +P FRP  +L
Sbjct: 240 RLYQRASRRAYVVT-NEGKDPNGLQVPEFRPGEIL 273

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  215 bits (548), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 171/291 (58%), Gaps = 46/291 (15%)

Query: 6   VQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQ---RIKAL 62
           V+ LL  LE LPL ++TLDLL          TV +  + L+  LE    + Q     K+L
Sbjct: 4   VKTLLNFLECLPLDTRTLDLLE--------GTVKLCSSALLDTLEQKLFDYQANENSKSL 55

Query: 63  ESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSS 122
           E I+Y+T+F W +  P+H++ F+ +Y D+  HWPYERHR +L+M  P   S+R+ W D++
Sbjct: 56  EWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNN 115

Query: 123 KTVLSMAEYSKNPWIEDNILSK-----------------------------KLTIIQRDL 153
           K VLS   + +NPW  ++ L +                             K++ ++  L
Sbjct: 116 KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTL 175

Query: 154 LFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRI 213
           LFH +F HY+FLK NP+LC  G+ LPIPIVEIPM+PLG DI + RI+NLFK K A T+++
Sbjct: 176 LFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKL 235

Query: 214 LAIENPVLSRGSENILSEII------SDASSRKQRRLYQASCKRAYVMEYD 258
           LA ENPVLS  +E +L +II      +  S+RK +RLYQ +CK +YV+  D
Sbjct: 236 LAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICED 286

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  206 bits (524), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 160/254 (62%), Gaps = 16/254 (6%)

Query: 10  LKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIKALESIIYHT 69
           ++ LEKLPL  +TL L+  +L+  E     +   +L    E+ +      K LE+II+HT
Sbjct: 5   IQVLEKLPLDVRTLKLIEKRLERAE----SLRFLELARQYEAKKD----YKTLENIIHHT 56

Query: 70  HFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSMA 129
           +F W + +P H+K F+ HY ++   WPYE HR+IL M+ P+S S+R+ W   +  VL+  
Sbjct: 57  YFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAM 116

Query: 130 EYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRP 189
            Y    W  +    ++LT ++R L FH +F H+LFL+  P+LC N ++L +PIVEIPM+P
Sbjct: 117 RYGSYGWNREGG-GERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKP 175

Query: 190 LGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEII-------SDASSRKQR 242
           LG +IA  RIKNLFK KVA+ +RILA++NP LS  +E++L +II          SSR  +
Sbjct: 176 LGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLK 235

Query: 243 RLYQASCKRAYVME 256
           RLYQ +C+ AYV++
Sbjct: 236 RLYQRACRGAYVIK 249

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  182 bits (463), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 137/204 (67%), Gaps = 8/204 (3%)

Query: 60  KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119
           K+LESI++ T+F W +    H+K F+ HY ++  HWPYE HRSIL+M+ P++ S+R+ W 
Sbjct: 47  KSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWS 106

Query: 120 DSSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLP 179
            +S  VLS   Y K     +   S+ LT +QR + FH VF H+LFLK+ P LC   + L 
Sbjct: 107 SNSPKVLSKMSYEKYAHDTEERPSR-LTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLA 165

Query: 180 IPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIIS----- 234
           +PIVEIPM+PLG +I   R++NLFK K+A+ +++LA+++P LSR +E  L++II      
Sbjct: 166 VPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLP 225

Query: 235 -DASSRKQ-RRLYQASCKRAYVME 256
            D SS+++ +RLYQ +C+ AY +E
Sbjct: 226 EDVSSKRELKRLYQRACRGAYTIE 249

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  170 bits (430), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 153/271 (56%), Gaps = 16/271 (5%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELK---TVIIPLAKLVSNLESSRAETQ 57
           +  +L + LL +L+ LPLHS TL  L  K     +K   +  IPL  L+++ E ++A  Q
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQ 63

Query: 58  RI---KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSL 114
                K LESIIYHT+F W + L  HLK FQ  Y+ +L  WP+  H  I      +  S+
Sbjct: 64  SKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSI 119

Query: 115 RYRWEDSSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNN 174
              W  SS +   + E   +     +++ +K       ++F  ++ HY+FL  NP LC+N
Sbjct: 120 ILTWNKSSNSKNMLRELLSHLNYTQSLVPQKKDF---QVIFKKIYQHYIFLSLNPSLCSN 176

Query: 175 GRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIIS 234
           G+ LP PIVEIPM  +G DI   RI NL +SK+A T+  LAI NP+L+  +E  L EII+
Sbjct: 177 GKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIIN 236

Query: 235 DAS---SRKQRRLYQASCKRAYVMEYDDGEH 262
            +S   SR+ R+LY+ +C  +YV++ +D  +
Sbjct: 237 GSSAIKSRQLRKLYRRACSNSYVIKNEDDNN 267

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  158 bits (400), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 140/252 (55%), Gaps = 9/252 (3%)

Query: 11  KALEKLPLHSKTLDLLACKLKGDELK--TVIIPLAKLVSNLESSRAETQRIKALESIIYH 68
           + + +LPLH  T +++   L   + +  T  I L + +++           + L+ +++H
Sbjct: 7   RIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGH----QGLQRLVFH 62

Query: 69  THFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSM 128
            HF      P HL++ + H  ++   WPYERH S+L +   RS SLR  WED  + VL  
Sbjct: 63  VHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQ 122

Query: 129 AEYSKNPWIEDNILSKK--LTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIP 186
            +Y ++ W+ +  + ++  LT  QR+ + H VF+ Y+FLK  P L +  R LPIP+VEI 
Sbjct: 123 MQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSV-RRLPIPVVEIG 181

Query: 187 MRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRKQRRLYQ 246
           M PLG DI   R+  LFK K     R+L  E+P L+  +E  +  II++  +R  RR+Y 
Sbjct: 182 MTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIYL 241

Query: 247 ASCKRAYVMEYD 258
            +C+RAYV++ D
Sbjct: 242 RACRRAYVLDAD 253

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  149 bits (375), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 153/265 (57%), Gaps = 11/265 (4%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQ--- 57
           + ++L   LL++LE+LPLH  TLD+L  ++   +L   +     +++  E S+  ++   
Sbjct: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHVADL-PFMEEYVGILNEYEISKINSKVEN 65

Query: 58  RIKALESIIYHTHFVWGSP-LPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRY 116
             +ALE I+  TH VW +   P HL+ F++HY ++L HWPYE H  +LNM +P + SL Y
Sbjct: 66  ESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIY 125

Query: 117 RWEDSSKTVLSMAEYS-KNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNG 175
              ++     +  +    N W  +++   KLT  QR  +++ +F    FLK +  +    
Sbjct: 126 LCLNNDDRFFNFYKSQINNKWF-NSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVN 184

Query: 176 RNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISD 235
           +N+ +PIVE+P++P+G DI   RIKNLF  KV + +++L++ +P +S   E I+  I+ D
Sbjct: 185 KNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNILED 243

Query: 236 A-SSRKQRRLYQASCKRAYVMEYDD 259
              +R+  RLY+ S K +YV  +DD
Sbjct: 244 TKDNRRINRLYRRSLKNSYV--FDD 266

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  144 bits (364), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 140/281 (49%), Gaps = 24/281 (8%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAE 55
           M  Q+   LL  +E  PLH  T   L   L   +     K + +PL K +   E + R +
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSI-----LNMEK 108
             R  +KALESIIY THF W +PLP H  +FQ HY  +L HWP+E HR +     +N  K
Sbjct: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120

Query: 109 PRSTSLRYRWEDSSKTVLSMAEYSKNPWIEDNILSKKLTII-------QRDLLFHSVFSH 161
             STS R  W  +    L      KNPW++      +L+         +R  L +S+ +H
Sbjct: 121 LNSTSSRSVWLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNH 177

Query: 162 YLFLKANPRLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPV 220
           Y FL AN  L  N +  P P V+IP+R  LG      +I  LF  +++H Y+ L IENP 
Sbjct: 178 YKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPP 237

Query: 221 LSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260
           LS  +E  L+ +  D +  R+ RRLY  +C RAY     D 
Sbjct: 238 LSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADS 278

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 139/289 (48%), Gaps = 31/289 (10%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKL----KGDELKTVIIPLAKLVSNLE-SSRAE 55
           M  Q    LL  ++ LPLH  T   L  +L       + K + +PL + +   E + RA+
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTS 113
             R  +KALESI+Y THF W +P P H  +FQ HY  +L HWP+E HRS+++    ++  
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 114 L-----RYRWEDSSKTVLSMAEYSKNPWI--------------EDNILSKKLTIIQRDLL 154
           L     +  W  +  T L      KNPW+              +++I        +R  L
Sbjct: 121 LISLTSKGNWLKADWTTLFQV---KNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFL 177

Query: 155 FHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRI 213
             S+ +HY FL  N  L  N +  P P+V+IP+R  LG      +I  LF  ++A  Y  
Sbjct: 178 VKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTS 237

Query: 214 LAIENPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDGE 261
           L +ENP LS  +E  L  +  D +  R+  RLY  +C RAY +   D +
Sbjct: 238 LFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSD 286

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  137 bits (344), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 142/277 (51%), Gaps = 34/277 (12%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTV----IIPLAKLVSNLESSRAET 56
           M + +   LL++L  +PLH KTLDLL  K++    K+      +PL +L+   E    + 
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60

Query: 57  QRI---KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTS 113
            +    K LESI Y+T+F+W +P+P HL++FQ +   +  +WP   HR    M+  R  S
Sbjct: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRG---MDTKRD-S 116

Query: 114 LRYRWEDSSKTVLSMAEYSKNPWIEDNILSKKLTIIQRD------LLFHSVFSHYLFLKA 167
           +  +W  S+                D +L   +  IQ        L+F  +F HY+FL  
Sbjct: 117 IIVQWAKSNNG--------------DALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTL 162

Query: 168 NPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSEN 227
           N R+ +N + L  P+V +PM  +G  I   R+KNLF+ KV+ T   L   NPVL+  +  
Sbjct: 163 NARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHG 222

Query: 228 ILSEIIS---DASSRKQRRLYQASCKRAYVMEYDDGE 261
            L EII+   + +SR  RRLYQ + K A+V+  +  E
Sbjct: 223 FLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPE 259

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  135 bits (339), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 142/277 (51%), Gaps = 39/277 (14%)

Query: 9   LLKALEKLPLHSKTLDLLACKL----KGDELKT-VIIPLAKLVSNLESSRAETQRIKALE 63
           +L+ + +LPLH+ T  ++A  +    KG+  +  VI P+ + + + E S         L 
Sbjct: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVS--------YLR 59

Query: 64  SIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSK 123
            +I+  +F   +P   H++ F+ +  ++ + WPYERH  +L+ E+P   S RY W  ++ 
Sbjct: 60  RVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNA 119

Query: 124 TVLSMAEYSKNPWIED--------NILSKKLTI----------------IQRDLLFHSVF 159
            VL +  Y ++ W+ D        +I  +  T                  +R  L   +F
Sbjct: 120 KVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIF 179

Query: 160 SHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENP 219
           SHYLF+K+ P LC + +NLPIPIVE+ M PLG D+   RI NLF+ +   T + L  + P
Sbjct: 180 SHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFP 238

Query: 220 VLSRGSENILSEIISDASSRKQRRLYQASCKRAYVME 256
            LSR  E++L  II +   R   RLY+ SC  AY M+
Sbjct: 239 PLSREVESLLHSIIKEC-DRSMGRLYKWSCNGAYTMD 274

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 137/273 (50%), Gaps = 24/273 (8%)

Query: 9   LLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAETQR--IKA 61
           LL  ++ +PLH  T + L   L   +     K + +PL KL+   E + R +  R  +KA
Sbjct: 9   LLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKA 68

Query: 62  LESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDS 121
           LESIIY THF W +P P H  +FQ HY  +L HWP+E HR +++        L       
Sbjct: 69  LESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLN---SIP 125

Query: 122 SKTVLSMAEYS-----KNPWIEDNILSKKLT-------IIQRDLLFHSVFSHYLFLKANP 169
           SKT    A+++     KNPW++     K L+         +R  L +S+ + Y FL AN 
Sbjct: 126 SKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKFLIANS 185

Query: 170 RLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENI 228
            L  N +  P P V+IP+R  LG      +I  LF  ++A+ Y  L  ENP LS  ++  
Sbjct: 186 HLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPANDIA 245

Query: 229 LSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260
           L  I +D +  R+ +RLY  +C RAY +   D 
Sbjct: 246 LMAIFNDKTMDRRFKRLYMRACARAYTITNADS 278

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  131 bits (329), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 139/284 (48%), Gaps = 27/284 (9%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAE 55
           MT ++   LL  +E LPLH  T   L   L G +     K + +PL + +   E + R +
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNM-----EK 108
             R  +KALESII+ THF W +P P H  +FQ H+  +L HWP+E HRS+++       K
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120

Query: 109 PRSTSLRYRWEDSSKTVLSMAEYSKNPWIEDNILSKK----------LTIIQRDLLFHSV 158
             S + +  W  +  T L      KN W++    S                +R  L +S+
Sbjct: 121 LNSMASKGTWLKADWTTLFQV---KNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSL 177

Query: 159 FSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSR-IKNLFKSKVAHTYRILAIE 217
            +HY FL AN  L  N +  P P V+IP+R    ++++S+ I  LF  ++   Y  L +E
Sbjct: 178 GNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVE 237

Query: 218 NPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260
           NP LS  +E  L  +  D S  R+ +RLY  +C RAY     D 
Sbjct: 238 NPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDS 281

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  126 bits (316), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 137/266 (51%), Gaps = 31/266 (11%)

Query: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIK 60
           +T+++   +  A+E LPLH KTL  L   LK ++   + IPL + V + E+    T + K
Sbjct: 12  VTKEVRDKITNAIEGLPLHQKTLLQLQDTLKRND--ALAIPLLRDVVSYET----TGKSK 65

Query: 61  ALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWED 120
            LESIIY  +F W + +P HLK   + Y  +  +WP ERH    N E P + SLR  W  
Sbjct: 66  FLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAISLRNAWMR 124

Query: 121 SSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKAN-PRLCNNGRNLP 179
           +  T + ++                      D +   + +H+ +L+ N  RLC   + + 
Sbjct: 125 NKATAVDLS--------------------TSDGVIKPILNHFRYLRVNEDRLCK--KKVG 162

Query: 180 IPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDA-SS 238
           +PI+E+P+   G +I   R+ NL K ++AH  + L  +NP+LS   E+ L  II+D+ ++
Sbjct: 163 LPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNT 222

Query: 239 RKQRRLYQASCKRAYVMEYDDGEHGN 264
           R  +R+Y  SC RAY  E +  +  N
Sbjct: 223 RALKRVYLRSCSRAYTGESNPKDSSN 248

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  124 bits (310), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 116/227 (51%), Gaps = 28/227 (12%)

Query: 60  KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119
           K LE ++Y  HF   +  P H+ + + +  ++   WPYE   SIL M+ P  TS    W 
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110

Query: 120 DSSKTVLSMAEYSKNPWIE------------------DNILSKKLTIIQR------DLLF 155
            ++K  L    ++++ W+                   D + S ++T + R          
Sbjct: 111 RNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETL 170

Query: 156 HSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILA 215
             +F HY FLK NP+LC   + L  PIVEI M+P G DIA  RI NLFK KV     +L 
Sbjct: 171 RQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLY 229

Query: 216 IENPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDGE 261
            +NPVL+  +E+IL+ I++D   +R+ +RLY+    R+Y+  + DG+
Sbjct: 230 SQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYL--FKDGK 274

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 126/280 (45%), Gaps = 37/280 (13%)

Query: 9   LLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLE---SSRAETQRIKALESI 65
           LL+ L  LPLHS TL  L+  +   +    +  +A+ + N     S++  TQ  K L ++
Sbjct: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQ-YKILTTL 66

Query: 66  IYHTHFVWG------SPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119
           +   +  W       S LP HL  F+  +  ++  WP E H S+    K  +T L++ W 
Sbjct: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHAT-LKHAWV 125

Query: 120 DSSKTVLSMA--EYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRN 177
            ++K  L M+    + NP   +  L   L           + SHY  L  N R+    + 
Sbjct: 126 TNNKHALQMSFDAAAANPTSGNIELRGSL---------RQILSHYQLLYNNMRMFGKIK- 175

Query: 178 LPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENI--LSEIIS- 234
           L +P+ EIP+   G +I   R  NL + KV +  R+L  E P L   +E I  L+ II+ 
Sbjct: 176 LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALY-NTECIAELTAIIAG 234

Query: 235 --------DASSRKQRRLYQASCKRAYVME--YDDGEHGN 264
                   + S R+ RRLY+ +    Y +     +G++G 
Sbjct: 235 DGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGG 274

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 106/234 (45%), Gaps = 42/234 (17%)

Query: 7   QPLLKALEKLPLHSKTLDLLACKLKGDELK-TVIIPLAKLVSNLESSRAETQRIKALESI 65
           Q +L  L +LPLH  TLDLL  ++     K + +I L    +N   ++ +  ++K L+ I
Sbjct: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRI 78

Query: 66  IYHTHFVWGSPLPV--HLKMFQSHYTDMLMHWPYERHRSIL--NMEKPRSTSLRYRWED- 120
           I+ TH ++ +      HLK F+  Y  +  +WPYERH  +   N   P + +L Y W + 
Sbjct: 79  IFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNC 138

Query: 121 --------SSKTVLSMAEYSKNPWI----------------EDNILSKKLTIIQRDL-LF 155
                    SK +  +    +N +I                E + LS+ +   + ++ LF
Sbjct: 139 NSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLF 198

Query: 156 HSVFS--HYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKV 207
             +F   HY+         N    L IPIV +P+  LG  I  SR+ N FK K+
Sbjct: 199 GELFKQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 90/200 (45%), Gaps = 22/200 (11%)

Query: 65  IIYHTHFVWG--SPLPVHLKMFQSHYTDMLMHWPYERHRSILN-MEKPRSTSLRYRWEDS 121
           ++ H H V    + LP HL+ +QS Y  ++  WP    R IL+ ME  +  ++R      
Sbjct: 58  LVTHVHHVLAPMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRI---PH 114

Query: 122 SKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNG-----R 176
           +KT+  M  + ++ W+    L     + +R LL   V         +     NG     R
Sbjct: 115 NKTLRQM--FEQHEWLVQQRLLDDKRLKRRRLLRCEVQMATPTTNGSTNGNTNGSEISFR 172

Query: 177 NLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISD- 235
             P+ I E+   PLG   + ++ KN  +S V   +R+LA+++P LSR   + L   +   
Sbjct: 173 QCPLTIRELT--PLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRT 230

Query: 236 -ASSRKQRRLYQASCKRAYV 254
             +SR  R     S  RAY+
Sbjct: 231 LGTSRTDR-----SIARAYL 245

>Smik_16.48 Chr16 (86657..89758) [3102 bp, 1033 aa] {ON} YGR258C
           (REAL)
          Length = 1033

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 69  THFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSIL 104
           T FVWGSP    L+ F  H     + WPYE+   IL
Sbjct: 950 TPFVWGSPDLDMLRSFMKHQ----LGWPYEKSDEIL 981

>ZYRO0A02266g Chr1 (180349..181575) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q04235 Saccharomyces cerevisiae YML005W TRM12
           Putative tRNA methyltransferase has a role in tRNA
           modification S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 408

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 219 PVLSRGSENILSEIISDASSRKQRRLYQASCKRAYVMEYDDGEHGNEL 266
           P+   GS++++   I DA      R    SCKR Y ++  D + GN++
Sbjct: 29  PIYREGSKSVIRTGIDDADDEVLGRY--GSCKRWYELDRGDTDGGNQI 74

>KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9
           YHL032C
          Length = 705

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 95  WPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSMAEY---SKNPWIEDNILSKKLTIIQR 151
           W   R+ SI+N EK R+TS   +     KT L ++ Y   SK  W  DN+ + K    + 
Sbjct: 214 WNDSRNASIINEEK-RTTSKEMQDMLMEKTGLPLSTYFSCSKLRWFLDNVPTVKKAYDEG 272

Query: 152 DLLFHSV 158
           DL+F +V
Sbjct: 273 DLMFGTV 279

>KAFR0B01710 Chr2 complement(332533..336081) [3549 bp, 1182 aa] {ON}
           Anc_8.83 YPL006W
          Length = 1182

 Score = 30.0 bits (66), Expect = 7.2,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 11/67 (16%)

Query: 81  LKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSMAEYSKNPWIEDN 140
           + +  S+++D+  HW +     +L+++ P+   + +             E SKN  ++DN
Sbjct: 506 VTLLLSNHSDVAEHWEHHLENFLLDIDAPKGVRISFS-----------TEISKNKEVDDN 554

Query: 141 ILSKKLT 147
           + S  LT
Sbjct: 555 VESWTLT 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,875,742
Number of extensions: 1184830
Number of successful extensions: 3299
Number of sequences better than 10.0: 33
Number of HSP's gapped: 3331
Number of HSP's successfully gapped: 34
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)