Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039208.265ON32232214410.0
YDR113C (PDS1)8.265ON3733774642e-54
Suva_2.2738.265ON3763794347e-50
Smik_4.3588.265ON3713744267e-49
Skud_4.3748.265ON3732973954e-44
ZYRO0C01584g8.265ON2823293562e-39
SAKL0H16962g8.265ON3363612683e-26
NCAS0B038308.265ON3253282595e-25
Kpol_543.418.265ON3063372586e-25
Kwal_56.237818.265ON2933391882e-15
KLTH0G13618g8.265ON3023461821e-14
KNAG0H032308.265ON2812601741e-13
AGR083W8.265ON2952551722e-13
TPHA0A017808.265ON3523721681e-12
KLLA0F19206g8.265ON2632621624e-12
KAFR0B055108.265ON2752931616e-12
NDAI0J013508.265ON4221421433e-09
Ecym_43058.265ON3113411361e-08
CAGL0L12298g8.265ON2862471201e-06
TBLA0E044608.265ON277151890.012
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03920
         (322 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   559   0.0  
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   183   2e-54
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   171   7e-50
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   168   7e-49
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   156   4e-44
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   141   2e-39
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   107   3e-26
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...   104   5e-25
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...   103   6e-25
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    77   2e-15
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    75   1e-14
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    72   1e-13
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    71   2e-13
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    69   1e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    67   4e-12
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    67   6e-12
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    60   3e-09
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    57   1e-08
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    51   1e-06
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    39   0.012

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/322 (87%), Positives = 282/322 (87%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLT 120
           RASPSRRVQQGRPPLASKDNNRSTGF              RNLSQSKKRNANVVDGQLLT
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLT 120

Query: 121 NPRRLKKYGSVLGYNALPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDRSD 180
           NPRRLKKYGSVLGYNALPKMKSLVLKDV                 HILRLKLHNAIDRSD
Sbjct: 121 NPRRLKKYGSVLGYNALPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRSD 180

Query: 181 EEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYD 240
           EEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYD
Sbjct: 181 EEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYD 240

Query: 241 KLKTFRSPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDENIERENLTVKQREMLPQYDTF 300
           KLKTFRSPYLIE         KQDGFLQLEEIGSAGDDENIERENLTVKQREMLPQYDTF
Sbjct: 241 KLKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVKQREMLPQYDTF 300

Query: 301 EIQPSYCGEGLDASDLNDLLKD 322
           EIQPSYCGEGLDASDLNDLLKD
Sbjct: 301 EIQPSYCGEGLDASDLNDLLKD 322

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  183 bits (464), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 185/377 (49%), Gaps = 63/377 (16%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKP----------SGEENPSNL 50
           MP NE+KEN++V    ES G++FPQTPAHLLKRS S ++KP          +   N + L
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 51  TYRDCDAPVKRASPSRRV-----QQGRPPLASKDNNRSTGFXXXXXXXXXXXX------- 98
            Y       K  SP++R+     QQGR PLA+KDNNRS  F                   
Sbjct: 62  KYIQGG---KEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQN 118

Query: 99  --------XXRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDVXX 150
                     R LSQ  +  +      LL+N R+L+KYGSVLGYNALPKMKSLVLKD+  
Sbjct: 119 TLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAD 178

Query: 151 XXXXXXXX---XXXXXXXHILRLKLHNAI---DRSDEEGEEVGGLF---DKSGLLHLVRD 201
                               L  KL +A+   D SD E E  GGL    ++ GL  L+++
Sbjct: 179 SGKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKN 238

Query: 202 SKKDE--------DDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEX 253
           S K+E        D  +D +IE  PQR EPLPY+PEG+    Q+D +KLKTF SPY ++ 
Sbjct: 239 STKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDL 298

Query: 254 XXXXXXXXKQDGFLQLEEIGSAGDDENIERENLTVKQRE--MLP----QYDTFEIQPS-- 305
                   K D  L LE+I   G  E  E E +T  Q E   LP     +      P+  
Sbjct: 299 EDEDDTPDKVD-LLPLEQIDEEG--EKDETECITRNQEEGAALPLLSKNFKEVAAVPTME 355

Query: 306 --YCGEGLDASDLNDLL 320
             Y  EGLD  +L DL+
Sbjct: 356 LVYSEEGLDPEELEDLV 372

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  171 bits (434), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 139/379 (36%), Positives = 183/379 (48%), Gaps = 63/379 (16%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKP----------SGEENPSNL 50
           MP NE+KEN++V    ES   SFPQTPAHLLKRS S ++KP              +  NL
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 51  TYRDCDAPVKRASPSRRVQ-----QGRPPLASKDNNRSTGF-----------------XX 88
            Y       K  SP++R+      QGR PLA+KDNNRS  F                   
Sbjct: 61  KYIQGG---KEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQ 117

Query: 89  XXXXXXXXXXXXRNLSQ-SKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKD 147
                       R LSQ S+ RN    +G +L N R+L+KYGSVLGYNALPKMKSLVLKD
Sbjct: 118 QNTLSTRKNDQLRKLSQVSRNRNRGNYNG-MLNNSRKLQKYGSVLGYNALPKMKSLVLKD 176

Query: 148 VXXXXXXXXXXXX---XXXXXHILRLKLHNAI---DRSDEEGEEVGG--LFD-KSGLLHL 198
           +                    + L  KL +A      S++E E  GG  LF+ + GL  L
Sbjct: 177 LADPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQL 236

Query: 199 VRDSKKDED-----DWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEX 253
           ++++ K ++     D +D +IE  PQR EPLPY+P+G+    QED  KLKTF SPY ++ 
Sbjct: 237 IKNTAKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDL 296

Query: 254 XXXXXXXXKQD--GFLQLEEIG----------SAGDDENIERENLTVKQREMLPQYDTFE 301
                     D  G L L E+           + GD +     +L ++  E         
Sbjct: 297 EGNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPL 356

Query: 302 IQPSYCGEGLDASDLNDLL 320
           I+  Y GEGLD+ +L DLL
Sbjct: 357 IESLYNGEGLDSEELEDLL 375

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  168 bits (426), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 184/374 (49%), Gaps = 58/374 (15%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSG--EENPSNLTYRDCDA- 57
           MP NE+KEN++V +   S  ++FPQTPAHLLKRS S ++KP    ++   ++   +C+A 
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 58  ----PVKRASPSRRV-----QQGRPPLASKDNNRSTGF-----------------XXXXX 91
                 K  SP++R+     QQGR PLA+KDNNR+  F                      
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 92  XXXXXXXXXRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDVX-- 149
                    R LSQ  +    V    LL N R+L+KYGSVLGYNALPKMKSLVLKD+   
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180

Query: 150 -XXXXXXXXXXXXXXXXHILRLKLHNAI---DRSDEEGEEVG--GLF-DKSGLLHLVRDS 202
                            + L  KL NA+     SD+E E  G  GLF ++ GL  L+++S
Sbjct: 181 GKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240

Query: 203 KKDE-----DDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEXXXXX 257
            ++E     D+ +  EIE  PQR +PLPY+P+G+    QED  KLK+F SPY ++     
Sbjct: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG 300

Query: 258 XXXXKQDGFLQLEEIGS----------AGDDENIERENLTVKQREMLPQYDTFEIQPSYC 307
               K D  L LE I            AGD E      L  K    +    T E   S C
Sbjct: 301 GSTDKVD-LLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIE---SLC 356

Query: 308 -GEGLDASDLNDLL 320
            GEGLD  +L DL+
Sbjct: 357 NGEGLDPEELEDLI 370

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  156 bits (395), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 154/297 (51%), Gaps = 51/297 (17%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPS----------GEENPSNL 50
           MP NE+KEN++V    ES G++FPQTPAHLLKRS S ++KP              N   L
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 51  TYRDCDAPVKRASPSRRV-----QQGRPPLASKDNNRSTGFXXXXXXXXXXXXXX----- 100
            Y       K  SP++R+     QQGR PLA+KDNNRS  F                   
Sbjct: 61  KYIQGG---KEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQ 117

Query: 101 ------------RNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDV 148
                       R LSQ  +        +LL N R+L+KYGSVLGYNALPKMKSLVLKD+
Sbjct: 118 QNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDL 177

Query: 149 XXXXXXXXXXXXXXXXX---HILRLKLHNAI---DRSDEEGEEVG--GLFD-KSGLLHLV 199
                                 L +KL NA      SD+E E  G  GLF+ + GL  L+
Sbjct: 178 AGPAKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLI 237

Query: 200 RD-------SKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPY 249
           ++       SK+++DD +D EIE  PQR EPLPY+P+G+ S  +ED +KL+TF SPY
Sbjct: 238 KNTTKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  141 bits (356), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 161/329 (48%), Gaps = 63/329 (19%)

Query: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62
           + +NKEN++VL+  E+G ++ PQTP HLLKRSQ  ++KP  EEN           PVK++
Sbjct: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP--EEN----------TPVKKS 52

Query: 63  ---SPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLL 119
              SP R   Q R PLASKD+N+S+                      KKR    + G+LL
Sbjct: 53  RSVSPVR--GQRRLPLASKDHNKSSAA-----------------GPVKKRQP-TLQGELL 92

Query: 120 TNPRRLKKYGSVLGYNALPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDRS 179
           +NPR+L+KYGSVLGY  LP+ KSLVLKD                    L+ KL +A++R 
Sbjct: 93  SNPRKLQKYGSVLGYTDLPRTKSLVLKDGDDEDDDEEEENSE------LQKKLQDAMNRR 146

Query: 180 DEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDY 239
           ++  E +GGL        LVRD+K D        IEY P R  PL Y P+GH     ED 
Sbjct: 147 EDSNEGLGGLA------KLVRDTKDD--------IEYAPHRLPPLEYAPDGHTRWEDEDI 192

Query: 240 DKLKT--FRSPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDEN------IERENLTVKQR 291
            KLK    R     +           DG L L  I S  +D N      I  +N  +   
Sbjct: 193 VKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPF 252

Query: 292 EMLPQYDTFEIQPSYCGEGLDASDLNDLL 320
             L  +D  +++  Y GEGL+A +L DLL
Sbjct: 253 PKLRVFDEDQVENIYNGEGLNAEELEDLL 281

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  107 bits (268), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 154/361 (42%), Gaps = 67/361 (18%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M  +ENKEN +          + P TP+HLLKRSQS M                   P+ 
Sbjct: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQSFM------------------KPLA 36

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRN--LSQSK-KRNANVVD-- 115
             SP+++  + R PLASKDNN+S                  N  L   K KRN  VV   
Sbjct: 37  SNSPTKKSGK-RLPLASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNT 95

Query: 116 GQLL-TNPR----------RLKKYGSVLGYNALPKMKSLVLKDVXXXXXXXXXXXXXXXX 164
           G  + TN            RLKKYGSVLGYN LP++KSLVLKDV                
Sbjct: 96  GSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEE 155

Query: 165 XHI--------LRLKLHNAIDRSDEEGEE---VGGLFDKSGLLHLVRDSKKDEDDWEDRE 213
                      L  KL  A++  +E+ +E   +G L   +GL  L++    +E +  D E
Sbjct: 156 DDDEEEEEDNPLAAKLLKALNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFE 215

Query: 214 IEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEXXXXXXXXXKQ-DGFLQLEEI 272
           IE  P   E LP++P G+    + D  KL TF SP+ +             DG L +  +
Sbjct: 216 IEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKEDSDCEECDDYDGLLTISMV 275

Query: 273 GSAG---DDENIER--------ENLTVKQREMLPQYDTFE--IQPSYCGEGLDASDLNDL 319
            S     DD+  +R        E L    R  L  ++  E  I+P Y GEGL+  DL  L
Sbjct: 276 KSEDEEQDDDTNDRKRRKSWIDEGLAT-ARHGLFDFNKPELYIEPHYNGEGLNKEDLESL 334

Query: 320 L 320
           L
Sbjct: 335 L 335

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score =  104 bits (259), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 143/328 (43%), Gaps = 84/328 (25%)

Query: 23  FPQTPAHLL-KRSQSAMMKPSGEENPSNLTYRDCDAPVKRASPSRR--VQ-QGRPPLASK 78
            P+TPAHLL KRS S ++KP    N  N T       +   SP RR  +Q Q R PLA K
Sbjct: 28  MPETPAHLLLKRSLSTVLKP----NSVNAT-----DELGNISPRRRQLLQLQNRLPLAKK 78

Query: 79  DNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALP 138
           DNN S                    S S ++N        L N ++LKKYGSVLG +ALP
Sbjct: 79  DNNNS--------------------SFSSRKNG-------LNNIKKLKKYGSVLGMDALP 111

Query: 139 KMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDRSDE----------EGEEVGG 188
           + KSL+LK                   +   LKL NA+ + +            G  +G 
Sbjct: 112 RTKSLILK----DVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGL 167

Query: 189 LFDK--------SGLLHLVRDSKKD--------------EDDWEDREIEYGPQRHEPLPY 226
             D          GL  L+R++ K+              +D   DREIEY P R EPLP+
Sbjct: 168 FHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPF 227

Query: 227 IPEGHLSLAQEDYDKLKTFRSPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDENIERENL 286
           +P G+     ED +KLKTF S Y ++           D  L LE I ++ DDE  E E+ 
Sbjct: 228 VPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDA--DKLLALETIETSVDDE-AEWEH- 283

Query: 287 TVKQREMLPQY----DTFEIQPSYCGEG 310
            V+     P      D+ ++ P Y GEG
Sbjct: 284 EVRHHRRRPTRDSNDDSIDLVPLYNGEG 311

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score =  103 bits (258), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 150/337 (44%), Gaps = 52/337 (15%)

Query: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62
           +++NKEN++      +     PQTP +LLKR+ S +         + +        V   
Sbjct: 1   MDQNKENNI---FRHAMLKDMPQTPNNLLKRTHSKL--------KTGIAKDIQGGNVINT 49

Query: 63  SPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQ----- 117
           SP +R+     PLASKDNNRS  F               N + +   N N +  Q     
Sbjct: 50  SPQKRL-----PLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQ 104

Query: 118 ----LLTNPRRLKKYGSVLGYNALPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLH 173
               +L + R+LKKYGSVLGYNALPK+KSLVLKD+                  + +  ++
Sbjct: 105 NKSGILADDRKLKKYGSVLGYNALPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSIN 164

Query: 174 NAIDRSDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLS 233
                   +     GL     L  L+RD+ +D      REIE+         YIP+ HL 
Sbjct: 165 T------NKSNSGIGLLSGGNLQQLIRDANEDV-----REIEHKSNAFPDKEYIPDDHLP 213

Query: 234 LAQEDYDKLKTFRSPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDENIERENLTVKQ--- 290
             + D  KLKTF SP+ +E           +  L    + +  DDE    + +T  +   
Sbjct: 214 FDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLL----LANTSDDEGTHNDKITTNKNLS 269

Query: 291 -------REMLPQYDTFEIQPSYCGEGLDASDLNDLL 320
                  ++++P  D  +I+PSY GEGLD++DL DLL
Sbjct: 270 INNKPNSKDVIPA-DILDIEPSY-GEGLDSNDLEDLL 304

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 138/339 (40%), Gaps = 64/339 (18%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M   ENKEN +          S P TP HLL RSQS M                     K
Sbjct: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------K 33

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVD--GQL 118
             SP R  Q  R PLASKDNN+STGF                    +KR    V+  G  
Sbjct: 34  NISPKRAEQ--RKPLASKDNNKSTGFLGAKEPL-------------RKRTRPTVNHAGSF 78

Query: 119 LTNPRRLKKYGSVLGYNALPKMKSLVLKD-VXXXXXXXXXXXXXXXXXHILRLKLH---N 174
           + N R       +L  N  P++KSLVLKD +                 + L  KL    N
Sbjct: 79  IGNTR--PGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKLN 136

Query: 175 AIDRSDEEGEEVGGLFDKSGLLHLVRDSKKDE--DDWEDREIEYGPQRHEPLPYIPEGHL 232
           A DR D+  E+ G L    GL  L       E  D   D E+E  P R EPLP+IP G+ 
Sbjct: 137 ARDR-DDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVIPPRPEPLPHIPHGYT 195

Query: 233 SLAQEDYDKLK-TFRSPYLI----EXXXXXXXXXKQDGFLQLEEIGSAGDDENIERENLT 287
               ED  KL+ T  SP+ +    +          Q   L+L+   + GD E+ +R+ L 
Sbjct: 196 PFTDEDIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKLDNDDNLGDQEH-DRKRLH 254

Query: 288 VKQRE-----MLPQYDTFEIQPSYCGEGLDASDLNDLLK 321
             +++     +  Q   FE+ P Y G GL   +L  LL+
Sbjct: 255 TPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 99/346 (28%), Positives = 141/346 (40%), Gaps = 69/346 (19%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M  +E+KEN +     ES   + P TP HLL RSQS M                     K
Sbjct: 1   MGRHEDKENSI---WSES---NVPVTPRHLLSRSQSFM---------------------K 33

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLT 120
             SP R   + R PLASKDNNRS  +              R  ++    +A    G    
Sbjct: 34  NKSPKR--AEARRPLASKDNNRSVSYLGTKEPL-------RKRTRPGVNHAGSFVGNARL 84

Query: 121 NPRRLKKYGSVLGYNALPKMKSLVLKDVXXXXXXXXXXXXXXXX----XHILRLKLHNAI 176
            P         L  +  PK+KSLVLKD                      + L  KL   +
Sbjct: 85  GP------APTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKL 138

Query: 177 ---DRSDEEGEEVGGLFDKSGLLHLV--RDSKKDEDDWEDREIEYGPQRHEPLPYIPEGH 231
              DR D EGE+ G L    GL  L+  + S++ E+   D+E+E  P R EPLP++PEG+
Sbjct: 139 LSRDR-DAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEVEVIPPRPEPLPHVPEGY 197

Query: 232 LSLAQEDYDKLKTF-RSPYLIEXXXXXXXX--XKQDGFLQLEEIGSAGDDENIERENLTV 288
               +++  KL+    SP+ +             QD   QL  +    DD +    + + 
Sbjct: 198 TPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDS-TQLFTLNFDRDDNDDTDADQSG 256

Query: 289 KQREMLPQ-------------YDTFEIQPSYCGEGLDASDLNDLLK 321
           ++R   P+              D FE++P+Y G GL A +L  LL+
Sbjct: 257 RKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLLE 302

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 108/260 (41%), Gaps = 73/260 (28%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M  NE+KEN           V+ PQTPA  +      ++KP G     + + R       
Sbjct: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVR------- 43

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLT 120
             SP+R    GR PLASKDNN ++G               R  + S              
Sbjct: 44  -KSPTR---GGRLPLASKDNN-ASGLVVSGKLGRQPADQVREANSS-------------- 84

Query: 121 NPRRLKKYGSVLGYN--ALPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDR 178
             R+LK+YGS+LGY+   L + KSL+LKD                     RL L   I +
Sbjct: 85  --RKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSKSVTK--------RLLLDEEIAK 134

Query: 179 SDEEG-------------EEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLP 225
           +  +G              ++GG     GL  LVR S       ++RE+E  PQ  + LP
Sbjct: 135 NSSDGDDDGDDTDILKIRSQLGG-----GLDRLVRQS-------QNRELEIRPQAQDELP 182

Query: 226 YIPEGHLSLAQEDYDKLKTF 245
           YIP+GH+ L + D  KL+ +
Sbjct: 183 YIPDGHIILHEADIAKLRDY 202

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 108/255 (42%), Gaps = 44/255 (17%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M  +E+KEN   L      G   P+TP H LKRS S            NL  R+      
Sbjct: 1   MKKHEDKEN---LVTSAGRGAMMPRTPIHQLKRSSS------------NLAGRNST---- 41

Query: 61  RASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLT 120
                      R PLASKD N+S G               +  S   KR A+    + + 
Sbjct: 42  -----------RMPLASKDRNQSQGVFGLKTSGAGGAGGAQAQS---KRPASSSIAKNMP 87

Query: 121 NPRRLKKYGSVLG--YNALPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDR 178
           +  +LKKYGSVLG  Y +L K KSLVLKD                  + L  KL + +  
Sbjct: 88  D-SKLKKYGSVLGVGYGSLAKAKSLVLKDTSDCESANEESEEEEG--NPLAAKLKSRLCS 144

Query: 179 SDEEGEEVGGLFDKSGLL---HLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLA 235
           ++E G E  G    SGLL    L + +   E   +   +EY P++   LP++P G+ SL 
Sbjct: 145 AEEGGNEDDG---SSGLLLGEALSQLAAAGETQEDVPPVEYAPEKLPELPHVPNGYESLK 201

Query: 236 QEDYDKLKTFRSPYL 250
             D  KL  + SP+L
Sbjct: 202 SADLAKLAKYHSPFL 216

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 156/372 (41%), Gaps = 80/372 (21%)

Query: 1   MPINENKENDLVLN----LPESGGVS---FPQTPA-HLLKRSQSAMMKPSGEENPSNLTY 52
           + +N +KEND+       L     +S    PQTP   LLKR+ S  +        S   +
Sbjct: 7   LNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTL--------STAVF 58

Query: 53  RDCDAPVKRASPSRRVQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNAN 112
           +D  A   + + +  ++  R PLASKDNN S                 R+ S   + N  
Sbjct: 59  KD--AQQSKENNNNNIKLNRLPLASKDNNNS----------------RRSNSFILQNNKL 100

Query: 113 VVDGQL--LTN---PRRLKKYGSVLGYNALPK--------MKSLVLKDVXXXXXXXXXXX 159
           V++ QL  L N     +L+KYGS+LG N            +KSL+LKD+           
Sbjct: 101 VLNKQLSLLNNNQTSNKLRKYGSILGVNNNGNNTNKTLNPVKSLILKDIPDNGNENDDDD 160

Query: 160 XXXXXXHILRLKLHNAIDR-----------------SDEEGEEVGGLFDKSGLLHLVRDS 202
                 +I+ L L NA+                   SD E EE+G     +GL  L+  S
Sbjct: 161 DDDDD-NIITLNLKNALQSKKEPLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQKLISQS 219

Query: 203 KKDEDDWEDREIEYGPQRHEPLP---YIPEGHLSLAQEDYDKLKTFRSPY----LIEXXX 255
              +   E   I     +    P   Y PEG++    ED  KL TF+SPY    + +   
Sbjct: 220 MNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLL 279

Query: 256 XXXXXXKQDGFLQLEEIGSAGDDENIERENLT-------VKQREMLPQYDTFEIQPSYCG 308
                    G L+LE +GS+ DD++    N++        +Q      +  FEIQPSY  
Sbjct: 280 ADHNNNNNSGLLELENVGSSDDDDDNNLLNISNIQDGRGSRQTNDNETFIDFEIQPSY-N 338

Query: 309 EGLDASDLNDLL 320
           +GLDA++L +LL
Sbjct: 339 DGLDANELENLL 350

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 67.0 bits (162), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 108/262 (41%), Gaps = 43/262 (16%)

Query: 68  VQQGRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLTNPRRLKK 127
           V+  R PLASKDNNR+                        KR A+     +  N  +LKK
Sbjct: 35  VRGNRRPLASKDNNRTQSILSVKNNAALGKS-----DHPLKRPASSFMKNMPEN--KLKK 87

Query: 128 YGSVLGYNA-LPKMKSLVLKDVXXXXXXXXXXXXXXXXXHILRLKLHNAIDRSDEEGEEV 186
           YGSVLG N  +P+ KSLVLKD                    +              G+ +
Sbjct: 88  YGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIF-----------PSGKSL 136

Query: 187 GGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFR 246
              F  +GL  L+R+ K+DE       IEY P+R + LPYIP G+    +E  +KL+  R
Sbjct: 137 NLGFG-NGLKALIRE-KEDE-----LNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHR 189

Query: 247 SPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDENI--------ERENLTVKQREMLPQYD 298
           SP+ +E                 E I  A  DE++         + NL +       +  
Sbjct: 190 SPFQVESITFDTEERDP------ELISLAATDEDLVSPTRYNNHKHNLELDSDN---ESI 240

Query: 299 TFEIQPSYCGEGLDASDLNDLL 320
           T E+   Y G+GLD  +LN LL
Sbjct: 241 TIELGEEYNGQGLDTLELNSLL 262

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 116/293 (39%), Gaps = 60/293 (20%)

Query: 49  NLTYRDCDAPVKRASPSRRVQQ-GRPPLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSK 107
           N  +   +    R SP +R+QQ G+ PL SK+ N+S                   L   K
Sbjct: 23  NTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNSI----------------LISHK 66

Query: 108 KRNANVVDGQLLTNPRRLKKYGSVLGYN-----ALPKMKSLVLKDVXXXXXXXXXXXXXX 162
             N             R+KKYGS+LG        LPK KSL+LKD               
Sbjct: 67  GNNT------------RIKKYGSILGLENPGNFKLPKTKSLILKD--------NESSESE 106

Query: 163 XXXHILRLKLHNAIDRS----DEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGP 218
               +L  KL  A+ RS    D EG+   GLF K    + + +     DD  + +I  G 
Sbjct: 107 EEDGLLNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHISN-----DDDSEIDIINGK 161

Query: 219 QRHEPLPYIPEGHLSLAQEDYDKLKTFR--SPYLIEXXXXXXXXXKQDGFLQLEEIGSAG 276
           ++   L YIP+ +  +A ++ +KLK     + +                FL+LE +  + 
Sbjct: 162 EKDVELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSD 221

Query: 277 DDENIERE----NLTVKQREMLPQYD---TFEIQPSYCGEGLDASDLNDLLKD 322
            +ENI+      N   K        D   T EI   Y G GLD  D+  +L+D
Sbjct: 222 TEENIDPSYNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAMLRD 274

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 69/142 (48%), Gaps = 41/142 (28%)

Query: 21  VSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYR-DCDAPVKRA----SPSRRV--QQGRP 73
           + FPQTPAHLLKRS S + K   +  P NL  +   DA         SP R++   Q R 
Sbjct: 35  ILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRF 94

Query: 74  PLASKDNNRSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLG 133
           PL+ KDNN S  F                L Q +++           + +RLKKYGSVLG
Sbjct: 95  PLSKKDNNNS--FI---------------LKQQQQQ----------FDHKRLKKYGSVLG 127

Query: 134 -------YNALPKMKSLVLKDV 148
                  +N L ++KSLVLKD+
Sbjct: 128 LGTDGNNHNNLTRIKSLVLKDI 149

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 201 DSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIE 252
           D+KK++   E+ +IEY P R + LPYIP+G+     ED +KLK + SP+ I 
Sbjct: 263 DNKKEDTYDEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIH 314

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 90/341 (26%), Positives = 133/341 (39%), Gaps = 52/341 (15%)

Query: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60
           M  +E+KEN  +    E  G   P+TP H LKRS S            N+  ++      
Sbjct: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTS------------NVHLKN------ 40

Query: 61  RASPSRRVQQGRPPLASKDNNRS-TGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLL 119
                      R PLASKD NRS +GF                + Q+K +         +
Sbjct: 41  ---------NSRLPLASKDRNRSQSGFNLKQQLVQGHVGGGVMVGQNKSKRP--ASNSFV 89

Query: 120 TN--PRRLKKYGSVLGYN--ALPKMKSLVLKDVXXXXXXXXXXXXXXXX------XHILR 169
            N    +LKKYGSVLG N   L K KSLVLKD                          LR
Sbjct: 90  KNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDASDGSQDNGEESDDYDDEEGNPLAAKLR 149

Query: 170 LKLHNAIDRSDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPE 229
            +L + ++  +E+    G L        +      ++D  E  +IE  P++   L +IP 
Sbjct: 150 SRLTSGVEDENEDDGSSGLLLGGGLKKLIKLHESDNQDTEEVPQIETAPEKVPELEHIPN 209

Query: 230 GHLSLAQEDYDKLKTFRSPYLIEXXXXXXXXXKQDGFLQLEEIGSAGDDENIERENLTVK 289
           G+     E+  KL T+ SP+L             +G   L  +   G DE+  ++   + 
Sbjct: 210 GYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMA 269

Query: 290 QREMLPQYDTF---------EIQPSY-CGEGLDASDLNDLL 320
            +E +    T          EIQ S+  G+GL +++L  LL
Sbjct: 270 TQENIIANKTIVDELGTQADEIQFSFDIGKGLSSNELQSLL 310

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 93/247 (37%), Gaps = 66/247 (26%)

Query: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62
           +  +KEN++V  L E G    P TP  LLKR++S ++                       
Sbjct: 4   VETDKENNVVGTLREKG----PATPTQLLKRTRSTLL----------------------- 36

Query: 63  SPSRRVQQGRPPLASKDNN--RSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLT 120
            P +  Q  R PLASKD N  RS+ +              RN +Q K + A    G    
Sbjct: 37  -PKKNGQ--RQPLASKDKNYNRSSSYLSLK----------RNSNQKKLKPAVTRAGSTAN 83

Query: 121 NPRRLKKYGSVLGYNALPKMKSLVLKDVXX---XXXXXXXXXXXXXXXHILRLKLHNAID 177
           N  R              ++ SL+LKD+                    + L LK+  A+ 
Sbjct: 84  NANR--------------RVTSLILKDIASGDEKESASESDSEDDEESNPLALKIKQALT 129

Query: 178 RSDEEGEEVGGLFD-KSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQ 236
            S    E   GL + KSGL  +  D   D      REIE    R    PY PEG+  L  
Sbjct: 130 HSIASAEGKTGLLNGKSGLRKIFNDRDLD------REIEVASVREPEKPYEPEGYEPLDD 183

Query: 237 EDYDKLK 243
            D +KLK
Sbjct: 184 SDLEKLK 190

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 66/151 (43%), Gaps = 26/151 (17%)

Query: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62
           +N NKEN            + P+TP+  LKR  S ++K +   + + L  +  D P   +
Sbjct: 1   MNSNKENIF----------TAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNAS 50

Query: 63  SPSRRVQQGRPPLASKDNN-RSTGFXXXXXXXXXXXXXXRNLSQSKKRNANVVDGQLLTN 121
             +      R PLASKD N R T                 + + + K   N++       
Sbjct: 51  GIT-----ARRPLASKDKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMN---- 101

Query: 122 PRRLKKYGSVLGY--NALPK--MKSLVLKDV 148
             RLKKYGSVLGY  N +     K+L+LKD+
Sbjct: 102 --RLKKYGSVLGYSNNTINSNASKTLILKDI 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,398,081
Number of extensions: 1386072
Number of successful extensions: 3190
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3185
Number of HSP's successfully gapped: 38
Length of query: 322
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 212
Effective length of database: 40,868,139
Effective search space: 8664045468
Effective search space used: 8664045468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)