Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039108.264ON42942921330.0
ZYRO0C01606g8.264ON43240912241e-166
NDAI0B020008.264ON43340910611e-142
NCAS0B050308.264ON43341010551e-141
KLTH0G13640g8.264ON4144069641e-127
SAKL0H16984g8.264ON4354099641e-127
Kwal_56.237828.264ON4143999081e-119
Ecym_43068.264ON4344078661e-112
AGR084C8.264ON4274028641e-112
Kpol_543.408.264ON4144058291e-107
TPHA0A017908.264ON4394238101e-104
Smik_12.1498.264ON4604218081e-103
YLR090W (XDJ1)8.264ON4594208071e-103
KLLA0F19184g8.264ON5124098081e-102
Skud_12.1588.264ON4554167674e-97
Suva_10.1748.264ON4564177597e-96
KNAG0G020508.264ON4324126829e-85
CAGL0L12276g8.264ON4524356841e-84
KLTH0G08756g2.218ON4624273952e-42
AER427W2.218ON4704103892e-41
KLLA0F03333g2.243ON4093793844e-41
YNL064C (YDJ1)2.243ON4093893774e-40
ADL257C2.243ON4103863764e-40
Smik_14.2632.243ON4093883765e-40
KNAG0I019002.243ON4093963741e-39
CAGL0J09966g2.243ON4073803722e-39
NDAI0D010302.243ON4113873722e-39
Skud_14.2682.243ON4103853722e-39
Ecym_32812.243ON4093823712e-39
Suva_14.2772.243ON4093823695e-39
TBLA0E038102.243ON4103893688e-39
KAFR0J009402.243ON4113983679e-39
TDEL0C046002.243ON4113883661e-38
Kpol_1002.1222.218ON5034703683e-38
Kpol_1003.122.243ON4083843643e-38
ZYRO0A01496g2.243ON4123843591e-37
TDEL0C043502.218ON4624163593e-37
SAKL0E09306g2.218ON4613863541e-36
Kwal_23.30612.218ON4583833532e-36
SAKL0E08734g2.243ON4113833512e-36
KLLA0E07899g2.218ON4954593543e-36
TPHA0C031102.243ON4073873475e-36
CAGL0J10296g2.218ON4794353411e-34
Kwal_23.48302.243ON4113893372e-34
NCAS0G030002.243ON4103973345e-34
KLTH0G09394g2.243ON4113823311e-33
KNAG0M020202.218ON4603613304e-33
ZYRO0C15048g2.218ON4914503243e-32
YNL077W (APJ1)2.218ON5284333229e-32
NDAI0F024502.218ON5304343052e-29
ZYRO0A06226g8.730ON3773712956e-29
Skud_14.2532.218ON5324892991e-28
Ecym_53842.218ON5033982882e-27
NCAS0G028502.218ON4944342812e-26
KNAG0G028808.730ON3783742745e-26
TBLA0E036602.218ON4484022757e-26
Ecym_62368.730ON3743722711e-25
TPHA0G006308.730ON3933732711e-25
KAFR0A041608.730ON3783632613e-24
Kpol_1064.408.730ON3873672534e-23
NCAS0B005308.730ON3753662525e-23
KLLA0C07260g8.730ON3683632507e-23
Suva_13.3978.730ON3753582491e-22
CAGL0F03729g8.730ON3613612481e-22
KLTH0D12496g8.730ON3753552472e-22
SAKL0H05258g8.730ON3683592453e-22
YMR214W (SCJ1)8.730ON3773632421e-21
NDAI0E008708.730ON3763662411e-21
Kwal_26.90248.730ON3753632375e-21
Smik_13.4228.730ON3783642322e-20
Skud_13.3838.730ON3753592181e-18
AER346W8.730ON3673642154e-18
TDEL0B037908.730ON3733702154e-18
Smik_14.2492.218ON5333242032e-16
TPHA0D005508.61ON4863912032e-16
TBLA0B034908.730ON3843741899e-15
Smik_9.2037.157ON432701863e-14
Ecym_14508.61ON4923941837e-14
KNAG0G011308.61ON5003911811e-13
KNAG0I007407.157ON4251011811e-13
Ecym_44697.157ON4331041801e-13
TDEL0H022907.217ON387851782e-13
KLLA0D13464g7.157ON4331041782e-13
YIR004W (DJP1)7.157ON432671782e-13
NDAI0A028207.157ON4821011783e-13
Kwal_55.209657.157ON4211051773e-13
KLTH0A03740g7.217ON395981754e-13
Skud_9.1817.157ON421671755e-13
Ecym_43727.217ON579701765e-13
YNL227C (JJJ1)2.15ON590681766e-13
Smik_6.638.61ON5103931756e-13
Suva_14.1162.15ON600801767e-13
TBLA0C014801.398ON353701738e-13
KNAG0F008602.15ON6261181758e-13
TPHA0C029802.218ON554731758e-13
SAKL0F04444g7.157ON4291041749e-13
Suva_14.2622.218ON536731741e-12
NCAS0A132107.157ON4141011731e-12
KLTH0F13398g7.157ON4191051731e-12
Skud_14.1102.15ON596801741e-12
ZYRO0E04598g1.398ON357701711e-12
NDAI0G032808.61ON5524041731e-12
Suva_9.2137.157ON431671721e-12
NDAI0C026101.398ON340701711e-12
CAGL0J01936g7.157ON4251041721e-12
NDAI0G042501.398ON363701702e-12
KAFR0C031608.61ON4984011722e-12
CAGL0H03707g1.398ON349701692e-12
Kpol_529.212.15ON622661722e-12
KAFR0H031501.398ON359701683e-12
NCAS0G013602.15ON616731713e-12
YNL007C (SIS1)1.398ON352701683e-12
Kwal_0.2071.398ON353701683e-12
KLLA0E04423g7.217ON428701693e-12
Smik_14.3211.398ON366701683e-12
KLLA0D04818g1.398ON354701674e-12
KLTH0H12100g1.398ON350701674e-12
Suva_6.448.61ON5074011694e-12
Smik_14.1062.15ON593801694e-12
Kpol_457.151.398ON357681674e-12
TDEL0B059601.398ON369701675e-12
NDAI0E045607.217ON394851675e-12
Suva_14.3411.398ON359701665e-12
TBLA0J018707.157ON4701051685e-12
CAGL0J07370g2.15ON623831686e-12
ADR015W7.157ON4361041676e-12
Skud_14.3201.398ON368701666e-12
KNAG0H016801.398ON363701657e-12
Skud_6.568.61ON5174431678e-12
ZYRO0D16390g7.217ON398831659e-12
NCAS0E029307.217ON387881659e-12
NCAS0C048901.398ON367701641e-11
Ecym_12921.398ON347701631e-11
YFL016C (MDJ1)8.61ON5114431651e-11
TPHA0B037601.398ON355701631e-11
SAKL0D08778g1.398ON348701622e-11
TPHA0L007907.157ON446671642e-11
TBLA0E024907.217ON366671622e-11
AAL008W1.398ON349701622e-11
TDEL0H032107.157ON411671632e-11
TBLA0D042407.217ON389711622e-11
KLTH0B08338g2.15ON590791642e-11
ZYRO0G03850g7.157ON4181011613e-11
NDAI0F038002.15ON638641633e-11
KAFR0A079502.15ON551861614e-11
NCAS0G036101.398ON327701585e-11
Kwal_47.181337.217ON393991595e-11
ZYRO0F15400g2.15ON525781605e-11
KAFR0L007407.217ON364671586e-11
CAGL0J04224g8.61ON5223901596e-11
KAFR0B047807.157ON4231041586e-11
TBLA0G001702.15ON659661607e-11
SAKL0E14234g2.15ON678791598e-11
ZYRO0A07502g2.350ON238951538e-11
TPHA0C012607.217ON380981578e-11
Kpol_1070.227.217ON380711579e-11
Kpol_499.307.157ON408671579e-11
Skud_5.1587.217ON391861571e-10
CAGL0L00957g7.217ON373881551e-10
Kwal_23.44202.15ON592661571e-10
KLLA0D19602g2.15ON620681571e-10
Suva_5.1507.217ON391861542e-10
Skud_13.3232.350ON224681492e-10
Suva_12.1851.113ON168671462e-10
YMR161W (HLJ1)2.350ON224681493e-10
Kwal_23.3578singletonOFF85611393e-10
Kpol_1072.48.698ON661741543e-10
TBLA0D026008.61ON5103881533e-10
Smik_5.1737.217ON391861514e-10
Smik_15.4378.698ON663771535e-10
TBLA0B093802.350ON2271161466e-10
TBLA0A011007.157ON434671516e-10
YER048C (CAJ1)7.217ON391861507e-10
KAFR0H023108.698ON655741517e-10
Smik_13.3612.350ON224681458e-10
KNAG0I008602.350ON219701458e-10
Kpol_1011.98.61ON4953781491e-09
YOR254C (SEC63)8.698ON663771501e-09
ABL194C2.15ON552801491e-09
TDEL0G028002.350ON225691431e-09
Suva_8.3038.698ON664741482e-09
Suva_13.3402.350ON225681432e-09
KAFR0C024507.217ON3731101462e-09
NCAS0C012208.698ON669741482e-09
SAKL0F08052g7.217ON393981462e-09
Skud_10.3191.113ON168671392e-09
KLLA0C09823g8.698ON669741482e-09
AFR507W8.61ON474661472e-09
TBLA0B037308.698ON693741472e-09
KLTH0F09944g2.350ON2331121423e-09
TPHA0G014808.698ON660751473e-09
Skud_15.4208.698ON665741463e-09
KNAG0J018408.698ON650741463e-09
NDAI0H031802.350ON229691404e-09
CAGL0J02750g7.217ON382701444e-09
TPHA0C045902.350ON233691404e-09
KNAG0L013307.217ON396671434e-09
TPHA0O019402.15ON598661445e-09
Smik_10.3851.113ON172671365e-09
TDEL0E005002.15ON581681436e-09
NCAS0D009602.350ON224691386e-09
ZYRO0D10934g8.698ON663741428e-09
TDEL0C058801.113ON159691349e-09
Kwal_33.135331.113ON161671331e-08
ZYRO0F15972g1.113ON162681321e-08
Kpol_526.62.350ON2281161352e-08
CAGL0C04565g1.113ON175871322e-08
Ecym_56262.350ON243691342e-08
YJR097W (JJJ3)1.113ON172671303e-08
KNAG0A056502.350ON175701303e-08
Ecym_23748.698ON661741383e-08
KNAG0C024501.185ON544681374e-08
AEL112C1.185ON535741364e-08
KAFR0B048902.350ON2201031315e-08
KLLA0C02981g1.113ON162701285e-08
SAKL0E06050g2.350ON232681325e-08
TDEL0A064308.698ON666741365e-08
NDAI0D005001.113ON190731296e-08
CAGL0H04499g2.350ON232691316e-08
AFL190C2.350ON235691316e-08
SAKL0H05984g8.698ON658741356e-08
Ecym_80931.185ON543681348e-08
SAKL0C05456g1.185ON583681348e-08
CAGL0G07469g8.698ON668741331e-07
NCAS0C039508.61ON5193971312e-07
Ecym_11101.113ON156661232e-07
Kwal_26.88798.698ON656741312e-07
KLLA0E01629g2.350ON231681244e-07
KLLA0B07271g1.185ON653671285e-07
Kwal_33.138601.185ON578681275e-07
KLTH0F03124g1.113ON162931205e-07
KLLA0D06402g1.297ON631671267e-07
TDEL0D016401.297ON604861259e-07
TBLA0A057401.113ON1701211199e-07
ADR124C1.297ON611791251e-06
KAFR0A016201.297ON665661251e-06
CAGL0I06226g1.185ON455681241e-06
KLTH0G18546gna 1ON283861221e-06
TDEL0C036801.185ON556671241e-06
TDEL0C061001.92ON285971221e-06
CAGL0H02827g1.297ON656841241e-06
Kwal_14.24521.297ON6071011232e-06
SAKL0B01276gna 1ON292671212e-06
Kwal_47.179578.61ON4783911232e-06
KLTH0D11770g8.698ON652741232e-06
YJL162C (JJJ2)1.185ON583681222e-06
NCAS0I028301.185ON491671222e-06
SAKL0C03476g1.113ON165661162e-06
AAL103W8.698ON669741223e-06
Suva_6.2431.185ON565681213e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03910
         (429 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   826   0.0  
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   476   e-166
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    413   e-142
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    410   e-141
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   375   e-127
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   375   e-127
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   354   e-119
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   338   e-112
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   337   e-112
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   323   e-107
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   316   e-104
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   315   e-103
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   315   e-103
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   315   e-102
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   300   4e-97
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   296   7e-96
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   267   9e-85
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   268   1e-84
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   156   2e-42
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   154   2e-41
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   152   4e-41
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   149   4e-40
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   149   4e-40
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   149   5e-40
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   148   1e-39
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   147   2e-39
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   147   2e-39
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   147   2e-39
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   147   2e-39
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   146   5e-39
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   146   8e-39
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   145   9e-39
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   145   1e-38
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   146   3e-38
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   144   3e-38
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   142   1e-37
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   142   3e-37
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   140   1e-36
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   140   2e-36
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   139   2e-36
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   140   3e-36
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   138   5e-36
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   135   1e-34
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   134   2e-34
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   133   5e-34
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   132   1e-33
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   131   4e-33
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   129   3e-32
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   128   9e-32
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...   122   2e-29
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   118   6e-29
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   119   1e-28
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   115   2e-27
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    112   2e-26
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   110   5e-26
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   110   7e-26
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   108   1e-25
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   108   1e-25
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   105   3e-24
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   102   4e-23
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      101   5e-23
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   100   7e-23
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   100   1e-22
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   100   1e-22
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   100   2e-22
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    99   3e-22
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    98   1e-21
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    97   1e-21
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    96   5e-21
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    94   2e-20
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    89   1e-18
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    87   4e-18
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    87   4e-18
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    83   2e-16
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    83   2e-16
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    77   9e-15
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    76   3e-14
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    75   7e-14
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    74   1e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    74   1e-13
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    74   1e-13
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    73   2e-13
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    73   2e-13
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    73   2e-13
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    73   3e-13
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    73   3e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    72   4e-13
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    72   5e-13
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    72   5e-13
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    72   6e-13
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    72   6e-13
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    72   7e-13
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    71   8e-13
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    72   8e-13
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    72   8e-13
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    72   9e-13
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    72   1e-12
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    71   1e-12
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    71   1e-12
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    72   1e-12
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    70   1e-12
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    71   1e-12
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    71   1e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               70   1e-12
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    71   1e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    70   2e-12
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    71   2e-12
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    70   2e-12
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    71   2e-12
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    69   3e-12
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    70   3e-12
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    69   3e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    69   3e-12
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    70   3e-12
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    69   3e-12
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    69   4e-12
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    69   4e-12
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    70   4e-12
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    70   4e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    69   4e-12
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    69   5e-12
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             69   5e-12
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    69   5e-12
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    69   5e-12
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    69   6e-12
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    69   6e-12
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    69   6e-12
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    68   7e-12
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    69   8e-12
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    68   9e-12
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     68   9e-12
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     68   1e-11
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    67   1e-11
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    68   1e-11
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    67   1e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    67   2e-11
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    68   2e-11
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    67   2e-11
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    67   2e-11
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    67   2e-11
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    67   2e-11
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    68   2e-11
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    67   3e-11
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      67   3e-11
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    67   4e-11
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      65   5e-11
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    66   5e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    66   5e-11
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    65   6e-11
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    66   6e-11
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               65   6e-11
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    66   7e-11
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    66   8e-11
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    64   8e-11
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    65   8e-11
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    65   9e-11
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    65   9e-11
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    65   1e-10
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    64   1e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    65   1e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    65   1e-10
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    64   2e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    62   2e-10
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    61   2e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    62   3e-10
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    58   3e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    64   3e-10
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    64   3e-10
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    63   4e-10
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    64   5e-10
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    61   6e-10
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    63   6e-10
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    62   7e-10
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    63   7e-10
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    60   8e-10
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    60   8e-10
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    62   1e-09
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    62   1e-09
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    62   1e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    60   1e-09
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    62   2e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    60   2e-09
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    61   2e-09
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     62   2e-09
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    61   2e-09
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    58   2e-09
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    62   2e-09
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    61   2e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    61   2e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    59   3e-09
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    61   3e-09
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    61   3e-09
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    61   3e-09
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      59   4e-09
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    60   4e-09
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    59   4e-09
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    60   4e-09
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    60   5e-09
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    57   5e-09
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    60   6e-09
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    58   6e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    59   8e-09
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    56   9e-09
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    56   1e-08
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    55   1e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    57   2e-08
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    55   2e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    56   2e-08
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    55   3e-08
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    55   3e-08
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    58   3e-08
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    57   4e-08
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    57   4e-08
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    55   5e-08
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    54   5e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    55   5e-08
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    57   5e-08
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    54   6e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    55   6e-08
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    55   6e-08
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    57   6e-08
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    56   8e-08
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    56   8e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    56   1e-07
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    55   2e-07
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    52   2e-07
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    55   2e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    52   4e-07
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    54   5e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    54   5e-07
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    51   5e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    53   7e-07
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    53   9e-07
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    50   9e-07
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    53   1e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    53   1e-06
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    52   1e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    52   1e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    52   1e-06
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    52   1e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    52   1e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    52   2e-06
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    51   2e-06
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    52   2e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    52   2e-06
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    52   2e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    52   2e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    49   2e-06
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    52   3e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    51   3e-06
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    52   3e-06
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    51   3e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    51   3e-06
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    51   3e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    51   3e-06
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    51   4e-06
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    50   6e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    50   7e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    50   7e-06
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    50   7e-06
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    48   9e-06
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    50   9e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    47   9e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    50   1e-05
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    49   1e-05
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    49   1e-05
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    49   2e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    48   2e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    49   2e-05
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    48   3e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    48   3e-05
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    48   3e-05
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    48   3e-05
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    48   4e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    48   4e-05
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    47   5e-05
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    47   5e-05
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       47   5e-05
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    47   5e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    46   6e-05
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    47   7e-05
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    47   8e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    46   1e-04
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    46   1e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    45   1e-04
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    46   1e-04
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    46   1e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    44   1e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    46   1e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    44   2e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   3e-04
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    45   3e-04
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    45   3e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    45   4e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    44   4e-04
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    44   5e-04
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    44   5e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    42   6e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    44   6e-04
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    44   6e-04
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    44   7e-04
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    44   8e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    43   9e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    43   0.001
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    43   0.001
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    42   0.002
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    42   0.002
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    42   0.002
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    41   0.003
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    40   0.007
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    40   0.008
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    40   0.008
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    39   0.009
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    40   0.010
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    39   0.016
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    39   0.016
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    39   0.018
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    39   0.020
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    38   0.031
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    38   0.032
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    38   0.035
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    38   0.038
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.068
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    37   0.068
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    36   0.14 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    36   0.14 
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         36   0.14 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    36   0.16 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    35   0.19 
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    35   0.21 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    35   0.30 
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    34   0.47 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    34   0.47 
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    34   0.48 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    33   1.1  
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    33   1.1  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    33   1.3  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    33   1.3  
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    33   1.7  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    32   1.8  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    33   1.8  
NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {O...    33   2.0  
KLLA0F24156g Chr6 (2251454..2254276) [2823 bp, 940 aa] {ON} simi...    33   2.1  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   2.1  
TPHA0P01440 Chr16 (295961..298696) [2736 bp, 911 aa] {ON} Anc_3....    33   2.3  
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    32   2.6  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    32   2.6  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    32   3.3  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    32   3.5  
Kpol_1014.13 s1014 (23928..26651) [2724 bp, 907 aa] {ON} (23928....    32   3.5  
KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {...    32   4.0  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   6.3  
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    31   6.6  
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    31   6.9  
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    30   7.7  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    30   7.8  
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    30   8.3  
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    30   8.9  

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/429 (93%), Positives = 402/429 (93%)

Query: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60
           MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD
Sbjct: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60

Query: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQ 120
           EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQ
Sbjct: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQ 120

Query: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR 180
           VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR
Sbjct: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR 180

Query: 181 IRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSR 240
           IRRLAPGFATTENITCPTCDGKGKCAS            VGTGVTTESKSLTVSLPRGSR
Sbjct: 181 IRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSR 240

Query: 241 QDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITG 300
           QDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITG
Sbjct: 241 QDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITG 300

Query: 301 FSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPDNW 360
           FSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPDNW
Sbjct: 301 FSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPDNW 360

Query: 361 FSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEIXXXXXXXXXXXXXXXKA 420
           FSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEI               KA
Sbjct: 361 FSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEIPDPSQDDRFRSRDDDKA 420

Query: 421 NDFPGCAQQ 429
           NDFPGCAQQ
Sbjct: 421 NDFPGCAQQ 429

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  476 bits (1224), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 238/409 (58%), Positives = 297/409 (72%), Gaps = 18/409 (4%)

Query: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
           +LY+ LGV  DATQ+EIKKAYRK ALQHHPDKV D+S+REESEVRFKEI AAYEVL DEE
Sbjct: 2   SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61

Query: 63  KRARYDKYGD-ADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKV-----DRS 116
           KR++YD YGD ADG DF       ED +FMNFF  F S         G         DRS
Sbjct: 62  KRSKYDTYGDTADGPDF-------EDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRS 114

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQG 176
            DVQVPL VSMADCYNGK FKFQSKR +VC++C GSGWRRR+    PPPQ  CK C G+G
Sbjct: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGG--PPPQTNCKSCQGRG 172

Query: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLP 236
           +K+++RR+APG    + ++C  C GKGK  S             G G+  E+K LTVS+P
Sbjct: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232

Query: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296
           RGSR  D+IV +GEADQEVGKS+TG+L+F + EGTE PEGV L+R G+DLIT++++SLAE
Sbjct: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292

Query: 297 AITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDT--TTSGDLYVVVHIE 354
           AITG  +TLTKTLDGR+L+L  P GKVI PG II++  EGWP+++  T  GDLYV+V I 
Sbjct: 293 AITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352

Query: 355 FPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEI 403
           FP DNWF+E+SDL +++N+LP E  NN  V+ DPGNTE V+++ +V+++
Sbjct: 353 FPRDNWFAEKSDLLKIRNILPSEAANN-DVKADPGNTEQVSDMKLVDQL 400

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  413 bits (1061), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/409 (51%), Positives = 276/409 (67%), Gaps = 16/409 (3%)

Query: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60
           M+ LY ILGV   AT  EIKKAYRK ALQ+HPDKV D + REE+E++FKEI +AYE+L D
Sbjct: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60

Query: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQ 120
           EEKRA YD YGDA+        NE+ +    +FF+     P   YD Y     D+S DV+
Sbjct: 61  EEKRAHYDLYGDAN-------ENEYNNQNANDFFNFETDQPD--YDSYAFDN-DKSKDVK 110

Query: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQGFKQ 179
           +PL +S+ + YNGK+FKFQSKR ++C +C G GWRRR N +V  P ++ECKKC G G+K+
Sbjct: 111 IPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKE 170

Query: 180 RIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGS 239
           R R L PGF TT+ I C  C GKG+  +             G G+ +E+K L VS+PRG 
Sbjct: 171 RTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGL 230

Query: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299
           +  D I ++ EADQE+GKS+TG+++  I+E T  P  V   R G D + +L+LSLAEA+T
Sbjct: 231 QNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALT 290

Query: 300 GFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFP 356
           GF  K L+K+LDGRIL L +P GKVIRPGNII+I  EGWP++   S  GDLYV++ IEFP
Sbjct: 291 GFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFP 350

Query: 357 PDNWFSERSDLTQVKNVLPGETNN--NAAVEDDPGNTETVTNINIVEEI 403
           PDNWFSE+SD+  ++NVLP   N   N+   DDP NTETVT  +I+EE+
Sbjct: 351 PDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEEL 399

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  410 bits (1055), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/410 (51%), Positives = 275/410 (67%), Gaps = 16/410 (3%)

Query: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESL--REESEVRFKEIAAAYEVL 58
           M+ LY +LGV  +AT  +IKKAYRK ALQHHPDKV + +   RE SE++FKEI+AAYE+L
Sbjct: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60

Query: 59  GDEEKRARYDKYGDADGSDFFNGP-NEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSA 117
            DE+KRA YD YG  +         + FE  +F NF        +    HY + K  RS 
Sbjct: 61  SDEDKRAHYDLYGSEEEQQRQQRQYDPFE--SFFNF-----EQDEEPSRHYEDPK--RSP 111

Query: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQG 176
           DV++PL +++ + YNGK+FKF+ KR ++CD C G GWRRR N  V  PP+VECK C GQG
Sbjct: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171

Query: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLP 236
           F +++R LAPGFAT E   C  CDGKGK  +             G G+  ESK LTVS+P
Sbjct: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231

Query: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296
           RG R  D I +  EADQE+GK +TG+L+F+I+E   CP+ V L+R G + +T L +SLAE
Sbjct: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291

Query: 297 AITGFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYVVVHI 353
           A+TGF  K +TKT DGRIL L IPPGKVIRPGNII+I  EGWP+  + T  GDLY+ V+I
Sbjct: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351

Query: 354 EFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEI 403
           EFPPDNWF+E+SDLTQ+KN+LP  T++   + DDP NTE +    ++E +
Sbjct: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETL 401

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  375 bits (964), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 201/406 (49%), Positives = 264/406 (65%), Gaps = 26/406 (6%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE LGV  DATQ EIKKAYR+ ALQHHPDKV+DESLR+ESE++FKE+AAAYE+L +EEKR
Sbjct: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQK--VDRSADVQVP 122
             YD YGD +G  F    + F+D  F +FF +F SN     D Y  Q     R+ D  VP
Sbjct: 64  QNYDTYGDTNG--FSGDYSGFQDGDFASFFGNFASN--RYQDEYEAQSPPSPRTDDAHVP 119

Query: 123 LNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIR 182
           + ++M + YNGK+ +FQ+KR +VC+RC G+G RRR  H        C +C G G KQR+R
Sbjct: 120 IRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASA-----CSQCEGHGVKQRLR 174

Query: 183 RLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQD 242
           RL PGF T E + C  C G GK                G  VT ESK+L V +PRGSR  
Sbjct: 175 RLGPGFVTREIVQCDKCKGLGK----NLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230

Query: 243 DQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFS 302
           D++VLKGEAD+E GK   G+LVF I E +       L+R G DL   +T+SL++A+TGF 
Sbjct: 231 DRVVLKGEADEEPGKI-PGDLVFDIAENS---ASSSLERRGSDLYAKITISLSDALTGFE 286

Query: 303 KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFPPDNW 360
           K +  TLDGR+L+L++P G+V+RPGN ++I +EGWP+D   S  GD+YV + IEFPPD+W
Sbjct: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346

Query: 361 FSERSDLTQVKNVLPGETNNNA-----AVEDDPGNTETVTNINIVE 401
           FSERSD+  ++N+LP   +++A     A   DP NTET    +IV+
Sbjct: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVK 392

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  375 bits (964), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 207/409 (50%), Positives = 269/409 (65%), Gaps = 16/409 (3%)

Query: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60
           M+ LYE+LGV  DA+Q EIKKAYRK ALQHHPDKVADE LREESE++FKEI AAYE+L D
Sbjct: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60

Query: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHS-----FGSNPQNAYDHYGEQKVDR 115
           E+ R +YD YGD        G + F D  FMNFF +     F   P+  Y     + V R
Sbjct: 61  EDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSV-R 119

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGG 174
           ++D ++PL +SM + YNGK+FKF+SKR ++CDRC GSG R++   H  P   V C+ C G
Sbjct: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQH--PRKPVVCQSCEG 177

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
            G K+RI+R+A GF   E + C  C+GKG+                G  V +E K+LTV 
Sbjct: 178 HGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCH--GKCVISEEKTLTVY 235

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +PRGSR  D + L+GEADQE  K  TG+L+F I+E  E     +L+R G DL T L +SL
Sbjct: 236 IPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPET--STNLERRGDDLHTRLKISL 292

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVH 352
           +EAITGF K +T TLD RIL+L+IP GKVIRPGN I++ +EGWP+D + +  GD+YV VH
Sbjct: 293 SEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVH 352

Query: 353 IEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVE 401
           IEFPPDNWFSE+SD+  ++ +LP   N   A   D  NTETV + ++V+
Sbjct: 353 IEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVK 401

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  354 bits (908), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 258/399 (64%), Gaps = 24/399 (6%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LGV  DATQ EIKKAYR+ ALQHHPDKV+DESLREESE++FKE+AAAYE+L +EEKR
Sbjct: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 65  ARYDKYGDADG-SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVPL 123
             YD YGD +G SD + G   F+D  F +FF +F S      + +      R+ D  V L
Sbjct: 64  RNYDTYGDTNGYSDSYGG---FQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120

Query: 124 NVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRR 183
            ++M D YNGK+ +FQS R +VC+RC G+G R+R  H        C  C G G KQR+RR
Sbjct: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASA-----CTHCEGHGVKQRLRR 175

Query: 184 LAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDD 243
           L PGF T E + C  C G GK                G  VT E+K+L V +PRGSR +D
Sbjct: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCH----GKRVTPETKNLNVYIPRGSRHND 231

Query: 244 QIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSK 303
           +IVL+GEAD+E GK  TG+LVF I E +      +L+R G DL T + +SL++A+TGF K
Sbjct: 232 RIVLEGEADEEPGK-LTGDLVFDISEDSTTS---NLERRGSDLHTKIIISLSDALTGFEK 287

Query: 304 TLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFPPDNWF 361
            +  TLDGR L+L+IP G+VIRPGN I + +EGWP+D      G++YV ++IEFPPD+W+
Sbjct: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWY 347

Query: 362 SERSDLTQVKNVLP-----GETNNNAAVEDDPGNTETVT 395
           SER ++  ++N++P        +++A+ E DP NTE  T
Sbjct: 348 SERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTEMPT 386

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  338 bits (866), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 174/407 (42%), Positives = 262/407 (64%), Gaps = 17/407 (4%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY +LG++ +AT+ E+K+AYR  AL +HPDK++DES R ESE +FKEI+AAY++L DE+K
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 64  RARYDKYGDADGSDF----FNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADV 119
           R+ YD YG  D   F    F+   +  +  FMNFF  +G+     Y+   ++   ++ D 
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFR-YGAGRYGQYEDAEQKTSQKTKDF 123

Query: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQ 179
            VPL +S    Y GK+F+F+ KR ++C +C G G R+R  H +P   ++C  C G+GFK+
Sbjct: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP---MKCGICDGRGFKE 180

Query: 180 RIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGS 239
           R+ R++PGF + E + C  CDGKG   S             G  V  E+  LT+ +PRG 
Sbjct: 181 RVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCH--GKCVIVENSILTLYVPRGH 238

Query: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299
           R  D I + G+AD E GK +TG+LVF I E T+ P+  +L+R G DL   +T+SLAEA+T
Sbjct: 239 RHADTIRIDGQADMEAGK-ETGDLVFEIDEITD-PD-AELERKGTDLHCSITISLAEALT 295

Query: 300 GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEFPPD 358
           GF++ + +T D R+L++ IP GKV+RPGN ++  +EGWPI+  +  GDLYV V+IEFP D
Sbjct: 296 GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKD 355

Query: 359 NWFSERSDLTQVKNVLPGETNNNAAVE---DDPGNTETVTNINIVEE 402
           NW +E+S+L  +K++LPG  N++ + +   DDP NTE + +  ++++
Sbjct: 356 NWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQD 402

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  337 bits (864), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/402 (43%), Positives = 258/402 (64%), Gaps = 18/402 (4%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LYE+LG+   A++ E+K+AYR+ AL++HPDK++DES RE SE +FKEI+AAY VL DE+K
Sbjct: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 64  RARYDKYGDADGSDFFNGPNEF--EDAAFMNFFHSFGSNPQNAYDHYGE--QKVDRSADV 119
           RA YD++G  DG     G +EF   D  FMNFF  +G+  ++ Y H  +  ++V R+AD 
Sbjct: 65  RAEYDQFGTVDGG---YGHDEFGHGDDDFMNFFR-YGAG-RHGYQHEEDDFEEVGRTADS 119

Query: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQ 179
            VPL ++    Y GK+F+F+++R ++C RC GSG R+R       P + C+ C GQG+K+
Sbjct: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKR---AAARPMIRCEGCEGQGYKE 176

Query: 180 RIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGS 239
           RI R+ PG  + E ++C  C GKGK                G  V  E   ++V +PRGS
Sbjct: 177 RISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234

Query: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299
           +  D++   G++D E GK +TG+LVF I E T+      L+R G DL   + +SLAEA+T
Sbjct: 235 QHGDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSS--SLERKGTDLYCTMKISLAEALT 291

Query: 300 GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGDLYVVVHIEFPPD 358
           GF++ +T+T D R+L++ IP GKV+RPGN ++  +EGWPI D    GD+YV V IEFP D
Sbjct: 292 GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKD 351

Query: 359 NWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIV 400
           NWF+E+++L  ++N+LPG  +  +   +DP NTE V   +I+
Sbjct: 352 NWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSII 393

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  323 bits (829), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 175/405 (43%), Positives = 241/405 (59%), Gaps = 30/405 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YEILGV  DAT  EIKK YRK ALQ+HPDK  DE  +  +E++FK+I AAY+ L DE+KR
Sbjct: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYD-HYGEQKVDRSADVQVPL 123
             YD                       NF   F S+  N +D +Y  +   RS D++V L
Sbjct: 74  NEYDNK--------------------KNFEPYFESDFANNHDGNYNSRYRSRSKDIKVEL 113

Query: 124 NVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRND-HVVPPPQVECKKCGGQGFKQRIR 182
           ++  ++ YNGK+ KF + R  +C  C G GWR + D     PP++EC+KC GQG+K    
Sbjct: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173

Query: 183 RLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQD 242
           +LAPGF TT+N+ C  C G GK                G  +      + VS+PRGS   
Sbjct: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233

Query: 243 DQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGF- 301
           D I+LKGEAD+E+GK   G+L+F I E  +     DL+R+G  LI H  +SLAEAITGF 
Sbjct: 234 DNIILKGEADEELGKKNAGDLIFEINEIID--SNNDLERYGNHLINHTHISLAEAITGFE 291

Query: 302 SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDT--TTSGDLYVVVHIEFPPDN 359
           +K + KT D R L L  P GKVIRPG+I+++ +EGWP+D    + G+LYV++ IEFPPDN
Sbjct: 292 NKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDN 351

Query: 360 WFSERSDLTQVKNVLPGE-TNNNAAVEDDPGNTETVTNINIVEEI 403
           W +E++D+ +++N+LP E T  N  V  DP N+E ++   IV+ +
Sbjct: 352 WINEKNDIIKIRNILPNEKTKRNNIV--DPINSEYISTFEIVKSL 394

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  316 bits (810), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/423 (41%), Positives = 260/423 (61%), Gaps = 50/423 (11%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVA-----DESLREESEVRFKEIAAAYEVL 58
           LY IL V+   TQ E+KK YRK AL++HPDKV      ++ ++ E E++FKEI +AYE+L
Sbjct: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 59  GDEEKRARYD---KYGDAD-GSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
            DEEKR +YD    + DA+ GSD+ +G N            +FG+               
Sbjct: 72  SDEEKRKQYDLQKNFRDANQGSDYGDGIN-----------TAFGNQT------------- 107

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCG 173
            S D+ +PL V++ D YNGK  ++  KR ++C++C+G GWR R+N     PP  ECK C 
Sbjct: 108 -SKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166

Query: 174 GQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           G G+KQ  +++APGF T +N+ C  CDGKG+                G G+   S+S+TV
Sbjct: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHG-FDLITHLTL 292
           ++PRGS   D I++  +ADQE+GK +TG+L+F ++E  +  E   L+R+G  DLIT LT+
Sbjct: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD--EQTALKRYGDKDLITELTI 284

Query: 293 SLAEAITGFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYV 349
           SLA+AITGF  K + KTLDGR+L+L IP GKVIR G+I+++  EGWP+  + T SGDLY+
Sbjct: 285 SLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYI 344

Query: 350 VVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDD---------PGNTETVTNINIV 400
             +IEFP DNW SE +D+ +++N+LP  ++  A +  D           N+E ++N + V
Sbjct: 345 KFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFV 404

Query: 401 EEI 403
           +++
Sbjct: 405 KDL 407

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  315 bits (808), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/421 (42%), Positives = 255/421 (60%), Gaps = 26/421 (6%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY++LGV  DA+  EIK AYRK AL+HHPDK  D++ +E +E++FKEI AAYE+L D EK
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSF-------GSNPQNAYDHYGEQKVDRS 116
           ++ YD YGD  G+    G + F D  FMNFF++F       G++    YD Y E K   S
Sbjct: 70  KSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCKSS 129

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQ 175
            D+ + + +++ D Y GK  KF+ KR +VC  C GSGW+ ++  HV    +VEC+ CGG+
Sbjct: 130 KDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVT--HEVECESCGGK 187

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
           G K+R++R  PG   ++ +TC  C GKGK                G G+ ++ + +TV++
Sbjct: 188 GSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNV 247

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLITH 289
             G   +D I +KG AD+E+ KS  G+L F + E  E  E   +    F      DL T 
Sbjct: 248 APGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTS 307

Query: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGD 346
            T+SL+EA+TGF K LT+T D R+L L I PG+VIRPG++I+I +EGWPI        GD
Sbjct: 308 ATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGD 367

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLPG------ETNNNAAVED-DPGNTETVTNINI 399
           LYV +HIEFPPDNWF+E+S+L  +K +LP       +T  N   +D +P N ET++N  I
Sbjct: 368 LYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQI 427

Query: 400 V 400
           +
Sbjct: 428 I 428

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  315 bits (807), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/420 (42%), Positives = 254/420 (60%), Gaps = 25/420 (5%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY++LGV  DAT  EIK AYRK AL+HHPDK  D+  +E +E++FKEI AAYE+L D EK
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSF-------GSNPQNAYDHYGEQKVDRS 116
           ++ YD YGD +G+    G N F D  FMNFF++F       G+N    YD Y E     S
Sbjct: 70  KSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSS 129

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQ 175
            D+ + +++++ D Y GK  KF  KR ++C +C GSGW+ +R  HV     VEC+ C G+
Sbjct: 130 KDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVT--HDVECESCAGK 187

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
           G K+R++R  PG   ++ + C  C+GKGK                G G+ ++ + +TV++
Sbjct: 188 GSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNV 247

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLITH 289
             G   +D I +KG AD+E+ K+  G+L F + E  E  E   +    F      DL T 
Sbjct: 248 APGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTS 307

Query: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT---TSGD 346
           +T+SL+EA+TGF K LTKT D R+L L + PG+V+RPG+ I+I +EGWPI        GD
Sbjct: 308 ITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGD 367

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLPGETN--NNAAV--EDDPG--NTETVTNINIV 400
           LYV VHIEFPPDNWF+E+S+L  +K  LP  ++  ++A V  EDD    N ET++N  I+
Sbjct: 368 LYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRII 427

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/409 (41%), Positives = 246/409 (60%), Gaps = 23/409 (5%)

Query: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
           T Y++LGVE DAT++EI+KAYRK AL++HPDK+ DE+ RE SE  FKE+ AAYE+L D E
Sbjct: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131

Query: 63  KRARYDKYGD----ADGSDFFNGPNEFEDAAFMNFFHSFGSN---PQNAYDH---YGEQK 112
            ++RYD YGD    + G+ F    +EF+D  FMNFF  +      P  +Y +   YGE +
Sbjct: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPE 189

Query: 113 VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKC 172
             R+ D ++   ++    Y GK+  FQ KR  +C  C G+G R+++      P++ C  C
Sbjct: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH---FQKPEISCTSC 246

Query: 173 GGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLT 232
            GQGFK+RI RLA G+   ++  C  C GKG+                G G+  E KS T
Sbjct: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCS--GKGLINEEKSQT 304

Query: 233 VSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTL 292
           V +PRGSR  D+  L   AD E GK +TG+++  I E +       L+R   DL T L +
Sbjct: 305 VYIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDS---SKSHLERKSNDLHTTLNI 360

Query: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVV 351
           SL +A+TGFS  + +T D R L++ +P GKVIRPGN  +   EGWP+    S GD+YV +
Sbjct: 361 SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQI 420

Query: 352 HIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIV 400
           +IEFP DNWF+E+S++T ++N+LPG  + +   + DP NTE V + +++
Sbjct: 421 NIEFPKDNWFNEKSEITALRNILPGLKSKDTK-DPDPLNTEDVLSYSVL 468

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  300 bits (767), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 173/416 (41%), Positives = 251/416 (60%), Gaps = 21/416 (5%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY +LGV  DA   EIK AYRK AL+HHPDK  D+  ++ +E++FKEI AAYE+L D EK
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSF-------GSNPQNAYDHYGEQKVDRS 116
           ++ YD YGD +G+    G + F +  FMNFF++F       G+   N Y  Y +     S
Sbjct: 70  KSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSASS 129

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQ 175
            D+ + ++++M D Y GK  +F  KR +VC +C GSGW+ ++  HV    +VEC+ CGG+
Sbjct: 130 KDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVT--HEVECESCGGK 187

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
           G K+R++R  PG   ++ + C  C GKGK                G G+ ++ + +TV +
Sbjct: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTE--CPEGVDLQRHG----FDLITH 289
             G   +D I ++G AD+E+GK+  G+L F + E  E    + V L+  G     D    
Sbjct: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307

Query: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGD 346
           +T+SL+EA+TGF K LTKT D R+L L I PG+VIRPG++++I +EGWPI        GD
Sbjct: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVED--DPGNTETVTNINIV 400
           LYV +HIEFPPDNWF+E+S+L  +K  LP  ++++ A  D  D  N ETV+N  I+
Sbjct: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQII 423

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  296 bits (759), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 167/417 (40%), Positives = 247/417 (59%), Gaps = 22/417 (5%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY++LGV  +A+  EIK AYRK AL+HHPDK  D+  +E +E +FKEI AAYE+L D EK
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY----DHYGEQKVDRSADV 119
           ++ YD YGD +G+   +   + +   F N F + G++  N +    + Y   +   S D+
Sbjct: 70  KSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDI 129

Query: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQGFK 178
            + L+ +M D Y GK  KF+ KR ++C +C GSGW+ ++  HV    ++EC+ CGG+G K
Sbjct: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT--HEMECESCGGKGSK 187

Query: 179 QRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRG 238
           +R++R  PG   ++ + C  C GKGK                  G+  + + +TV++P G
Sbjct: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247

Query: 239 SRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLITHLTL 292
              +D + +KG AD+E+ K+  G+L+F + E  E  +   +    F      DL   +T+
Sbjct: 248 HHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITV 307

Query: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGDLYV 349
           SL+EA+TGF K LT+T D R+L L I PGKVIRPG+II+I +EGWPI        GDLYV
Sbjct: 308 SLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYV 367

Query: 350 VVHIEFPPDNWFSERSDLTQVKNVLPGETNN------NAAVEDDPGNTETVTNINIV 400
            V IEFPPDNWF+E+S+L  +K  LP  T+       N   ++ P N+ETV+N  I+
Sbjct: 368 FVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQII 424

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  267 bits (682), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 233/412 (56%), Gaps = 29/412 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ILGV+ D+T  EI+KAYRK AL+ HPDKV D   +  +E++FKEI  AYE+L + E  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFF------HSFGSNPQNAYDHYGEQKVDRSAD 118
              ++  +  G  F  G +      FMNFF      H  G +PQ   +   E        
Sbjct: 67  EEMEEEYEGQGYGFNFGDD------FMNFFNEGRNAHPMGGHPQREDESTNEA------- 113

Query: 119 VQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQGF 177
            Q+ + V++ D YNGK+ KFQ  R ++C  C G+ WRRR N  +  PP + C KC G G+
Sbjct: 114 TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGY 173

Query: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPR 237
            +R+   +P F   + I+C  C GKG+  +             G G+  E + L V++PR
Sbjct: 174 VERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPR 233

Query: 238 GSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVD----LQRHGFDLITHLTLS 293
           GS   + I+ K + D+++   + G++VF +K   E P G D    + + G DL  ++ + 
Sbjct: 234 GSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDE-PNGGDPDILVTKEGTDLHMNIEIP 292

Query: 294 LAEAITGF-SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYVV 350
           L EAI+G   + LTKT D R+L+L +P GKV+RPG+ I I  EGWP   + T  GD++V 
Sbjct: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352

Query: 351 VHIEFPPDNWFSERSDLTQVKNVLP-GETNNNAAVEDDPGNTETVTNINIVE 401
           V++EFPPDNW SER+D+T + NVLP G++++  A   D  N E V +  I++
Sbjct: 353 VNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILK 404

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  268 bits (684), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 170/435 (39%), Positives = 240/435 (55%), Gaps = 54/435 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES-----EVRFKEIAAAYEVLG 59
           Y +LGV  DA+Q EIK+AYRK AL+HHPDK       E+S     +V FKE+ AAY+VL 
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 60  DEEKRARYDK--------YGDADGSDFFNGPNEFEDAAFMNFFHSF--GSNP--QNAYDH 107
           D   RA YD+        YGD D               FMNFF  F  GS+P  ++ +D 
Sbjct: 64  DASLRAEYDQKLAFEAQPYGDDD---------------FMNFFSGFNGGSHPGHRSGFDS 108

Query: 108 YGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQV 167
               +  +S D+++ L V  ++ Y GK   F  KR   C RC G+GW+  +  +V     
Sbjct: 109 GRGARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKS-HASIVKKKTA 167

Query: 168 E-----CKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGT 222
           +     C+ C GQG +QR+R+LAPGF TTE I C  C GKGK  +            + +
Sbjct: 168 KFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITS 227

Query: 223 ---GVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDL 279
              G+  E+K +T+++ +G+   D+IVLKGEAD+++  ++ G+LV  I+E  E P+  D+
Sbjct: 228 GTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKE-PQ-YDI 285

Query: 280 QRHGFDLITHLTLSLAEAITGF-SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP 338
            R+G+DLI    + LA+AI GF  K L +T DGR+L+     GKVIRP +I++I +EGWP
Sbjct: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345

Query: 339 I-----DTTT---SGDLYVVVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPG- 389
                 D  T   +GDLYV+V I FPPDNW  E +D   V+N++P   N   +       
Sbjct: 346 RREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESI 405

Query: 390 -NTETVTNINIVEEI 403
            N E +    IV+EI
Sbjct: 406 LNVENINVSEIVKEI 420

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  156 bits (395), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 115/427 (26%), Positives = 190/427 (44%), Gaps = 51/427 (11%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           S LY+ILGV   A++ +IKKAYR  AL+HHPDK       EES+++F++I  AYE+L DE
Sbjct: 7   SELYDILGVSASASRQDIKKAYRVNALKHHPDKNGHS---EESKLKFQQICKAYEILKDE 63

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAA-------FMNFF-------------HSFGSNP 101
            KR  YD++G AD S +      +++ +       F  FF              SF    
Sbjct: 64  RKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKR 123

Query: 102 QNAYDHYGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHV 161
           Q A+     +++ R  D++  L  ++ + Y+GK  K   KRT +C +C G G  + +   
Sbjct: 124 QGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKAS--- 180

Query: 162 VPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVG 221
                 +C  CGG+G +   +R  P    T + TC  C G+G                 G
Sbjct: 181 ------QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQKDICRDCN----G 229

Query: 222 TGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQT------GNLVFTIKEGTECPE 275
            G   E +   + + +G     ++VL GEAD+ VG          G+++  ++   + P 
Sbjct: 230 QGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILE---QLPH 286

Query: 276 GVDLQRHGFDLIT-HLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPH 334
               +     L+  H  + L  ++ G    +     G++L++ + PG++++PG I  +  
Sbjct: 287 KAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEG 346

Query: 335 EGWPIDTTTSGDLYVVVHIEFP----PDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGN 390
            G P      G+LY+   + FP    P+   + R+ L Q      G      AVE     
Sbjct: 347 MGMPKSGGRFGNLYIRFDVAFPESLKPETVEALRAALGQEPGANSGAGEPAVAVEGREVE 406

Query: 391 TETVTNI 397
              ++N 
Sbjct: 407 EHVLSNF 413

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  154 bits (389), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/410 (29%), Positives = 180/410 (43%), Gaps = 67/410 (16%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY++LGV+   +  E+KK+Y+ AAL++HPDK       E S+ RF++IA AY VLGDE  
Sbjct: 7   LYDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHS---EASKQRFQQIADAYRVLGDERL 63

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDH-------------YGE 110
           R  YD+YG  D         E    A     H+ G  P + + H             +GE
Sbjct: 64  RKIYDRYGTVD-------EGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGE 116

Query: 111 --------QKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVV 162
                    +V R  D++  L  ++ + Y GK  +    RT +C  C G G  R +    
Sbjct: 117 SGASSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAS---- 172

Query: 163 PPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGT 222
                 C  C GQG   + +R       T + TC  C G G                 G 
Sbjct: 173 -----TCTACSGQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVKDCDTCTSCG----GA 222

Query: 223 GVTTESKSLTVSLPRGSRQDDQIVLKGEADQEV----GKSQT--GNLVFTIKEGT----- 271
           G   E K   V +  G R   ++V  GEAD+ V    GK Q   G+L  TI+E T     
Sbjct: 223 GYLRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRY 282

Query: 272 ECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQ 331
           +C    +L      L+T L + L  ++ G +  +     G+++QL+I PG+++ PG I  
Sbjct: 283 QCRGDANL------LLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKC 336

Query: 332 IPHEGWPI--DTTTSGDLYVVVHIEFPPDNWFSERSDLTQVKNVLPGETN 379
           I H G P   D +  G L++  H++FP        S +T +   L  +TN
Sbjct: 337 IEHLGMPHPDDPSQYGHLFIKFHVDFPKT---LADSTITAIAQALDADTN 383

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  152 bits (384), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 187/379 (49%), Gaps = 37/379 (9%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++LGV   A   +IKKAYRK+AL+ HPDK    +  EE+  +FKEI +AYE+L D 
Sbjct: 5   TKLYDLLGVSPGADDNQIKKAYRKSALKFHPDK----NPSEEAAEKFKEITSAYEILSDS 60

Query: 62  EKRARYDKYG----DADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSA 117
           +KR  YD++G       G+    G   F +  F  FF    S P+      G QK     
Sbjct: 61  QKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPR------GPQK---GR 111

Query: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGF 177
           D++  +  ++   + G++ K    + L+C  C G G +  +         +C  C GQGF
Sbjct: 112 DIRHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVK-------KCTACSGQGF 164

Query: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPR 237
           K   R++ P     + + C +C G G+                G  V  E K L V++  
Sbjct: 165 KFVTRQMGPMIQRFQ-VECESCHGAGEIIDPKGRCKVCS----GKKVVNERKVLEVNIEP 219

Query: 238 GSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEA 297
           G +   +IV +GEADQ  G    G++VF +   +E P  V  +R G DL     + L  A
Sbjct: 220 GMKDGQRIVFQGEADQSPG-IIPGDVVFVV---SEQPHPV-FKRDGNDLHYDAEIDLLSA 274

Query: 298 ITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEFP 356
           I G  +   K + G  L+++I PG+VI PG++  I  +G PI      G+L +  +I+FP
Sbjct: 275 IAG-GQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIKFNIKFP 333

Query: 357 PDNWFSERSDLTQVKNVLP 375
           P + F++   L +++ +LP
Sbjct: 334 PAH-FTDDETLKKLEEILP 351

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  149 bits (377), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 184/389 (47%), Gaps = 54/389 (13%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV + AT +EIKKAYRK AL++HPDK    +  EE+  +FKE +AAYE+L D 
Sbjct: 5   TKFYDILGVPVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASAAYEILSDP 60

Query: 62  EKRARYDKYGDADG-------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
           EKR  YD++G+ DG         F  G   F D  F  FF + G     A    G Q   
Sbjct: 61  EKRDIYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGG-----AQRPRGPQ--- 111

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           R  D++  ++ S+ + Y G++ K    + ++C  C G G ++           +C  C G
Sbjct: 112 RGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVK-------KCTSCNG 164

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKG-------KCASXXXXXXXXXXXXVGTGVTTE 227
           QG K   R++ P     +   C  C G G       +C S             G  V  E
Sbjct: 165 QGIKFVTRQMGPMIQRFQT-ECDVCHGTGDIIDPKDRCKSCN-----------GKKVENE 212

Query: 228 SKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLI 287
            K L V +  G +   +IV KGEADQ       G++VF + E          +R G DL+
Sbjct: 213 RKILEVHVEPGMKDGQRIVFKGEADQ-APDVIPGDVVFIVSERPH----KSFKRDGDDLV 267

Query: 288 THLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GD 346
               + L  AI G    L + + G  L++ I PG+VI PG    I  +G PI      G+
Sbjct: 268 YEAEIDLLTAIAGGEFAL-EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGN 326

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLP 375
           L +   I+F P+N F+   +L +++ +LP
Sbjct: 327 LIIKFTIKF-PENHFTSEENLKKLEEILP 354

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  149 bits (376), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 192/386 (49%), Gaps = 41/386 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++LGV  DA   +IKKAYRK+AL++HPDK    +  EE+  +FK+I  AYE+L D 
Sbjct: 5   TKLYDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDS 60

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAA-------FMNFFHSFG-SNPQNAYDHYGEQKV 113
           +KR  YD++G+   +    G               F  FF   G S P+      G QK 
Sbjct: 61  QKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPR------GPQK- 113

Query: 114 DRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCG 173
               D++  ++ ++ + Y G++ K    +T++C RC G G +  +         +C  C 
Sbjct: 114 --GRDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVK-------KCTSCN 164

Query: 174 GQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           GQG K   R + P     +  TC  C+G+G                 G  + +E K L V
Sbjct: 165 GQGVKFVTRHMGPMIQRFQT-TCEVCNGEGDVIPAADRCKDCD----GKKIASERKILEV 219

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLS 293
           ++  G +   +IV +GEADQ+ G+   G++VF + E  E P  V   R+G +L     + 
Sbjct: 220 NIQPGMKHGQKIVFQGEADQQPGQI-PGDVVFVVNE-QEHPRFV---RNGDNLHYEAEID 274

Query: 294 LAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVH 352
           L  AI G    L + + G  L++ I PG+VI PG +  I  +G PI    S GDL +  +
Sbjct: 275 LLTAIAGGQFAL-EHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFN 333

Query: 353 IEFPPDNWFSERSDLTQVKNVLPGET 378
           ++F P + F++   L +++ +LP +T
Sbjct: 334 VKF-PKSHFADEEALKKLEAILPPKT 358

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  149 bits (376), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 124/388 (31%), Positives = 184/388 (47%), Gaps = 52/388 (13%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV + AT +EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYE+L D 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDS 60

Query: 62  EKRARYDKYGDADGS------DFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115
           EKR  YD++G+   S       F  G   F D  F  FF + G     A    G Q   R
Sbjct: 61  EKREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGG-----AQRPRGPQ---R 112

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
             D++  ++ S+ + Y G++ K    + ++C  C G G ++           +C  C GQ
Sbjct: 113 GKDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVK-------KCSSCNGQ 165

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKG-------KCASXXXXXXXXXXXXVGTGVTTES 228
           G K   R++ P     +   C  C G G       +C S             G  V  E 
Sbjct: 166 GIKFVTRQMGPMIQRFQT-ECDVCHGTGDIIDPKDRCKSCN-----------GKKVENER 213

Query: 229 KSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLIT 288
           K L V +  G +   +IV KGEADQ       G++VF + E        + +R G DL+ 
Sbjct: 214 KILEVHVEPGMKDGQRIVFKGEADQ-APDVIPGDVVFIVSERPH----KNFKRDGDDLVY 268

Query: 289 HLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDL 347
              + L  AI G    L + + G  L++ I PG+VI PG    I  +G PI      G+L
Sbjct: 269 EAEIDLLTAIAGGEFAL-EHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGYGNL 327

Query: 348 YVVVHIEFPPDNWFSERSDLTQVKNVLP 375
            +   I+F P+N F+   +L +++ +LP
Sbjct: 328 VIKFTIKF-PENHFTTEENLKKLEEILP 354

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  148 bits (374), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 185/396 (46%), Gaps = 42/396 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++LGV + AT +EIKKAYRK AL+ HPDK    +  EE+  +FKE ++AYEVL D 
Sbjct: 5   TKLYDVLGVSVTATDVEIKKAYRKMALKFHPDK----NPSEEAAEKFKEASSAYEVLSDA 60

Query: 62  EKRARYDKYG-----DADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRS 116
           +KR  YD++G      A G     G   F D  F  FF   G     A    G Q   R 
Sbjct: 61  DKRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAG-----AQRPRGPQ---RG 112

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQG 176
            D++  +NV++ + Y GK+ K    + ++C  C G G ++           +C  C GQG
Sbjct: 113 RDIKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVK-------KCSSCNGQG 165

Query: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLP 236
            K   R++ P     +   C  C G G                 G  V +E K L V + 
Sbjct: 166 IKFVTRQMGPMIQRFQT-ECDVCHGAGDIVDPKDRCKSCN----GKKVASERKILEVHVD 220

Query: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296
            G +   ++V KGEADQ       G++VF I E          QR G +L+    + L  
Sbjct: 221 PGMKNGQKVVFKGEADQ-APDVIPGDVVFVINEKPH----KHFQRSGDNLVYEAEVDLLT 275

Query: 297 AITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEF 355
           AI G  +   + + G  L++ I PG+VI PG    I  +G P+      G+L +   ++F
Sbjct: 276 AIAG-GEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGGYGNLIIKFTVKF 334

Query: 356 PPDNWFSERSDLTQVKNVLPGET-----NNNAAVED 386
            P+  F+   +L +++ +LP  T       NA VED
Sbjct: 335 -PEPHFTTEENLKKLEEILPQRTPLPQMPKNAHVED 369

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 173/380 (45%), Gaps = 38/380 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY+ LGV   A+  EIKKAYRK+AL++HPDK    +  EE+  +FKE+++AYE+L D 
Sbjct: 5   TKLYDTLGVSPGASDAEIKKAYRKSALKYHPDK----NPSEEAAEKFKEVSSAYEILSDS 60

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSF-----GSNPQNAYDHYGEQKVDRS 116
           +KR  YD++G+   S               + F  F     G  P+            R 
Sbjct: 61  QKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGP---------QRG 111

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQG 176
            D++  +  S+ + Y G++ K    + ++C  C G G +            +C  C GQG
Sbjct: 112 RDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKE-------GAVKKCSSCNGQG 164

Query: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLP 236
            K   R++ P     +   C  C G G                 G  V  E K L V + 
Sbjct: 165 IKFVTRQMGPMIQRFQT-ECDVCHGTGDIIDAKDRCKSCN----GKKVDNERKILEVRIE 219

Query: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296
            G +   +IV KGEADQ       G++VF I E          QR G DLI    + L  
Sbjct: 220 PGMKDGQKIVFKGEADQ-APDVIPGDVVFVISEKPH----KHFQRAGDDLIYEAEIDLLT 274

Query: 297 AITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEF 355
           A+ G    L + + G  L++ I PG+VI PG    +  +G PI      G+L +  +I+F
Sbjct: 275 ALAGGQFAL-EHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKF 333

Query: 356 PPDNWFSERSDLTQVKNVLP 375
            P+N F+   +L +++ +LP
Sbjct: 334 -PENHFTSEENLKKLEEILP 352

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 179/387 (46%), Gaps = 36/387 (9%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV   A+  EIKKAYRK AL++HPDK    +  EE+  +FKE +AAYEVL D+
Sbjct: 5   TKFYDILGVSPSASSSEIKKAYRKFALKYHPDK----NPSEEAAEKFKEASAAYEVLSDD 60

Query: 62  EKRARYDKY------GDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115
           EKR  YD++      G   G   F G   F D  F  FF   G+           +   R
Sbjct: 61  EKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRP------RGPQR 114

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
             D++  L+ ++ + Y G++ K    + ++C  C G G ++           +C  C GQ
Sbjct: 115 GRDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK-------KCSSCNGQ 167

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
           G K   R++ P     +   C  C G G                    VT E K L V +
Sbjct: 168 GVKFVTRQMGPMLQRFQ-AECEVCHGTGDIIDPKDRCKTCNAKK----VTNERKILEVHI 222

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLA 295
             G +   ++V KGEADQ       G+++F + +          QR G DL+    + L 
Sbjct: 223 EPGMKDGQKVVFKGEADQ-APDIIPGDVIFVVSQKPH----EHFQRAGDDLVYEAEIDLL 277

Query: 296 EAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIE 354
            AI G  +   K + G  L++ I PG+VI PG    I  +G PI      G+L V  +I+
Sbjct: 278 TAIAG-GEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGGYGNLIVKFNIK 336

Query: 355 FPPDNWFSERSDLTQVKNVLPGETNNN 381
           FPP N F++   L +++ +LP  T  N
Sbjct: 337 FPP-NHFTDEESLKKLEEILPPRTKTN 362

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 181/385 (47%), Gaps = 39/385 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV + AT +EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYE+L D 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDS 60

Query: 62  EKRARYDKYGDADG-------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
           EKR  YD++G+ DG         F  G   F D  F  FF   G     A    G Q   
Sbjct: 61  EKRDVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAG----GAQRPRGPQ--- 112

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           R  D++  ++ S+ + Y G++ K    + ++C  C G G ++           +C  C G
Sbjct: 113 RGKDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVK-------KCSSCNG 165

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           QG K   R++ P     +   C  C G G                 G  V  E K L V 
Sbjct: 166 QGIKFVTRQMGPMIQRFQT-ECDVCHGTGDIVDPKDRCKSCN----GKKVENERKILEVH 220

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +   +IV KGEADQ       G++VF + E          +R G DL+    + L
Sbjct: 221 VEPGMKDGQRIVFKGEADQ-APDVIPGDVVFLVSERPH----KSFKRDGDDLVYEAEIDL 275

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             AI G    L + + G  L++ I PG+VI PG    I  +G P+      G+L +   +
Sbjct: 276 LTAIAGGEFAL-EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIIKFTV 334

Query: 354 EFPPDNWFSERSDLTQVKNVLPGET 378
           +F P+N F+   +L +++ +LP  T
Sbjct: 335 KF-PENHFTAEENLKKLEEILPPRT 358

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  147 bits (371), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/382 (31%), Positives = 195/382 (51%), Gaps = 40/382 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++LGV  DA   +IKKAYRKAAL++HPDK    +   E+  +FK++ AAYE+L D 
Sbjct: 5   TKLYDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDS 60

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAA------FMNFFHSFG-SNPQNAYDHYGEQKVD 114
           +KR  YD++G+   +    GP  F          F  FF   G S P+      G QK  
Sbjct: 61  QKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPR------GPQK-- 112

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
              D++  ++ ++ + Y G++ K    +T++C  C G G +  +         +C  CGG
Sbjct: 113 -GRDIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVK-------KCSSCGG 164

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
            G K   R++ P     +  TC  C+G+G                 G  ++ E K L V+
Sbjct: 165 HGVKFVTRQMGPMIQRFQT-TCEACNGEGDVIDPKDRCRECS----GKKISNERKILEVN 219

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +   ++V +GEADQ+ G+   G++VF + E  E P+ V   R+G +L     + L
Sbjct: 220 IEPGMKNGQKVVFQGEADQQPGQI-PGDVVFVVNE-QEHPKFV---RNGDNLHYEAQIDL 274

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             A+ G    L + + G  L++ I PG+VI PG +  I  +G PI    S G+L +  ++
Sbjct: 275 LTAVAGGQFAL-EHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGNLLIKFNV 333

Query: 354 EFPPDNWFSERSDLTQVKNVLP 375
           +FP  ++ S+ +DL +++ +LP
Sbjct: 334 KFPKSHFASD-ADLKKLEEILP 354

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  146 bits (369), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 180/382 (47%), Gaps = 40/382 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV + AT +EIKKAYRK AL+ HPDK    +  EE+  +FKE ++AYEVL D 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKFHPDK----NPSEEAAEKFKEASSAYEVLSDS 60

Query: 62  EKRARYDKYGDADG-------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
           EKR  YD++G+ DG         F  G   F D  F  FF + G+         G Q   
Sbjct: 61  EKREVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPK-----GPQ--- 111

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           R  D++  ++ S+ + Y G++ K    + ++C  C G G ++           +C  C G
Sbjct: 112 RGRDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVK-------KCTGCNG 164

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           QG K   R++ P     +   C  C G G                 G  +  E K L V 
Sbjct: 165 QGIKFVTRQMGPMIQRFQT-ECDACHGTGDIVDPKDRCKSCN----GKKIENERKILEVH 219

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +   +IV KGEADQ       G++VF + E          +R G DL+    + L
Sbjct: 220 VEPGMKDGQKIVFKGEADQ-APDVIPGDVVFLVSERPH----KHFKRDGDDLVYEAEIDL 274

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             AI G    L + + G  L++ I PG+VI PG    I  +G P+      G+L V   I
Sbjct: 275 LTAIAGGEFAL-EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIVKFTI 333

Query: 354 EFPPDNWFSERSDLTQVKNVLP 375
           +F P+N F+   +L +++ +LP
Sbjct: 334 KF-PENHFTTEENLKKLEEILP 354

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  146 bits (368), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 183/389 (47%), Gaps = 53/389 (13%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y+ILGV   A++ EIKK YRKAAL++HPDK    +   E+  +FKE +AAYEVL D 
Sbjct: 5   TKFYDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDP 60

Query: 62  EKRARYDKYGDADGSD-------FFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
           EKR  YD+YG+   S         F G   F D  F  FF    S         G QK  
Sbjct: 61  EKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPR-----GPQK-- 113

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
              D++  +  ++ + Y G++ K    + ++C  C G G   + D V      +C  CGG
Sbjct: 114 -GRDIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRGG--KADAV-----KKCSSCGG 165

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDG-------KGKCASXXXXXXXXXXXXVGTGVTTE 227
           QG K   +++ P     +   C  C G       KG+C S             G  +  E
Sbjct: 166 QGIKFVTKQMGPMIQRFQT-ECDVCHGTGDIIDPKGRCKSCH-----------GKKIANE 213

Query: 228 SKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLI 287
            K L V +  G +   +IV KGE+DQ       G++VF + E          QR G DL+
Sbjct: 214 RKILEVKIEPGMKDGQRIVFKGESDQ-APDIIPGDVVFVVNEKPH----KHFQRSGNDLV 268

Query: 288 THLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGD 346
               + L  AI G    L + + G  L++ I  G+VI PG    I  +G PI      G+
Sbjct: 269 YLAEIDLLTAIAGGEFAL-EHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGGYGN 327

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLP 375
           L +  +I+F P+N F++ S+L +++ +LP
Sbjct: 328 LIIQFNIKF-PENHFTDESNLKKLEEILP 355

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  145 bits (367), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 183/398 (45%), Gaps = 46/398 (11%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY+ILGV   A+  EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYEVL D 
Sbjct: 5   TKLYDILGVSPTASDSEIKKAYRKQALKYHPDK----NPSEEAAEKFKEASSAYEVLSDS 60

Query: 62  EKRARYDKYGDADG------SDFFNGPNEFEDAAFMNFFHSFG-SNPQNAYDHYGEQKVD 114
           EKR  YD++G  DG           G   F +  F  FF   G S P+            
Sbjct: 61  EKRDIYDQFGQ-DGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGP---------Q 110

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           R  D++  ++VS+ + Y GK+ K    + ++C  C G G ++           +C  C G
Sbjct: 111 RGRDIKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKK-------GAVKKCSSCNG 163

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           QG K   R++ P     +   C  C G G                 G  +  E K L V+
Sbjct: 164 QGIKFVTRQMGPMIQRFQT-ECDVCHGTGDIIDAKDRCKDCH----GKKIANERKILQVN 218

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +   ++V KGEADQ       G+++F I E          QR G DLI    + L
Sbjct: 219 VDPGMKNGQKVVFKGEADQ-APDIIPGDVIFVISEKPH----KHFQRVGDDLIYEAEIDL 273

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             A+ G    L + + G  L++ I PG+VI P     +  +G PI      G+L +   I
Sbjct: 274 LTAVAGGEFAL-EHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGYGNLIIKFSI 332

Query: 354 EFPPDNWFSERSDLTQVKNVLPGET-----NNNAAVED 386
           +F P+N F++   L +++ +LP          NA V+D
Sbjct: 333 KF-PENHFADEDTLKKLEEILPARKPLPTFPKNAIVDD 369

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  145 bits (366), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 183/388 (47%), Gaps = 51/388 (13%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           S  Y++LGV + AT++EIKKAYRK+AL++HPDK    +   E+  +FKE+++AYEVL D 
Sbjct: 5   SKYYDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDS 60

Query: 62  EKRARYDKY------GDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115
           EKR  YD++      G A G+  F G   + D  F  FF       +            R
Sbjct: 61  EKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPR-------GPQR 113

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
             D++  + V++ + Y G++ K    + ++C  C G G +            +C  C GQ
Sbjct: 114 GRDIKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVK-------KCSSCNGQ 166

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKG-------KCASXXXXXXXXXXXXVGTGVTTES 228
           G+K   R++ P     +   C  C G G       +C S             G  V  E 
Sbjct: 167 GYKFVTRQMGPMIQRFQT-ECEACAGTGDIIDPKDRCKSCN-----------GKKVANER 214

Query: 229 KSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLIT 288
           K L V +  G +   +IV KGEADQ       G+++F + E        + QR G DL+ 
Sbjct: 215 KILEVHVDPGMKDGQKIVFKGEADQ-APDVIPGDVIFVVSEKPH----KNFQRVGDDLVY 269

Query: 289 HLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDL 347
              + L  A+ G   +L + + G  L++ I PG+VI PG    +  +G PI      G+L
Sbjct: 270 EAEIDLLTAVAGGEFSL-EHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGYGNL 328

Query: 348 YVVVHIEFPPDNWFSERSDLTQVKNVLP 375
            V   I FPP N F+   +L +++ +LP
Sbjct: 329 LVTFKINFPP-NHFTSDENLKKLEEILP 355

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  146 bits (368), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 205/470 (43%), Gaps = 96/470 (20%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           S LY+IL +  +A   +IKKAYR  AL++HPDK    +  EES+V F++I+ AYEVL D 
Sbjct: 5   SELYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDV 61

Query: 62  EKRARYDKYGDAD------------------------------------GSDFFNGPNEF 85
           EKR  YD+YG  D                                    GSD      + 
Sbjct: 62  EKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGDL 121

Query: 86  EDAAFMNF------FHSFG------SNPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNG 133
               F N       F+ FG      SN  N +++    +++R  D++  L  S+ D Y G
Sbjct: 122 FAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYYG 181

Query: 134 KSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTEN 193
           K  K +  RT +C  C+G G  +++         +C  C G G   + RR+ P   T   
Sbjct: 182 KKTKLRLDRTRLCVLCMGQGSMKKS---------KCFTCNGLGSLTQTRRMGPMIQTFSQ 232

Query: 194 ITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ 253
            +CP C G G                 G G   E K   V +  G      I+L GEAD+
Sbjct: 233 -SCPDCQGSGMFVKRSDTCQSCS----GNGYVEERKIFDVEIQPGMVNGQVIILPGEADE 287

Query: 254 EV----GKSQT--GNLVFTIKE----GTECPEGVDLQRHGFDLITHLTLSLAEAITGFSK 303
            V    GK +   G++V TI +      E     DL      L+ + +++L++A+ G + 
Sbjct: 288 VVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDL------LLDNFSVNLSKALCGGTI 341

Query: 304 TLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP----------IDTTTSGDLYVVVHI 353
            ++    G ++++ I PG+++ PG I  + + G P          I   + G+LYV   I
Sbjct: 342 FISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDI 401

Query: 354 EFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEI 403
           +FP      E   + ++K VL  +   +A + D+    + V+N++ + EI
Sbjct: 402 KFPTR---LEEDTIAKLKAVLSEDRYAHAEMADEEA--KDVSNLDDLVEI 446

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  144 bits (364), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 117/384 (30%), Positives = 180/384 (46%), Gaps = 39/384 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV  +A++ EIKK YRKAAL++HPDK    +  +E+  +FKE + AYEVL D 
Sbjct: 5   TKFYDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLSDS 60

Query: 62  EKRARYDKYGD-----ADGSDFFNGPNEFEDAAFMNFFHSFG-SNPQNAYDHYGEQKVDR 115
           +KR  YD+YG+           F G   F D  F  FF   G S P+            R
Sbjct: 61  QKREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGP---------QR 111

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
             D++  +  ++ + Y G++ K    + ++C  C G G +            +C  CGGQ
Sbjct: 112 GKDIRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKE-------GAVKKCSSCGGQ 164

Query: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
           G K   R++ P     +   C  C G G                 G  V  E K L V +
Sbjct: 165 GVKFVTRQMGPMIQRFQT-ECDVCHGSGDIIDPKDRCKECK----GNKVANERKVLEVHV 219

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLA 295
             G R+  ++  KGEADQ       G+++F +   TE P     +R G DL+    + L 
Sbjct: 220 EPGMREGQKVTFKGEADQ-APDIIPGDVIFVV---TEKPH-KHFKRSGDDLLYEAEVDLL 274

Query: 296 EAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIE 354
            AI G    + + + G  L++ I PG+VI PG    I  +G P+      G+L +   I+
Sbjct: 275 TAIAGGDFAI-EHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGGYGNLIITFKIK 333

Query: 355 FPPDNWFSERSDLTQVKNVLPGET 378
           F P+N F++ + L  ++++LP  T
Sbjct: 334 F-PENHFADEAKLKALEDILPPRT 356

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  142 bits (359), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 180/384 (46%), Gaps = 42/384 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV   A++ EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYEVL D 
Sbjct: 5   TKFYDLLGVSATASETEIKKAYRKTALKYHPDK----NPSEEAAEKFKEASSAYEVLMDA 60

Query: 62  EKRARYDKYGDADGS---------DFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQK 112
           EKR  YD++G+   S           F G   F D  F  FF    S P+      G Q 
Sbjct: 61  EKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPR------GPQ- 113

Query: 113 VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKC 172
             R  D++  + V++ + Y G++ K    + ++C  C G G +            +C  C
Sbjct: 114 --RGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKE-------GAVKKCTSC 164

Query: 173 GGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLT 232
            GQG K   R++ P     +   C  CDG G   +             G  V  E K L 
Sbjct: 165 NGQGVKFITRQMGPMIQRFQT-ECDACDGTGDIINPKDRCKACS----GKKVANERKILE 219

Query: 233 VSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTL 292
           V +  G +   +IV KGEADQ       G+++F + E          +R   DL+    +
Sbjct: 220 VHVDPGMKDGQKIVFKGEADQ-APDIIPGDVIFVVSERPH----KHFRRDSDDLVYEADI 274

Query: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVV 351
            L  AI G  +   + + G  L+++I PG+VI PG    I  +G P+      G+L V  
Sbjct: 275 DLLTAIAG-GEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKF 333

Query: 352 HIEFPPDNWFSERSDLTQVKNVLP 375
           +I FP D+ F+   ++ +++ +LP
Sbjct: 334 NIVFPKDH-FTSLENMKKLEEILP 356

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  142 bits (359), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 192/416 (46%), Gaps = 66/416 (15%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++L V  +A+ +EI+KAYR  AL+HHPDK    +  EES+ +F E+  AYE+L DE
Sbjct: 5   TRLYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDE 61

Query: 62  EKRARYDKYGDAD--------------GSDFFNGPNEFEDAA-------FMNFFHSFGSN 100
           +KR+ YD+YG  D               S FFN  +             F +FF    S 
Sbjct: 62  KKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSS- 120

Query: 101 PQNAYDHYGEQK----VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRR 156
                  +G +K    +D   D++  L  +++  Y GK+ K    R  VC  C G G  +
Sbjct: 121 -----PSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMK 175

Query: 157 RNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXX 216
                       CK C G+G + R R++ P   T    TC  C+G G             
Sbjct: 176 VR---------TCKACRGRGQQSRSRQMGPMMQTWTQ-TCSDCNGMGTFTKDSDVCRDCE 225

Query: 217 XXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGN-------LVFTIKE 269
               G G   E K   V +  G  Q  QI+L GEAD EV K++ GN       ++ TI +
Sbjct: 226 ----GEGCIRERKIFDVEVKPGMCQGQQIILPGEAD-EVIKTRFGNETVIPGDVIITIIQ 280

Query: 270 GTECPEGVDLQRHGFDLIT-HLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGN 328
             + P+   + R+G DL+  +  + L  ++ G   ++    +G+++ + I PG++I+P +
Sbjct: 281 IKD-PKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNH 339

Query: 329 IIQIPHEGWPIDTTTS-----GDLYVVVHIEFPPDNWFSERSDLTQVKNVLPGETN 379
              I + G P           G+LY+   +EF P+   SE   +T++K VL  + N
Sbjct: 340 FKSIENLGMPRYEEKRAPEGYGNLYIQFQVEF-PETLASE--TVTKLKQVLDEDPN 392

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  140 bits (354), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/386 (28%), Positives = 177/386 (45%), Gaps = 59/386 (15%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY+ L + +DAT  EIKKAYR AAL+ HPDK    +  E+S+ +F+EI  AYE+LGD +K
Sbjct: 9   LYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAKK 65

Query: 64  RARYDKYGDADG------------------------SDFFNGPNEFEDAAFMNFFHSFGS 99
           +  YD+YG  D                         S FF G +    ++F N    F +
Sbjct: 66  KLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFT 125

Query: 100 NPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRND 159
             +N+     +++V R  D++  L  S+ + Y+GK  K +  RT +C  C G+G    + 
Sbjct: 126 GKKNS-----QRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSSS- 179

Query: 160 HVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXX 219
                    C+ C GQGF  + RR  P    T + TC  C G G                
Sbjct: 180 --------ACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRRKDVCSECK--- 227

Query: 220 VGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEV----GKSQT--GNLVFTIKEGTEC 273
            G G   E K   + +  G     +IVL  EAD+ V    GK Q   G+++  +++  + 
Sbjct: 228 -GQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQ-VKH 285

Query: 274 PEGVDLQRHG-FDLITH-LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQ 331
           P     Q H   DL+ +   + L  ++ G    +     G  L++++ PG++++PG +  
Sbjct: 286 PL---FQIHNDTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKC 342

Query: 332 IPHEGWPIDTTTS-GDLYVVVHIEFP 356
           +   G P   +   G+LY+   ++FP
Sbjct: 343 VESMGMPHPQSQGFGNLYIRFQVDFP 368

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  140 bits (353), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/383 (27%), Positives = 177/383 (46%), Gaps = 52/383 (13%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY+ LGV  +A++ EIKKAYR  AL+HHPDK       E+S+++F++I  AYE+LGD++K
Sbjct: 9   LYDTLGVAANASRQEIKKAYRLKALKHHPDKNGHS---EQSKLKFQQICKAYEILGDDKK 65

Query: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGS----------NPQNAYDHYGE--- 110
           R  YD++G AD + +      +E+ + M+    F                  D +G    
Sbjct: 66  REMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFGSSRG 125

Query: 111 ---QKVDRSA-----DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVV 162
              Q   RSA     D++  L  ++ + YNGK  K   KRT +C  C G G ++      
Sbjct: 126 FRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK------ 179

Query: 163 PPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGT 222
                 C  C G+G + + +R  P    T + TC TC G G                 G 
Sbjct: 180 ---ATSCYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIVKPSDICNGCH----GQ 231

Query: 223 GVTTESKSLTVSLPRGSRQDDQIVLKGEADQEV----GKSQT--GNLVFTIKEGTECPEG 276
           G   E K   + + +G      +V+  EAD+ V    G  +   G+++  ++   + P  
Sbjct: 232 GWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILE---QLPH- 287

Query: 277 VDLQRHGFD---LITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIP 333
             L+R G D   L++   + L  ++ G +  +     G++L++ + PG++++PG I  + 
Sbjct: 288 RSLKR-GHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQ 346

Query: 334 HEGWPIDTTTSGDLYVVVHIEFP 356
             G P      GDL++   + FP
Sbjct: 347 SMGMPKSKGGYGDLFIKFKVIFP 369

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  139 bits (351), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/383 (31%), Positives = 180/383 (46%), Gaps = 41/383 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY+++GV   A   +IKKAYRKAAL++HPDK    +  EE+  +FKEI++AYE+L D 
Sbjct: 5   TKLYDLIGVSPGADDAQIKKAYRKAALKYHPDK----NPTEEAAEKFKEISSAYEILSDS 60

Query: 62  EKRARYDK------YGDADGSDFFNGPNEFEDAAFMNFFHSFG--SNPQNAYDHYGEQKV 113
           +KR  YD+       G   G+  F G   F D  F  FF   G  S P+      G QK 
Sbjct: 61  QKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPR------GPQK- 113

Query: 114 DRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCG 173
               D++  ++ ++ + Y G++ K    + ++C  C G G +            +C  C 
Sbjct: 114 --GRDIRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGK-------AGAVKKCSSCN 164

Query: 174 GQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           GQGFK   R++ P     +   C  C+G G                 G  +  E K L V
Sbjct: 165 GQGFKFITRQMGPMIQRFQ-AECDACNGTGDIIDAKDRCKACN----GKKIANERKILEV 219

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLS 293
            +  G +   +IV +GEADQ    +        +   +E P      R G DL     + 
Sbjct: 220 HIEPGMKDGQKIVFQGEADQ----APDVVPGDVVFVVSERPH-ERFNRKGDDLYYEAEVD 274

Query: 294 LAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVH 352
           L  AI G  +   + + G  L+++I PG+VI PG    I  +G P+      G+L V   
Sbjct: 275 LLTAIAG-GEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGGFGNLIVKFK 333

Query: 353 IEFPPDNWFSERSDLTQVKNVLP 375
           I+FPP N F++ + L Q++N+LP
Sbjct: 334 IKFPP-NHFADEASLKQLENILP 355

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  140 bits (354), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 122/459 (26%), Positives = 198/459 (43%), Gaps = 79/459 (17%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY+IL V   AT+ EIKKAYRK AL+HHPDK    +   ES   F++I+ AYE L + 
Sbjct: 5   TKLYDILEVNTTATEQEIKKAYRKKALKHHPDK---NNHSAESIKLFQDISHAYETLSNS 61

Query: 62  EKRARYDKYGDAD----------------GSD-----------------FFNGPNEFEDA 88
            KR  YD+YG  D                GS+                 FF G       
Sbjct: 62  NKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTG 121

Query: 89  A-------------FMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNGKS 135
           A             F +F H F  N    ++  G  ++     ++  L  ++ D ++GK 
Sbjct: 122 ASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKR 181

Query: 136 FKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENIT 195
            K    RT +C RC G G ++           +C+ C G G     +R+ P    T   T
Sbjct: 182 AKLALNRTRLCQRCQGYGGKK---------ATQCRGCQGTGLFTTTKRMGP-MVQTWQTT 231

Query: 196 CPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ-- 253
           C  C G GK                G G   E K   V +  G R  ++I+L GEAD+  
Sbjct: 232 CKECSGTGKYIRSKDACTECS----GNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVI 287

Query: 254 --EVGKSQT--GNLVFTIK--EGTECPEGVDLQRHGFDLIT-HLTLSLAEAITGFSKTLT 306
             E GK +   G+++ TI+     E         H  DLI  +  + L  ++ G +  + 
Sbjct: 288 NTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIE 347

Query: 307 KTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEFPPDNWFSERS 365
               G   ++++  G++++PG I  + ++G P+D+  + G+LY+   ++FP       +S
Sbjct: 348 DHPSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGNFGNLYIRFRVKFPE----QLKS 403

Query: 366 D-LTQVKNVLPGETNNNAAVEDDPGN-TETVTNINIVEE 402
           D + ++  +L  + N ++ + D   N +  + + +I EE
Sbjct: 404 DTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEE 442

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  138 bits (347), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 116/387 (29%), Positives = 174/387 (44%), Gaps = 45/387 (11%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV  +A++ EIKK YRK AL++HPDK    +  EE+  +FKE +AAYEVL D 
Sbjct: 5   TKFYDLLGVSPNASETEIKKGYRKQALKYHPDK----NPSEEAAEKFKECSAAYEVLSDS 60

Query: 62  EKRARYDKY-----GDADGSDFFNGPNEFEDAAFMNFFHSFG----SNPQNAYDHYGEQK 112
           +KR  YD+Y            F  G   F D  F  FF   G    S PQ          
Sbjct: 61  QKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQ---------- 110

Query: 113 VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKC 172
             R  D++  +  ++ + Y G++ K    + ++C  C G G +            +C  C
Sbjct: 111 --RGRDIKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGK-------AGAVKKCTSC 161

Query: 173 GGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLT 232
            GQG K   R++ P     +   C  C G G                 G  +  E K L 
Sbjct: 162 NGQGIKFVTRQMGPMIQRFQT-ECDVCHGSGDIIDPKDRCKDCK----GKKIANERKVLE 216

Query: 233 VSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTL 292
           V +  G R+  +IV KGEADQ       G+++F + E          +R G DL+    +
Sbjct: 217 VHVEPGMREGQKIVFKGEADQ-APDVIPGDVIFVVVEKPH----KHFKRAGDDLLYEAEI 271

Query: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVV 351
            L  AI G  +   + + G  L++   PG+VI  G    I  +G P+      G+L V  
Sbjct: 272 DLLTAIAG-GEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGGYGNLIVTF 330

Query: 352 HIEFPPDNWFSERSDLTQVKNVLPGET 378
            I+FP +N+ +E   L +++N+LP  T
Sbjct: 331 KIKFPENNFATE-DKLKELENILPART 356

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  135 bits (341), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/435 (28%), Positives = 190/435 (43%), Gaps = 75/435 (17%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY++L VE DA+Q+ IKKA+  AAL+ HPDK    +  EES+ +F+EI+ AYEVL D + 
Sbjct: 7   LYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKS 63

Query: 64  RARYDKYGDAD------------GSDFFNGPN---EFEDAA---FMNFFHSFG-SNPQ-- 102
           R  YD+YG  D            G  F++G N    F  +A   F  FF+S G + P   
Sbjct: 64  REMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFG 123

Query: 103 --NAYDHYGEQKVDRSA---------DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLG 151
             + +D +G       A         D++  L  +++D Y GK  K    R  VC  C G
Sbjct: 124 FGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDG 183

Query: 152 SGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXX 211
            G  R            C+ C GQG   + RR+ P    T + TC +C G G        
Sbjct: 184 KGGMR---------VASCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFIKDSDL 233

Query: 212 XXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKS------QTGNLVF 265
                    G+GV+ E K   V +  G   +  IVL GEAD+ +  S      Q G++V 
Sbjct: 234 CFVCK----GSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVI 289

Query: 266 TIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIR 325
            I         V +  H   ++ +  + L   + G    +     G+I++L I P ++++
Sbjct: 290 VIDLVKNTQFQV-VNDHDL-VLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLK 347

Query: 326 PGNIIQIPHEGWP-------------IDTTTSGDLYVVVHIEFPPDNWFSERSDLTQVKN 372
           P     +   G P              D    G+LYV   ++FP      E + +T+++ 
Sbjct: 348 PSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPER---LEDTTITKLQE 404

Query: 373 VLPGETNNNAAVEDD 387
           +L  E + N   ED+
Sbjct: 405 IL--EQDPNVKKEDE 417

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  134 bits (337), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/389 (30%), Positives = 172/389 (44%), Gaps = 53/389 (13%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV  DA   +IKKAYRK AL+ HPDK    +  EE+  +FKE+  AYE+L D 
Sbjct: 5   TKFYDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDS 60

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAA-------FMNFFHSFGSNPQNAYDHYGEQKVD 114
           +KR  YD+ G+   S    G               F  FF   GS         G QK  
Sbjct: 61  QKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPR-----GPQK-- 113

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
              D++  ++ S+ + Y G++ K    + ++C  C G G +            +C  C G
Sbjct: 114 -GRDIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGK-------AGAVKKCSSCNG 165

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKG-------KCASXXXXXXXXXXXXVGTGVTTE 227
           QG K   R++ P     +   C  C G G       +C S             G  +  E
Sbjct: 166 QGIKFITRQMGPMIQRFQ-AECDVCSGTGDIIDPKDRCKSCN-----------GKKIDNE 213

Query: 228 SKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLI 287
            K L V +  G +   +IV +GEADQ  G    G++VF I +          +R G DL+
Sbjct: 214 RKILEVHIEPGMKDGQKIVFQGEADQAPG-IIPGDVVFVISQRPH----KHFERKGDDLL 268

Query: 288 THLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GD 346
               + L  AI G  +   + + G  L++ I PG+VI PG    I  +G PI      G+
Sbjct: 269 YQAEVDLLSAIAG-GEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGGYGN 327

Query: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLP 375
           L V   I FP  N F++   L +++ +LP
Sbjct: 328 LIVTFKINFPT-NHFADEESLKKLEEILP 355

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  133 bits (334), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 177/397 (44%), Gaps = 41/397 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY++LGV   A   EIKKAYRK+AL++HPDK    +  EE   +FKE++AAYE+L D 
Sbjct: 5   TKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDK----NPTEEGAEKFKEVSAAYEILSDS 60

Query: 62  EKRARYDK-------YGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114
           EKR  YD+        G   G   F G   F D  F  FF   G+           +   
Sbjct: 61  EKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRP------RGPQ 114

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           R  D++  +  ++ + Y G++ K    + ++C  C G G ++           +C  C G
Sbjct: 115 RGRDIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK-------KCSSCNG 167

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           QG K   R++ P     +   C  C G G                    VT E K L V 
Sbjct: 168 QGVKFVTRQMGPMIQRFQ-AECDVCSGTGDIIDPKDRCKTCNAKK----VTNERKILEVH 222

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +    IV KGEADQ       G+++F + +          QR G DL+    + L
Sbjct: 223 IEPGMKDGQNIVFKGEADQ-APDVIPGDVIFVVAQKPH----KHFQRSGDDLVYEAEIDL 277

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             AI G    L + + G  L++ I PG+VI PG+   I  +G PI      G+L V   +
Sbjct: 278 LTAIAGGEFAL-EHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGHGNLIVHFTV 336

Query: 354 EFPPDNWFSERSDLTQVKNVLPGETN----NNAAVED 386
           +F P   F++   L +++ +LP         NA V+D
Sbjct: 337 KF-PQKHFADEDSLKKLEEILPPRKKISIPANATVDD 372

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  132 bits (331), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 111/382 (29%), Positives = 169/382 (44%), Gaps = 40/382 (10%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV +DA   +IKK YRK AL+ HPDK    +   E+  +FKE+  AYEVL D 
Sbjct: 5   TKFYDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLSDS 60

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAA-------FMNFFHSFGSNPQNAYDHYGEQKVD 114
           +KR  YD+ G+   S    G               F  FF    S P+      G QK  
Sbjct: 61  QKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPR------GPQK-- 112

Query: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
              D++  ++ S+ + Y G++ K    + ++C  C G G +            +C  C G
Sbjct: 113 -GRDIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVK-------KCASCNG 164

Query: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           QG K   R++ P     +   C  C+G G                 G  +  E K L V 
Sbjct: 165 QGVKFITRQMGPMIQRFQ-AECDACNGTGDIVDPKDRCKTCN----GKKIDNERKILEVH 219

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  G +   +IV +GEADQ  G    G+++F I +          +R G +L     + L
Sbjct: 220 IEPGMKDGQKIVFQGEADQAPG-VIPGDVIFVISQRPH----KHFERKGDNLYYQAEVDL 274

Query: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHI 353
             AI G  +   + + G  L++ I PG+VI PG    I  +G P+      GDL V   +
Sbjct: 275 LSAIAG-GEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGGFGDLIVTFKV 333

Query: 354 EFPPDNWFSERSDLTQVKNVLP 375
            F P N F++   L +++ +LP
Sbjct: 334 NF-PTNHFADEESLKKLEEILP 354

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  131 bits (330), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 165/361 (45%), Gaps = 39/361 (10%)

Query: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDK-VADESLREESEVRFKEIAAAYEVLG 59
           M +LY++LGV  DA+Q EIKKAYRK AL++HPDK   DE   E     F++I+ AY VLG
Sbjct: 1   MESLYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEA----FQKISHAYGVLG 56

Query: 60  DEEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFG-SNPQNAYDHYGEQKVDRSAD 118
           D  +R RYD+ GD + S    G N  +   F +FF+  G     ++      +   R  +
Sbjct: 57  DVAQRQRYDQSGDENESLQPTGSNAAD--LFSSFFNGGGVYPSGSSGGPGPSRGPSRGPN 114

Query: 119 VQVPLNVSMADCYNGKSFKFQSKRTLVCDRC-LGSGWRRRNDHVVPPPQVECKKCGGQGF 177
           +   L  ++ D Y GK  K   +RT  C+RC LG+                C  C G G 
Sbjct: 115 IIHELKCTLQDLYRGKVIKLALRRTAPCERCSLGAA-------------NVCSSCNGSGN 161

Query: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPR 237
             RI R+ P    T + TC  C G+G+ +              G     E     V +  
Sbjct: 162 ITRIERVGP-LTQTWSSTCNACQGQGRMSVDCSQCG-------GAQYLNERVVFKVHVKP 213

Query: 238 GSRQDDQIVLKGEADQEVGK-------SQTGNLVFTIKEGTECP-EGVDLQRHGFDLITH 289
           G      IVL GEADQ V         +++G++V  I+E  +   +   L +     +  
Sbjct: 214 GMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQ 273

Query: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT-TSGDLY 348
           + + L  A+TG +  L     G ++++ I PG+ +    I  +   G PID T   GDLY
Sbjct: 274 VKVDLTTALTGGNVLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPIDDTGQRGDLY 333

Query: 349 V 349
           +
Sbjct: 334 I 334

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  129 bits (324), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 125/450 (27%), Positives = 185/450 (41%), Gaps = 77/450 (17%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY+ L V  DAT  EIK+AY+  AL++HPDK       E+++ +F+E+  AYE+L DE+K
Sbjct: 7   LYDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDK 63

Query: 64  RARYDKYGDAD-------------------GSDFFNGPNEFEDAAFMNF--FHSFGSNP- 101
           R  YD+YG  D                          P +     F NF    SFG +P 
Sbjct: 64  RVMYDRYGTVDEYALQEQEESQGAPTTSSSFFGSSMSPGDLFAQFFDNFPGHSSFGRSPF 123

Query: 102 ----------------QNAYDHYGEQKV--------DRSADVQVPLNVSMADCYNGKSFK 137
                            +++ H+              R  D++  L  ++A+ Y+GK  K
Sbjct: 124 GSAFGGGSPFGGGFPFGSSFSHHSGGGRSSYGGGRPSRGPDIKHNLKCTLAELYDGKITK 183

Query: 138 FQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCP 197
               R  +C  C G G  RR           CK C GQG +   RR  P    T   TCP
Sbjct: 184 LGLNRRRMCQSCQGQGSLRRR---------TCKTCRGQGQQTETRRTGP-MVQTWTQTCP 233

Query: 198 TCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ---- 253
            C+G G                 G     E K   V + +G      IVL GEAD+    
Sbjct: 234 DCNGLG----TYTKQADVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELIKT 289

Query: 254 --EVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLIT-HLTLSLAEAITGFSKTLTKTLD 310
              V K   G++V TI +  +  +   + R+G DL+    ++ L+ ++ G    +     
Sbjct: 290 SFGVEKVIPGDVVITIDQVKD-SKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHPS 348

Query: 311 GRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYVVVHIEFP----PDNWFSER 364
           G++L++ I PG++I P  +  I   G P        G+LY+   +E+P    PD     +
Sbjct: 349 GKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGKGNLYIQFQLEYPVGLEPDTIGRLQ 408

Query: 365 SDLTQVKNVLPGETNNNAAVEDDPGNTETV 394
           S L Q K V     + NA V    G+   V
Sbjct: 409 SVLLQDKYVQNQIQSQNAKVYQKLGDCAEV 438

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  128 bits (322), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 118/433 (27%), Positives = 175/433 (40%), Gaps = 104/433 (24%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           ++LY+ L V   A+  EIKKAYR AAL++HPDK    +  EES+ +F+EI  AYE+L D 
Sbjct: 5   TSLYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDN 61

Query: 62  EKRARYDKYGDAD---------------------GSDFFNGPNEFEDAA----FMNFFHS 96
             RA YD+YG  D                      S+F      F D +    F  FF+S
Sbjct: 62  RLRALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNS 121

Query: 97  F----------------------------GSNPQNAYDHYG-------EQKVDRSADVQV 121
                                        GS   N Y           +  +DR  D++ 
Sbjct: 122 SATPSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKH 181

Query: 122 PLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRI 181
            L  ++ + Y GK+ K    RT +C  C G G  ++           CK C GQG + + 
Sbjct: 182 NLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK---------CTCKTCKGQGIQTQT 232

Query: 182 RRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQ 241
           RR+ P    + + TC  C G G                 G G   E K L V++  GS  
Sbjct: 233 RRMGP-LVQSWSQTCADCGGAGVFVKNKDICQQCQ----GLGFIKERKILQVTVQPGSCH 287

Query: 242 DDQIVLKGEADQEVG-------KSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +  IVL GE D+ +        K   G++V TI         + L+   F +I +  L  
Sbjct: 288 NQLIVLTGEGDEVISTKGGGHEKVIPGDVVITI---------LRLKDPNFQVINYSNLIC 338

Query: 295 AEAITGFSKTLTKTL-------DGRILQLQIPPGKVIRPGNIIQIPHEGWP--IDTTTS- 344
            +    F  +L   +        G++++L I PG++++PG    +   G P  I+   S 
Sbjct: 339 KKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSG 398

Query: 345 -GDLYVVVHIEFP 356
            G LYV   + +P
Sbjct: 399 FGHLYVKFDVTYP 411

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score =  122 bits (305), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 115/434 (26%), Positives = 181/434 (41%), Gaps = 96/434 (22%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LY IL V   AT  EIK AY+K AL++HPDK    +  EES+++F+EI  AYEVL D+
Sbjct: 12  TRLYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDK 68

Query: 62  EKRARYDKYGDADGS--DFFNGPNEFEDA----------AFMNFFH-------------- 95
           +K+  YD YG  D S  D   G N+ +D            F  FF               
Sbjct: 69  DKKLLYDTYGTLDESLIDKQRGNNDQKDDFDTTELSPGDLFAKFFDKSSRVNNNNYNSNS 128

Query: 96  -------SFGSNPQNAYDHYGEQKVD--------------RSADVQVPLNVSMADCYNGK 134
                  S  +N  +A + +  Q ++              R  D++  LN ++ + Y GK
Sbjct: 129 SPFNNVPSTNTNTNSAGNRFMTQALNSPSTTGTLFEKGLSRGPDIKHVLNCTLKELYQGK 188

Query: 135 SFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENI 194
             K    RT  C  C G G             + C +C G+G     + L P    + + 
Sbjct: 189 KCKLGLNRTRSCHSCNGMGGMN---------TIICNECQGKGINTETKMLGP-MVQSWSS 238

Query: 195 TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQE 254
           TC  C G G                 G G   E    TV++  G R + +IVLKGEADQ 
Sbjct: 239 TCFNCSGMGYFIDSQSGCKECQ----GEGYLRERTIFTVTVKPGMRNNQKIVLKGEADQV 294

Query: 255 --VGKSQT-----GNLVFTI--------KEGTECPEGVDLQRHGFDLIT-------HLTL 292
             VGK        G+++  I        K  +   +G +  +  F++I        +  +
Sbjct: 295 MLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEIINEKDLLLRNCQI 354

Query: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP--IDTTT------- 343
            L  ++ G    +     G++++L I P ++++P  +  + + G P  I+  T       
Sbjct: 355 DLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETNNGEEYL 414

Query: 344 -SGDLYVVVHIEFP 356
            +GDLY+   +++P
Sbjct: 415 PNGDLYIQFKVKYP 428

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  118 bits (295), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 110/371 (29%), Positives = 163/371 (43%), Gaps = 47/371 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDK-VADESLREESEVRFKEIAAAYEVLGDEEK 63
           Y ILG+  DA+  ++K AYR+ + ++HPDK   DES  +    RF E+  AYEVL D EK
Sbjct: 21  YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQ----RFIEVGEAYEVLSDPEK 76

Query: 64  RARYDKYGDADG--------------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYG 109
           R  +D+YG ADG                 F+ P +  +  F       G        H G
Sbjct: 77  RGIFDQYG-ADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHRG 135

Query: 110 EQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVE- 168
                +   ++V   +S+ D Y+G   +F+     +CD C GSG            +VE 
Sbjct: 136 -----KGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG--------SEDGKVET 182

Query: 169 CKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTES 228
           C  CGGQG   +I R+      T+ I  P     G+C+              G  V  + 
Sbjct: 183 CPDCGGQGILIQIIRMG---IMTQRIQQPC----GRCSGRGHIIKNQCKACGGHKVVKKP 235

Query: 229 KSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLIT 288
           KS  V +P G+ +D   V   EADQ     + G++     E  +   G   +R G  L  
Sbjct: 236 KSFQVEVPAGAPRDHVEVRHQEADQST-DMEAGDIFVEFTESDKNNMG--YRRRGDHLFR 292

Query: 289 HLTLSLAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT--TSG 345
              LS  EA+  G+S+ +    D + ++LQ P G ++  G I QIP  G P  ++  + G
Sbjct: 293 TEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFG 352

Query: 346 DLYVVVHIEFP 356
           DL+V   +  P
Sbjct: 353 DLFVEYAVVMP 363

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 129/489 (26%), Positives = 199/489 (40%), Gaps = 118/489 (24%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           ++LY+ L V   A+  EIKKAYR AAL++HPDK    +  EES+ +F+EI  AYE L D 
Sbjct: 5   TSLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDN 61

Query: 62  EKRARYDKYGDAD-------------------------GSDFFNGPNEFEDAA----FMN 92
             R+ YD+YG  D                          + F  G   F D +    F  
Sbjct: 62  HLRSLYDQYGTTDEVLIQEQQAQTQSQRQRQQASVFSPSAGFGTGGMSFPDLSPGDLFAQ 121

Query: 93  FFHS--------------------------FGS--------NPQNAYDHYGE-QKVDRSA 117
           FF+S                          FGS        +P + Y+  GE + ++R  
Sbjct: 122 FFNSSASASSNGSKDNFNFSFDGSTTPNFPFGSGGGMNNLYSPPSRYNSEGEGRHLNRGP 181

Query: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGF 177
           D++  L  ++ + Y GK+ K    RT +C  C G G  ++           CK C GQG 
Sbjct: 182 DIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK---------YACKTCKGQGV 232

Query: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPR 237
           + +  R+ P    + + TC  C G G                 G G   + K L V++  
Sbjct: 233 QTQTNRMGP-LVQSWSQTCADCGGAGIFVESKDICQQCQ----GLGFVKQRKILQVAVQP 287

Query: 238 GSRQDDQIVLKGEADQEVG-------KSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHL 290
           GS  +  IVL GE D+ +        K   G++V TI         + L+   F ++   
Sbjct: 288 GSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITI---------LRLKDPRFQIVDDY 338

Query: 291 TL-------SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP--IDT 341
            L        L  ++ G    +     G++++L I PG+V++PG    + + G P  I+ 
Sbjct: 339 NLIYKKCKVDLMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFING 398

Query: 342 TTS--GDLYVVVHIEFP----PDNWFSERSDLTQVKNVLPGETNNNAAVE--DDPGNTET 393
             S  G +YV   + +P    P+N    +  L   K V     N  +A+E  D     + 
Sbjct: 399 VRSGFGHMYVKFEVTYPRRLEPENAIKLQKVLANDKYV----QNERSAMETADADCYCDL 454

Query: 394 VTNINIVEE 402
             + N+VEE
Sbjct: 455 ERSYNVVEE 463

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 105/398 (26%), Positives = 165/398 (41%), Gaps = 64/398 (16%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
            Y++L V    +  E+KK+Y+ AAL++HPDK       E ++  F++I  AY +L DE K
Sbjct: 7   FYDLLNVSPTVSPQELKKSYKLAALRYHPDKNGHS---ESAKQAFQQITEAYGILSDERK 63

Query: 64  RARYDKYGDADGSDFF-----------------NGPNEFEDAAFMNFFH----------- 95
           R  YD+YG +D ++                         E      F H           
Sbjct: 64  RKIYDRYGVSDENEIVAILASQKRAAAAAAPAATAARNMEMTPGDLFAHFFGDGFGAGGE 123

Query: 96  -SFGSNPQNAYDHYGEQKVDRS-------ADVQVPLNVSMADCYNGKSFKFQSKRTLVCD 147
            SF       +  +     D++        D++  L   + + Y+GK  K    RT +C 
Sbjct: 124 FSFLQGNLGGHCRFNSAAKDKARDGKSRGPDIKHNLKCELKELYSGKVAKLGLTRTRLCH 183

Query: 148 RCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCAS 207
           RC G G    +          C +C GQG   + RR  P    T + +C  C G G    
Sbjct: 184 RCSGHGSMTSS---------VCGECRGQGVYSQTRRHGP-LVQTWSSSCRNCSGAGTFVK 233

Query: 208 XXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEV----GKSQT--G 261
                        GTG   E K   V +  G     +I+L GEADQ +    GK Q   G
Sbjct: 234 SNDVCQTCR----GTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPG 289

Query: 262 NLVFTIKEGTECPEGVDLQRHGFDLI-THLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           +++  ++E  +C  G   +    DL+ T   + L  ++ G S  +     GR ++L++ P
Sbjct: 290 DVIIIVQE--QCSTGRYRRFRESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIP 347

Query: 321 GKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFP 356
           G+++ PG+I  + + G P     S  GDLY+   + FP
Sbjct: 348 GELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNFP 385

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  112 bits (281), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 119/434 (27%), Positives = 183/434 (42%), Gaps = 72/434 (16%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           + LYE L V I AT L+IKKAY+K AL++HPDK    +  E+S+ +F+ +  AYE+L D+
Sbjct: 5   TKLYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDK 61

Query: 62  EKRARYDKYGDADGS------------DFFNGPNEFEDAAFM--NFFHSFGSNPQNAY-- 105
           + RA YD  G  D +                G  EF        + F  F  N  NA   
Sbjct: 62  QSRAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQ 121

Query: 106 ---------------DHYGEQKVD----RSADVQVPLNVSMADCYNGKSFKFQSKRTLVC 146
                           H    K D    R  D++  L  ++ + YNGK  K    RT +C
Sbjct: 122 PSQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRLC 181

Query: 147 DRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCA 206
             C G G  +R           C+ C G GF+ + RR+ P    T   TC +CDG G   
Sbjct: 182 LPCNGFGGLQR---------TTCESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAG--- 228

Query: 207 SXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEV------GKSQT 260
                         G G   E K   V +  G +    ++++GEAD+ +       K   
Sbjct: 229 -CFIKPNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIP 287

Query: 261 GNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           G++V TIK+  +      +  +   L+    + L  ++ G    +     G++++L I P
Sbjct: 288 GDVVITIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIP 347

Query: 321 GKVIRPGNIIQIPHEGWPI------DTTT-SGDLYVVVHIEFPPDNWFSERSDLTQVKNV 373
           G++++P     I   G P       DT    GDLY+   I++P      E   +TQ+K  
Sbjct: 348 GEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYPEQ---LENETMTQLK-- 402

Query: 374 LPGETNNNAAVEDD 387
              + N +  V++D
Sbjct: 403 --AQLNKDKYVKED 414

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  110 bits (274), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 107/374 (28%), Positives = 169/374 (45%), Gaps = 51/374 (13%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV  DA++ +IK AYR+ + + HPDK A +   +E+  +F EI  AYEVL D EKR
Sbjct: 21  YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGD---DEAHHKFIEIGEAYEVLSDSEKR 77

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYD------HYGEQKVDRSAD 118
           A YD++    G+D               F      +P + ++      H G Q V + ++
Sbjct: 78  ATYDRF----GADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSN 133

Query: 119 VQVPLNVSMADCYNGKSFKFQSKRTL----VCDRCLGSGWRRRNDHVVPPPQVECKKCGG 174
           + V  +V++   Y+G    F +  TL     C+ C GSG               C+ C G
Sbjct: 134 LIVKDSVTLNGFYHG----FYANLTLDLNDDCEHCHGSGAEDNQ-------FATCETCQG 182

Query: 175 QGFKQRIRRLAPGFATTE-NITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           +G    I+ +  GF T +    C  C GKGK                G  V    K+  +
Sbjct: 183 RGVI--IQVIQMGFMTQQIQQVCGACQGKGKTIKHVCKICR------GARVVKTPKTFEI 234

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLS 293
           S+P G++++  +V  G+A++ V   Q+G+LVF  +E +   E +  +R G  L     L 
Sbjct: 235 SVPAGAQRNYNVVKSGQAEK-VPDMQSGDLVFVFEENSH--ENLGYRRRGDHLYRTEVLH 291

Query: 294 LAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP------IDTTTSGD 346
             EA+  G+ + +    D + + ++     V  PG I ++P+ G P        T   GD
Sbjct: 292 WKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGD 351

Query: 347 LYVVVHI----EFP 356
           L++   I    EFP
Sbjct: 352 LFIEYVIVSPKEFP 365

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  110 bits (275), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 103/402 (25%), Positives = 167/402 (41%), Gaps = 72/402 (17%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           LY  L +   A+Q +IKKAYR  AL++HPDK  +ES  EES+ +F++I+ AY +L DE +
Sbjct: 7   LYNALNIPPTASQSDIKKAYRVQALRYHPDK-NNES--EESKKKFQDISEAYSILRDENQ 63

Query: 64  RARYDKYGDADGSDF----------FNGPNEFEDA-AFMNFF--HSFGSNPQNAYDHYG- 109
           R  YDKYG  + ++           F  P     A  F  FF   +  S   N+   +G 
Sbjct: 64  RKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPFGF 123

Query: 110 ---------------------------EQKVDRSADVQVPLNVSMADCYNGKSFKFQSKR 142
                                       + + +  D+   L  ++ D Y GK  K + +R
Sbjct: 124 PFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRLER 183

Query: 143 TLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGK 202
           + +C  C G G  +R+          C +C G G      RL P   T  + TC  C+G 
Sbjct: 184 SKLCSICKGDGGVKRS---------MCNQCHGDGNITETTRLGPMLQTFTH-TCNICNGN 233

Query: 203 GKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQT-- 260
           G                 G G   E K   V +  G +   QIV   E D+ V K +   
Sbjct: 234 GWVIISQETCQGCN----GVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIP 289

Query: 261 GNLVFTIKEGTE-----CPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQ 315
           GN++  I E  +       +G DL    ++      + L  ++ G    +    + ++++
Sbjct: 290 GNVIIHINEIEDNKFKRVNDGQDLYYWNYE------IDLFTSLCGGVIYIKGHPNNKLIK 343

Query: 316 LQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEFP 356
           + I PG++I  G++  +   G P +     G LY+   +++P
Sbjct: 344 VDILPGEIIESGSVKGVESLGMPKNKGNEYGILYIQFQVKYP 385

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 107/372 (28%), Positives = 168/372 (45%), Gaps = 52/372 (13%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV   A+  +IK AYR+ + ++HPDK   +   E++  RF E+  AYE L D EKR
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALSDPEKR 79

Query: 65  ARYDKYG------------DADGSDFFNGPNEFEDAAF----MNFFHSFGSNPQNAYDHY 108
             YD++G                   F+ P +  D  F     + FH  G          
Sbjct: 80  KIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGG---------- 129

Query: 109 GEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVE 168
           G+++  R   +QV   +++   Y+G S +F       CD C GSG     D  V     +
Sbjct: 130 GQRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG---SQDGKVE----K 182

Query: 169 CKKCGGQGFKQRIRRLAPGFATTE-NITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTE 227
           C +CGG+G   ++ R   GF T +    C  C+G+G+                G+ V  +
Sbjct: 183 CGQCGGRGMVVQVIR--QGFITQQIQQMCQKCEGRGEVIKNKCKTCH------GSKVVKK 234

Query: 228 SKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECP-EGVDLQRHGFDL 286
           +KS  V +P G+ +D   V++GEA++    ++ G++   +    E P + +  +R G DL
Sbjct: 235 NKSFHVDVPAGAPRDFVAVIRGEAEKSP-DTEPGDIYVKV---VESPVQNMGYRRRGPDL 290

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDG-RILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS- 344
                LSL EA+ G      + LD  + + L    G  ++ G +  I   G P+++ T  
Sbjct: 291 FRTEVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGTKY 350

Query: 345 GDLYVVVHIEFP 356
           GDLYV   I  P
Sbjct: 351 GDLYVDYVIVMP 362

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 166/373 (44%), Gaps = 45/373 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ILG+  +A++  IK AYR+ + ++HPDK  ++   EE+   F EI  AYEVL D EKR
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQND---EEAHNHFIEIGEAYEVLSDPEKR 87

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHY---------------- 108
             YD++    GSD F    + +             +P + ++                  
Sbjct: 88  RTYDQF----GSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGG 143

Query: 109 ---GEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPP 165
               + +  ++  +QV   +S+ + + G +  FQ      CD C GSG     D  V   
Sbjct: 144 GGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG---SEDGKVD-- 198

Query: 166 QVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVT 225
             +CK+CGG GF  ++ R+ P      +  CP C G G                 G  + 
Sbjct: 199 --KCKECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAGSTIKNHCKKCH------GQKLV 249

Query: 226 TESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFD 285
           T+SK + V +P G+ +D   +++   D+E+  ++ G+L+   +E  +    +  +R G D
Sbjct: 250 TKSKEINVKVPAGAPRDFLKIVENGGDKELN-AEAGDLLVQFQEIAQ--NNLGYRRRGND 306

Query: 286 LITHLTLSLAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS 344
           L     L   +A+  G+++T+      R +++   PG  +    I ++   G PI  +  
Sbjct: 307 LFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGSDR 366

Query: 345 -GDLYVVVHIEFP 356
            GDLY+   I  P
Sbjct: 367 FGDLYIDYVIIVP 379

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 161/363 (44%), Gaps = 31/363 (8%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ILGV  DA   EIK AYR+ + ++HPDK   +   EE+  +F E+  AY+VL D EKR
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGD---EEAHNKFIEVGEAYDVLSDSEKR 80

Query: 65  ARYDKYG-DADGSDFFNGPNEFEDAAFMN----FFHSFGSNPQNAYDHYGEQKVDRSADV 119
             YD+YG DA  +           + F +    F   F  NP       G     R    
Sbjct: 81  NIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRPRGQ 140

Query: 120 QVPLN--VSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGF 177
            + L   VS+ D YNG+ FK+  +    C++C G+G +   D  V      C  C G+G 
Sbjct: 141 NLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSK---DGKV----TRCPDCQGRGV 193

Query: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPR 237
             ++ ++       +++ C  C G G+                G  V    K  TV LP 
Sbjct: 194 IVQVIQMGIMTQQIQHV-CDRCSGSGEIIKNPCPHCH------GHKVAKMDKEFTVKLPN 246

Query: 238 GSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEA 297
           G++++   +  GEA++       G+L+F  +E +    G   +R G  L     LS+ EA
Sbjct: 247 GAQRNYVDIKHGEAEKG-ADFDAGDLMFEFRENSMNNMG--YRRRGDHLYRTEVLSVQEA 303

Query: 298 IT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS---GDLYVVVHI 353
           +  G+ + L      + ++L+    +V+  G I  +P  G PI  +     GDL++   I
Sbjct: 304 LKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVI 363

Query: 354 EFP 356
             P
Sbjct: 364 LMP 366

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 106/367 (28%), Positives = 158/367 (43%), Gaps = 45/367 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ILG+  +  + EIK AYR+ + + HPDK  ++   E++  +F EI  AYEVL D EKR
Sbjct: 25  YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLSDPEKR 81

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKV----------- 113
             YD++G AD                  F   F    Q     +G               
Sbjct: 82  RMYDQFG-ADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGGFGGG 140

Query: 114 ------DRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQV 167
                  R   ++V   +++ D YNG S  F       CD C GSG     D  V     
Sbjct: 141 QQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG---SEDGKVK---- 193

Query: 168 ECKKCGGQGFKQRIRRLAPGFATTE-NITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTT 226
           +C  CGG+G   ++ R+  G  T +    C  C G G+                G  V  
Sbjct: 194 KCPDCGGRGVVIQVIRM--GIVTQQVQQRCNRCAGSGEIIQNKCKVCS------GAKVQK 245

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEG-VDLQRHGFD 285
           + K ++VS   G  ++   V +GEA++  G  + G+L+    E  E PE  +  +R G D
Sbjct: 246 KEKDISVSFDSGIERNHISVQQGEAEKGPG-IEPGDLIV---EFFEVPEANMGYRRRGKD 301

Query: 286 LITHLTLSLAEAITG-FSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS 344
           L     L+L EAI G +S+ +      + LQL+  P  ++  G + +IP  G PI  +  
Sbjct: 302 LFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKG 361

Query: 345 --GDLYV 349
             GDLY+
Sbjct: 362 KFGDLYI 368

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 102/366 (27%), Positives = 158/366 (43%), Gaps = 34/366 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ILG+  DAT  EIK AYR+ + + HPDK       E++  +F E+  AYEVL D +KR
Sbjct: 23  YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGN---EDAHQKFIEVGEAYEVLSDPQKR 79

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSF----GSNPQNAYDHYGEQKVDRSADVQ 120
             +D++G AD             A F + F  F    G          G+++  R  ++ 
Sbjct: 80  QTFDQFG-ADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGPNIM 138

Query: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR 180
               +S+ D Y G    F      +CD C G+G    +D  + P    C  C G+G   +
Sbjct: 139 AREEISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGKLTP----CPDCQGRGVIIQ 191

Query: 181 IRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRG 238
           + R+      T+ I   C  C GKG+                G  V  + K   V LP+G
Sbjct: 192 LIRMG---MMTQQIQQMCGRCGGKGQLFKKQCRKCH------GNKVMPQKKEFQVKLPKG 242

Query: 239 SRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAI 298
           +++    V  GEAD+     + G+L+    E  +   G   +R G +L     L++ EA+
Sbjct: 243 AKRHYMDVKHGEADKNP-DLEAGDLLIEFNENDKSNMG--YRRRGQNLYRTEVLNVTEAL 299

Query: 299 TGFSKTLTKTLD-GRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGDLYVVVHIE 354
            G  +     LD  + LQ+      V+  G + +IP  G P       T GDL+ + ++ 
Sbjct: 300 YGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLF-IDYVV 358

Query: 355 FPPDNW 360
             P  W
Sbjct: 359 IMPKQW 364

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  100 bits (250), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 154/363 (42%), Gaps = 34/363 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV+  A++ EIK AYR+ + ++HPDK       +E+   F E+  AY+VL D EKR
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGN---DEAHHHFIEVGEAYDVLSDPEKR 78

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMN----FFHSFGSNPQNAYDHYGEQKVDRSADVQ 120
             YD++G AD     +         F +    F   FGSN  N       +   R  ++Q
Sbjct: 79  QIYDRHG-ADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNR-----ARGKPRGQNLQ 132

Query: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR 180
           V  ++S+   Y G  F+F      +CD C GSG               C  CGG G   +
Sbjct: 133 VNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTET-------CPDCGGSGQIMK 185

Query: 181 IRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSR 240
           + R  P         C  C G+G+                G  V  +SK  T  +  G  
Sbjct: 186 VFRAGP-IEQRVRQPCSRCQGRGQLIKHVCKKCK------GVKVVQKSKVFTAKVEPGME 238

Query: 241 QDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITG 300
           ++   V++G++++     + G+L    +E  +  + +  +R G  L     LS  EA+ G
Sbjct: 239 RNHIHVMQGQSEKHP-DIEPGDLYQYFRESEK--DSMGYRRRGNTLYRTEILSFKEALQG 295

Query: 301 FSKTLTKTLDG-RILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFPP 357
             +   +  D  + L L  P G  ++ G    I   G PI + T   GDL ++ ++   P
Sbjct: 296 GWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDL-IIDYVILLP 354

Query: 358 DNW 360
             W
Sbjct: 355 GEW 357

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 156/358 (43%), Gaps = 27/358 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y IL +  DA++ EIK AYR+ + ++HPDK A     +E+  +F EI  AYEVL D EK+
Sbjct: 25  YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGS---DEAHHKFIEIGEAYEVLSDPEKK 81

Query: 65  ARYDKYG-----DADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADV 119
             YD++G     +  G     G   F D  F  F   F          +G+++  R   +
Sbjct: 82  KIYDQFGADAVKNGGGGAGGPGGGGFHD-PFDIFERMFQGGQGGPGGGFGQRQRQRGPTI 140

Query: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQ 179
           +V  N+S+   Y+G S +F       CD C GSG              +C  C G+G   
Sbjct: 141 KVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG-------SADGKLAQCPDCQGRGIIV 193

Query: 180 RIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGS 239
           ++ R+       + I        G+CA              G  VT ++K   V +P G+
Sbjct: 194 QVVRMGIMTQQIQQIC-------GRCAGTGQVIKNQCKTCHGKKVTKKNKFFHVDVPPGA 246

Query: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299
            ++      GEA++       G+LV   +E     E +  +R G +L     LS AEA+ 
Sbjct: 247 PRNYMDTRAGEAEKGP-DFDAGDLVIEFREMD--TENMGYRRRGHNLYRTEVLSAAEALY 303

Query: 300 -GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFP 356
            G+ +T+    + + ++L  P   V+  G I  +   G P  +   GDLY+   +  P
Sbjct: 304 GGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKGSRDHGDLYIDYVVVMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 157/361 (43%), Gaps = 55/361 (15%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILG+  DA+  EIK AYR+ + ++HPDK   +   EE+  +F E+  AY++LGD EKR
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGD---EEAHHKFIEVGEAYDILGDPEKR 78

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVPLN 124
             YD +G AD   F NG        F + F  F           G ++  RS + QV   
Sbjct: 79  KTYDVHG-ADA--FKNGGQGQRGGGFHDPFDMF--EQMFGRQGGGFRQTQRSQNYQVRNQ 133

Query: 125 VSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRL 184
           VS+ + Y+G   +F+     +CD C GSG       V       C  C G+G   ++ R+
Sbjct: 134 VSLKEFYSGGEVEFEIPLNDICDSCHGSGSADGKVKV-------CPACQGRGVVVQVIRM 186

Query: 185 AP--------------GFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKS 230
            P                 T EN  C TC G                      V  ++K 
Sbjct: 187 GPITQQIQQQCGQCGGKGKTIEN-PCKTCKGH--------------------KVVRKNKP 225

Query: 231 LTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHL 290
                P G  ++      GE+D+     ++G+++    E  +  E +  +R G +L    
Sbjct: 226 FHFEFPGGIPRNHIDKKSGESDKSP-DMESGDIIIEYNESEK--ENLGYRRRGNNLYRTE 282

Query: 291 TLSLAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGDLY 348
            ++  EAI  G+++ +    + + ++L  P G ++  G+I +I   G PI  +   GDLY
Sbjct: 283 IITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKNFGDLY 342

Query: 349 V 349
           +
Sbjct: 343 I 343

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 98/355 (27%), Positives = 153/355 (43%), Gaps = 34/355 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV  DA++ EIK AYR+ + ++HPDK   +   E +  +F E+  AYEVL D++KR
Sbjct: 26  YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGD---ETAHHKFIEVGEAYEVLSDDQKR 82

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDH-YGEQKVDRSA------ 117
             Y++YG     +   G +                +P + ++  +G Q+           
Sbjct: 83  QIYNQYGAEALKNGGPGGSGGPGGPGGFG--GGFHDPMDIFEQMFGAQRGGGGRGRPRGH 140

Query: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGF 177
           +++    +++ + Y G S  F       CD C G+G +             C  C GQG 
Sbjct: 141 NLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQ-------DGKTTRCSDCQGQGV 193

Query: 178 KQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
             +I R+ P    T+ I   C  C GKG+                G  V  ++K   V +
Sbjct: 194 VIQIIRMGP---ITQQIQQMCGACQGKGQIIKNKCKQCH------GAKVERKTKHFHVDV 244

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLA 295
           P G+ +D   V  GEAD+  G       V+ IK      + +  +R G  L     L+L 
Sbjct: 245 PAGAPRDFVDVKNGEADK--GPDFDAGDVY-IKFSESSRDNMGYRRRGVHLHRTEVLTLK 301

Query: 296 EAITGFSKTLTKTLDG-RILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYV 349
           EA+ G  K   + LD  + ++L    G  +R G   ++P  G P D    GDL+V
Sbjct: 302 EALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKDGRHFGDLFV 356

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 154/359 (42%), Gaps = 27/359 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV   A   +IK AYR+ + ++HPDK  D+   + +  +F E+  AYEVL D EKR
Sbjct: 22  YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLSDPEKR 78

Query: 65  ARYDKYG--DADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVP 122
             YD+YG      +    G        F + F  F            +++  R  +++  
Sbjct: 79  KIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLETR 138

Query: 123 LNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIR 182
             +++ + Y G S  F       C+ C GSG +   D  V     +C  C G G   +I 
Sbjct: 139 EELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQ---DGKV----TKCPDCKGHGVVVQIV 191

Query: 183 RLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSR 240
           R+ P    T+ I   C  C G+G                 G  V  + KS  V +P G+ 
Sbjct: 192 RMGP---VTQQIQQMCGKCQGRGSTIKNKCKHCH------GEKVVRKPKSFHVDVPPGAP 242

Query: 241 QDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITG 300
           ++   V +GE+D+       G+L     E +   + +  +R G DL     LSL EA+ G
Sbjct: 243 RNFVEVKQGESDKGP-DFDAGDLFIKFSETSR--DNLGYRRRGDDLFRTEALSLREALKG 299

Query: 301 FSKTLTKTLDG-RILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPD 358
             +   + LD  R ++++     V   G I +IP  G P +    GDLY+   +  P D
Sbjct: 300 GWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEHNKFGDLYIDYVVIVPDD 358

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 158/363 (43%), Gaps = 35/363 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y IL ++ DAT+ EIK AYR+ + ++HPDK A     EE+  +F E+  AY+VL D EK+
Sbjct: 25  YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGS---EEAHQKFIEVGEAYDVLSDPEKK 81

Query: 65  ARYDKYGDADG--------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRS 116
             YD++G AD              G   F D  F  F   F          +G+++  R 
Sbjct: 82  KIYDQFG-ADAVKNGGGGGGPGGPGAGGFHD-PFDIFERMFQGGHGGPGGGFGQRQRQRG 139

Query: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQG 176
             ++V   +S+   Y+G S +F       CD C GSG              +C  C G+G
Sbjct: 140 PMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG-------SADGKLAQCPDCQGRG 192

Query: 177 FKQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
              ++ R+      T+ I   C  C G G+                G  VT ++K   V 
Sbjct: 193 VIIQVLRMG---IMTQQIQQMCGRCGGTGQIIKNECKTCH------GKKVTKKNKFFHVD 243

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +P G+ ++      GEA++       G+LV   KE     E +  +R G +L     LS 
Sbjct: 244 VPPGAPRNYMDTRVGEAEKGP-DFDAGDLVIEFKEKD--TENMGYRRRGDNLYRTEVLSA 300

Query: 295 AEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHI 353
           AEA+  G+ +T+    + + ++L  P   V+  G +  +   G P  +   GDLY+   +
Sbjct: 301 AEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGYGDLYIDYVV 360

Query: 354 EFP 356
             P
Sbjct: 361 VMP 363

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 97.4 bits (241), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/366 (25%), Positives = 160/366 (43%), Gaps = 41/366 (11%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+IL ++ DAT  +I+ AYR+ + ++HPDK  ++   E++  +F E+  AYE+L D EKR
Sbjct: 24  YKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILSDPEKR 80

Query: 65  ARYDKYG---------DADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115
            RYD++G            G   F+ P +     F   F   G    +  + + +Q+  R
Sbjct: 81  QRYDQFGPEGVNGQNGGGPGGAGFHDPFDI----FEQMFGGGGGMGGHGGNPFQQQR-QR 135

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
             +V    + S+ + YNG   KF      +CD C GSG    ND        +C  C G+
Sbjct: 136 GQNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG---SND----GKSTKCPDCQGR 188

Query: 176 GFKQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           G   ++ R+      T+ I   C  C GKG+                G+ V  + K   +
Sbjct: 189 GVTVQVIRMG---MMTQQIQQVCGKCGGKGQIIKNPCKTCH------GSKVVQKPKDFEI 239

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLS 293
            LP G+ +       G AD+      +G++     E  +  + +  +R G  L     L+
Sbjct: 240 ELPAGAPRKFVHAEHGAADKHP-DYDSGDVYIEFTENDK--DNMGYRRRGPHLYRTEVLN 296

Query: 294 LAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVV 350
             EA+  G+ + L      +I+ ++  P K+I+ G   +I   G P+       GDL++ 
Sbjct: 297 ATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFID 356

Query: 351 VHIEFP 356
             +  P
Sbjct: 357 YVVVMP 362

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 153/363 (42%), Gaps = 37/363 (10%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV  DA+  EIK AYR+ + + HPDK   +   E++  +F E+  AYEVL D++KR
Sbjct: 27  YGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGD---EDAHHKFIEVGEAYEVLSDDQKR 83

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHY-------GEQKVDRSA 117
             YD++    G++                F     +P + ++         G +   R  
Sbjct: 84  QIYDQH----GAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRPRGH 139

Query: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGF 177
           +++    +++   Y G S  F       C+ C GSG +             C +C GQG 
Sbjct: 140 NLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQ-------DGKTTHCSECRGQGV 192

Query: 178 KQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSL 235
             ++ R+ P    T+ I   C  C GKG+                G  V  ++K   V +
Sbjct: 193 VIQVVRMGP---LTQKIQQMCGACQGKGQVIKNKCKRCH------GAKVERKAKHFHVDV 243

Query: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLA 295
           P G+ +D   V  GEAD+  G       VF IK      + +  +R G  L     LSL 
Sbjct: 244 PAGAPRDFVDVKAGEADK--GPDFDSGDVF-IKFSESSRDNMGYRRRGPHLYRTEVLSLK 300

Query: 296 EAITGFSKTLTKTLD-GRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGDLYVVVHI 353
           EA+ G  K   +  D  + L+LQ   G  +R G I ++P  G P       GDL+V   +
Sbjct: 301 EALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKHGDLFVDYVV 360

Query: 354 EFP 356
             P
Sbjct: 361 VIP 363

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 101/364 (27%), Positives = 156/364 (42%), Gaps = 36/364 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y IL V+ DA++ EIK AYR+ + ++HPDK    S  EE+  +F E+  AY+VL D EK+
Sbjct: 25  YAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSDPEKK 81

Query: 65  ARYDKYGDADG---------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115
             YD++G AD               G   F D  F  F H F          +G+++  R
Sbjct: 82  KIYDQFG-ADAVKNGGGGGGGAGGPGGGGFHD-PFDIFEHMFQGGHGGPGGGFGQRQRQR 139

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
              ++V   +S+   Y+G S +F       CD C GSG              +C  C G+
Sbjct: 140 GPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG-------SADGKLAQCPDCQGR 192

Query: 176 GFKQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTV 233
           G   ++ R+      T+ I   C  C G G+                G  V  ++K   V
Sbjct: 193 GVIIQVLRMG---IMTQQIQQMCGRCGGTGQIIKNQCKTCH------GKKVIKKNKFFHV 243

Query: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLS 293
            +P G+ ++      GEA++       G+LV   KE     E +  +R G +L     LS
Sbjct: 244 DVPPGAPRNYLDTRAGEAEKGP-DFDAGDLVIEFKEKD--TENMGYRRRGDNLYRTEVLS 300

Query: 294 LAEAIT-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVH 352
             EA+  G+ +T+    + + ++L  P   V+  G I  +   G P      GDLY+   
Sbjct: 301 AEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKGHGDLYIDYV 360

Query: 353 IEFP 356
           +  P
Sbjct: 361 VIMP 364

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 152/359 (42%), Gaps = 29/359 (8%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y IL ++  A++ EIK AYR+ + + HPDK A     EE+  +F E+  AY+VL D EK+
Sbjct: 25  YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGS---EEAHQKFIEVGEAYDVLSDPEKK 81

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMN----FFHSFGSNPQNAYDHYGEQKVDRSADVQ 120
             YD++G     +  +G        F +    F   F          +G+++  R   ++
Sbjct: 82  KIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGPMIK 141

Query: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQR 180
           V   +S+   Y+G S +F       CD C GSG              +C  C G+G   +
Sbjct: 142 VQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG-------SADGKLAQCPDCQGRGVIIQ 194

Query: 181 IRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRG 238
           + R+      T+ I   C  C G G+                G  VT  +K   V +P G
Sbjct: 195 VLRMG---IMTQQIQQMCGRCGGTGQVIKNECKTCH------GNKVTKRNKFFHVDVPPG 245

Query: 239 SRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAI 298
           + ++      GEA++       G+LV   KE     E +  +R G +L     LS+ EA+
Sbjct: 246 APRNYMDTRAGEAEKGP-DFDAGDLVIEFKEKD--SENMGYRRRGDNLYRTEVLSIEEAL 302

Query: 299 T-GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFP 356
             G+ +T+    + + ++L  P    +  G I  +   G P      GDLY+   +  P
Sbjct: 303 YGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMPKGGKGYGDLYIDYVVIMP 361

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 161/364 (44%), Gaps = 42/364 (11%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILGV+ +AT+ +IK AYR+ + ++HPDK   ++    +   F E+  AYE L D EKR
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHY---------GEQKVDR 115
             YD+YG A+        N          FH    +P + ++           G+++  R
Sbjct: 80  RIYDQYG-AEALK-----NGGGAEGGHGGFH----DPFDIFEQMFGGGARFGGGQRRRQR 129

Query: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQ 175
           S  +QV   +++   Y+G + +F       CD C  +G     D  V      C +C  +
Sbjct: 130 SQSLQVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATG---SQDGKVE----RCTQCSVR 182

Query: 176 GFKQRIRRLAPGFATTE-NITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVS 234
           G   ++ R   GF T +    CP   G    A              G     ++KS  V 
Sbjct: 183 GVIVQVGR--QGFMTQQFQQVCPRLLGPWPKALPKKCKVCQ-----GHKAIKKNKSFRVE 235

Query: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294
           +P G+ +D   V +GEA++ V     G++   + E T   + +  +R G +L     LSL
Sbjct: 236 VPPGAPRDFVAVQQGEAEK-VPDMDPGDIYVKVFENTR--DNMGYRRQGANLFRTEVLSL 292

Query: 295 AEAITGFSKTLTKTLD-GRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGDLYVVVH 352
            EA+ G  K   + LD  + +      G+ ++ G + ++P  G P+ D+   GDLYV   
Sbjct: 293 KEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAGFGDLYVDYV 352

Query: 353 IEFP 356
           +  P
Sbjct: 353 VILP 356

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 151/370 (40%), Gaps = 49/370 (13%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y ILG+  DA+  EIK +YR+ + + HPDK   +   EE+  +F EI  AYEVL D EKR
Sbjct: 23  YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGD---EEAHHKFIEIGEAYEVLSDPEKR 79

Query: 65  ARYDKYGDADG------------SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQK 112
             +D+YG AD                FN P       F  F   F          +G  +
Sbjct: 80  KIFDQYG-ADALKNGGPGGPGGGGGGFNDP-------FDIFEQMFNRGGGGGGGGFGRMQ 131

Query: 113 VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKC 172
             R  +++V   +S+ + Y G + +F      +CD C G+G              +C  C
Sbjct: 132 RPRGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG-------SADGKVAKCSDC 184

Query: 173 GGQGFKQRIRRLAPGFATTENI--TCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKS 230
            G+G   ++ R+      T+ I   C  C GKG                 G+ V  + K 
Sbjct: 185 QGRGVVIQVIRMG---MMTQQIQQMCGRCGGKGSVIKNHCKTCH------GSKVVKKQKP 235

Query: 231 LTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHL 290
             V +P G+ +       GE+D+       G++     E T     +  +R G  L    
Sbjct: 236 FHVEVPPGAARHYTETRSGESDKG-ADFDAGDVFIEFNEKT--TNNLGYRRRGPHLYRTE 292

Query: 291 TLSLAEAITGFSKTLTKTLDGRILQLQIPPGK--VIRPGNIIQIPHEGWPIDTTTS--GD 346
            LS  EA+ G  +   + LD +  +++I   K  V+  G + +IP  G P        GD
Sbjct: 293 VLSAREALKGDWQREVEFLDEK-KKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGD 351

Query: 347 LYVVVHIEFP 356
           L++   +  P
Sbjct: 352 LFIEYVVVMP 361

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 139/324 (42%), Gaps = 47/324 (14%)

Query: 79  FNG---PN-EFEDAAFMNFFHSFGSNPQNAYDHYGEQK-VDRSADVQVPLNVSMADCYNG 133
           FNG   PN  F + + MN  +S    P + Y+  GE+  ++R  D++  L  ++ + Y G
Sbjct: 145 FNGSSTPNFPFGNGSGMNSLYS----PSSKYNTTGEEHHLNRGPDIKHNLKCTLKELYMG 200

Query: 134 KSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTEN 193
           K+ K    RT +C  C G G  R+           CK C GQG + + +R+ P    + +
Sbjct: 201 KTAKLGLNRTRICHVCDGHGGLRK---------YTCKPCKGQGIQTQTKRMGP-LVQSWS 250

Query: 194 ITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ 253
            TC  C G G                 G G   + K L V++  GS  +  IVL GE D+
Sbjct: 251 QTCADCGGAGTFVKNKDICEQCQ----GLGFIKQRKILQVTVQPGSCHNQLIVLTGEGDE 306

Query: 254 EVG-------KSQTGNLVFTIKE----GTECPEGVDLQRHGFDLITHLTLSLAEAITGFS 302
            +        K   G++V TI        +  +  DL      +     + L  ++ G  
Sbjct: 307 VISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDL------ICKKCEVDLMTSLCGGI 360

Query: 303 KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP--IDTTTS--GDLYVVVHIEFPPD 358
             +     G+++++ I PG+V++PG    + + G P  I+   S  G LYV   + +P  
Sbjct: 361 VYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKFDVTYPER 420

Query: 359 NWFSERSDLTQVKNVLPGETNNNA 382
               E  +  +VK++L  +   NA
Sbjct: 421 ---LEPENAAKVKSILANDKYINA 441

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          ++LY+ L V   A+  EIKKAYR AAL++HPDK    +  EES+ +F+EI  AYEVL D 
Sbjct: 5  TSLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDN 61

Query: 62 EKRARYDKYGDAD 74
            R+ YD+YG  D
Sbjct: 62 HLRSLYDQYGTTD 74

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 103/391 (26%), Positives = 169/391 (43%), Gaps = 70/391 (17%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREE--SEVRFKEIAAAYEVLGDEE 62
           Y+ LGV  DA+  +IK+AY K A ++HPD      + +E  ++  F  +  AYE+L DE+
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPD------INKEPGADKTFHNLQNAYEILSDEK 103

Query: 63  KRARYDKY--------GDADGSDFFN------GPNEFEDAAFMNFFHSFGS--------N 100
           K+ +YD+Y        G+A+G+  FN        + F D   +NF   FG+        N
Sbjct: 104 KKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRN 163

Query: 101 PQNAYDHYGEQKVDRSA---DVQVPLNVSMADC---YNGKSFKFQSKRTLVCDRCLGSGW 154
             +A    G   + R      +++   VS  D     N  S K++S     C  C GSG 
Sbjct: 164 GGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDP--CGTCHGSGL 221

Query: 155 RRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXX 214
           +    H     +  C  C G G +  ++    GF      TC  C G+G   +       
Sbjct: 222 KNGEQH----KRKTCSYCNGTGTQVHVK---SGFQMAS--TCMHCHGEGTTIAREDTCSA 272

Query: 215 XXXXXVGTGVTTES-KSLTVSLPRGSRQDDQIVLKGEA----------DQEVGKSQTGNL 263
                 G GV   S KSL V+ P G    D I + GE           D+ + K   G+L
Sbjct: 273 CD----GDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSI-KLSRGDL 327

Query: 264 VFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKV 323
           +  I+  ++    V   ++ +D+ T   + +  A  G +  + +T+DG+ ++L++  G  
Sbjct: 328 LVRIRVKSDPKFFV---KNKYDIWTIKEIPITTAALGGTVEI-ETVDGKNIRLKVISG-- 381

Query: 324 IRPGNIIQIPHEGWPI-DTTTSGDLYVVVHI 353
            +   +  IP+ G P  + T  G++ V   I
Sbjct: 382 TQHDQVTSIPNMGIPYRNGTGRGNMNVQYKI 412

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 154/374 (41%), Gaps = 47/374 (12%)

Query: 5   YEILGVEID-ATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           Y+ILG+  +   + EIK AYRK + ++HPDK  ++   ++++  F ++  AY+VLGD +K
Sbjct: 26  YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKND---KDAQQNFIKVGEAYDVLGDPDK 82

Query: 64  RARYDKYG-DADGSDFFNGPNE-----------FEDA--AFMNFFHSFGSNPQNAYDHYG 109
           + +YD+ G DA    F N               F D    F   FH  G    N +    
Sbjct: 83  KRQYDQMGHDA----FVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNP 138

Query: 110 EQKVDRSA---DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQ 166
                       ++V   +S+   Y G  F+F       CD C G+G       V     
Sbjct: 139 FGGGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTKV----- 193

Query: 167 VECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTT 226
             C  C G G   +I R+      T+ I  P     G+C               G  V  
Sbjct: 194 --CPDCKGSGIIIQIIRMG---MMTQQIQQPC----GRCRGQGHLIKNFCKVCNGAKVQQ 244

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECP-EGVDLQRHGFD 285
           + K   V +P GS ++   V  G+A++     + G+++    E  E P + +  +R G +
Sbjct: 245 KLKDFKVYVPPGSPRNHVEVKAGQAEKNPN-YEPGDVII---EFNELPLDNLGYRRRGNN 300

Query: 286 LITHLTLSLAEAITG-FSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS 344
           L     +SL EA+ G + +TL      + + L+  P   I  G I  +   G PI    +
Sbjct: 301 LFRTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKN 360

Query: 345 --GDLYVVVHIEFP 356
             GDLY+   +  P
Sbjct: 361 KFGDLYIDYKVIIP 374

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 3/70 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          S  Y++LGV   AT +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VLGD+
Sbjct: 5  SEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDD 61

Query: 62 EKRARYDKYG 71
          E RA+YDKYG
Sbjct: 62 ELRAKYDKYG 71

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 106/394 (26%), Positives = 161/394 (40%), Gaps = 70/394 (17%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE LGV  DA+  +IKKAY K A ++HPD   DE     +E +F ++  AYE+L DE KR
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEG----AEKKFHDLQNAYEILSDESKR 108

Query: 65  ARYDKYGDADGSD------------------FFNGPNEFEDAAFMNFFHSFGS------- 99
           ++YD++G A  S                    F G   F D   +NF   FG+       
Sbjct: 109 SQYDQFGAAAFSQGGAAGPGNGAGGFQGGFAGFGGFEGFGDFGGINFEDLFGAAFRGGSG 168

Query: 100 ------NPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNG-KSFKFQSKRTLVCDRCLGS 152
                   +N  +   E K D    + VP NVS  D   G K  K +      C  C GS
Sbjct: 169 SGASGARGRNGANFVREYKGD---SIHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGS 225

Query: 153 GWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXX 212
           G +          +  C  C G G +  +R    GF      TC  C+G+G         
Sbjct: 226 GLKS------GAKRSSCSICHGTGTQMHVR---AGFQMAS--TCTQCNGEGSSIRRSDQC 274

Query: 213 XXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEA-------DQEVG---KSQTGN 262
                  V   V    K + V LP G +  D + +  +        D E+    +++ G+
Sbjct: 275 SSCRGEGV---VFNRQKEIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGD 331

Query: 263 LVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGK 322
           L+  I+   +    +   R+ +D+     + +  A  G    +  T+DG  L+L+I PG 
Sbjct: 332 LLIQIRVERDPRFQI---RNNYDIWYTQDIPITTAALGGVVNIP-TVDGEQLRLKIAPG- 386

Query: 323 VIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEF 355
             +   ++ +P++G P   T S GD+ V   I  
Sbjct: 387 -TQHEQVVSVPNKGVPKGLTASRGDMKVQYKISL 419

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 154/391 (39%), Gaps = 78/391 (19%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y +LGV+  A+Q EIKKAY K A Q+HPD   +      +E +F ++  AYE+L DE KR
Sbjct: 37  YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAG----AEKKFHDLQNAYEILSDESKR 92

Query: 65  ARYDK------------------YGDADGSDFFNG-----PNEFEDAAFMNFFHSF---- 97
            ++D+                  Y    G + F        + F D   +NF   F    
Sbjct: 93  KQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFEDLFGAAF 152

Query: 98  -------------GSNPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNGKS-FKFQSKRT 143
                            +N +   G ++  +   V V  N+S  D   GKS  K +    
Sbjct: 153 SGSGGAGGAKAGGAGASRNPFSSSGYRQY-KGDSVHVSYNMSFKDAVFGKSGVKLKFNVF 211

Query: 144 LVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKG 203
             CD C GSG ++         + +C  C G G K  +R    GF      TC  C G+G
Sbjct: 212 DPCDTCSGSGIKKGAS------RHQCPGCQGSGTKIHVR---GGFQMMS--TCNECQGEG 260

Query: 204 KCASXXXXXXXXXXXXVGTGVT-TESKSLTVSLPRGSRQDDQIVLKGEADQ-EVG----- 256
              +             G GV     K +TV LP G +  D I + G+    EV      
Sbjct: 261 TTVNSSDLCGACH----GEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSL 316

Query: 257 ----KSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGR 312
               K   G+++  ++   +    +   R   D+   + + +  A  G       T+DG 
Sbjct: 317 AGSVKLTRGDVLVNVRVEEDPTFTI---RDKSDIWYTMEIPITTAALG-GTVQVPTVDGS 372

Query: 313 ILQLQIPPGKVIRPGNIIQIPHEGWPIDTTT 343
            ++L++ PG   + G++I +P+ G P    T
Sbjct: 373 HIRLKVAPG--TQSGDVITVPNMGVPRSNLT 401

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.157
           YIR004W
          Length = 425

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 60/101 (59%), Gaps = 8/101 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YEILGV   AT +EIKKAYRK ++Q HPDK  D+ +  E   RF+ I+ AY+VL DE+ R
Sbjct: 8   YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDEDLR 64

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
            +YD++G  +          FEDAA   F   FG +   +Y
Sbjct: 65  GKYDRFGKTEAVP----KGGFEDAA-EQFSVIFGGDAFASY 100

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (59%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y++LGV  DA Q++IKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VLG +
Sbjct: 5   TTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSD 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E RA+YDK+G  +        N FEDA    F   FG     +Y
Sbjct: 62  ELRAKYDKFGKDEAV----PQNGFEDAG-EQFAAIFGGEAFASY 100

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (64%), Gaps = 9/85 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV   AT +EIKKAYRK A+Q HPDK  D+    E+E +F+ +  AY+VL D E R
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDP---EAETKFQAVGEAYQVLSDTELR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDA 88
          +RYD++G  D       P + FEDA
Sbjct: 65 SRYDQFGKDDAV-----PQQGFEDA 84

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
           {ON} similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 433

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (57%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y++LGV  DA Q++IKKAYRK +++ HPDK  D+    E   RF+ I+ AY+VL  E
Sbjct: 5   TTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSE 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E R +YDK+G  +        N FEDA    F   FG     +Y
Sbjct: 62  ELRMKYDKFGKEEAM----PKNGFEDAG-EQFAAIFGGEAFTSY 100

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV   A+ +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VLGD++ R
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 65 ARYDKYG 71
          A+YDKYG
Sbjct: 65 AKYDKYG 71

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {ON}
           Anc_7.157
          Length = 482

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 60/101 (59%), Gaps = 8/101 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LG+E  ATQ EIKKAYRK +++ HPDK  ++    E   RF+ I+ AY+VL DE  R
Sbjct: 8   YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE---RFQAISEAYQVLSDESLR 64

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
            +YDKYG  +        N FEDAA   F   FG +   +Y
Sbjct: 65  LKYDKYGKKEAIP----QNGFEDAA-EQFSAIFGGDAFASY 100

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
           (DJP1) - involved in peroxisome biogenesis [contig 135]
           FULL
          Length = 421

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 10/105 (9%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y++LGV+  A  ++IKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL  E
Sbjct: 6   TTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKE 62

Query: 62  EKRARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHSFGSNPQNAY 105
           + RA+YDKYG  +       P E FEDAA   F   FG +   +Y
Sbjct: 63  DLRAKYDKYGKEEAI-----PKEGFEDAA-EQFSMIFGGDAFASY 101

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 395

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 62/98 (63%), Gaps = 12/98 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LG++ DA+  EIKKAYRK A+  HPDK  D+    E++ +F+ I  AY+VL D E R
Sbjct: 8   YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGQAYQVLSDPELR 64

Query: 65  ARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHS-FGSN 100
           +RYD++G  D       P + FEDAA   FF + FG +
Sbjct: 65  SRYDEFGKEDAV-----PQQGFEDAA--EFFSTIFGGD 95

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV   A+ +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VLGD+E R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDDELR 64

Query: 65 ARYDKYG 71
          A+YDK+G
Sbjct: 65 AKYDKFG 71

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 3/70 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV+ DAT  +IKKAYRK A+Q HPDK  ++    E++ +F+E++ AY+VL D E R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDP---EAQAKFQEVSKAYKVLSDGELR 64

Query: 65 ARYDKYGDAD 74
          +RYD+ G +D
Sbjct: 65 SRYDEVGLSD 74

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+ LE+KKAYRK ALQ+HPDK  D    EE+  +F  I AAYEVL D ++R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAVIRAAYEVLSDPQER 63

Query: 65 ARYDKYGD 72
          A YD + +
Sbjct: 64 AWYDSHKE 71

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 105/393 (26%), Positives = 168/393 (42%), Gaps = 73/393 (18%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG++  AT  EIKKAY K A ++HPD +  E    ++E +F ++  AYE+L DE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEV---DAEKKFHDLQNAYEILSDENKR 118

Query: 65  ARYDK-------------------------------YGDADGSDFFNGPNEFEDAAFMNF 93
            +YD+                               + +A GS F  G   FED  F   
Sbjct: 119 QQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPF--GGINFED-LFGAA 175

Query: 94  FHSFGSNPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLV--CDRCLG 151
           F   G +           +  R   +++   VS  D   G S   Q K + +  C  C G
Sbjct: 176 FGGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFG-SNNVQLKFSALDPCSTCSG 234

Query: 152 SGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXX 211
           +G  + N H     +V C  C G G    IR    GF      TCPTC+G+G        
Sbjct: 235 TGM-KPNTH-----KVNCSTCHGTGTTVHIR---GGFQMMS--TCPTCNGEGTMKRPQDS 283

Query: 212 XXXXXXXXVGTGV-TTESKSLTVSLPRGSRQDDQIVLKG---------EAD-QEVGKSQT 260
                    G GV    +K++TV LP G +  D + + G         EAD ++  K   
Sbjct: 284 CTKCH----GEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSR 339

Query: 261 GNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           G+++  I+   +    +   ++ +D+     + +  A  G + T+  T++G+ +++++ P
Sbjct: 340 GDILVRIRVDKDPNFSI---KNKYDIWYDKEIPITTAALGGTVTIP-TVEGQKIRIKVAP 395

Query: 321 GKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHI 353
           G   +   +I IP+ G P  TT  GD+ +   I
Sbjct: 396 G--TQYNQVISIPNMGVPKTTTIRGDMKIQYKI 426

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 51/80 (63%), Gaps = 11/80 (13%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+ LE+KKAYRK ALQ+HPDK  D    EE+  +F  I AAYEVL D ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATEKFAIIRAAYEVLSDSQER 63

Query: 65 ARYDKYG---------DADG 75
          A YD +          DADG
Sbjct: 64 AWYDSHKEQILNDTPPDADG 83

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A+  EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDS 58

Query: 62 EKRARYDKYG 71
           KR+ YD+YG
Sbjct: 59 NKRSVYDQYG 68

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 9/132 (6%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + ++L  G ++  ++  K   D          L F IKE          +R G ++
Sbjct: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPL----YKRDGDNI 269

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT--TS 344
           I  L L+  E++ GFSKTL +TLDGR L L     + ++P      P +G PI       
Sbjct: 270 IYTLPLTFKESLLGFSKTL-QTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQR 326

Query: 345 GDLYVVVHIEFP 356
           G+L +   I +P
Sbjct: 327 GNLIIKYKINYP 338

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 62/118 (52%), Gaps = 19/118 (16%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE+LGVE +AT +E+KKAYR+ ALQ HPDK  D    EE+   F  + AAYEVL D ++R
Sbjct: 6   YELLGVETNATDVELKKAYRRKALQFHPDKNPDNV--EETTAIFASVRAAYEVLADPQER 63

Query: 65  ARYDKY-----------GDADGSDFFN----GPNEFEDAAFMN--FFHSFGSNPQNAY 105
           A YD +            DAD     +    G    E   F N   + +FG++P   Y
Sbjct: 64  AWYDDHKEQILNDSVNLDDADDESHLDSSITGVTSDELLMFFNSSLYTNFGNSPSGVY 121

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON}
          Anc_2.218 YNL077W
          Length = 554

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY+IL V  D+ +  IKKAYR  AL++HPDK    +L EES+  F++I+ AY VL ++
Sbjct: 5  TQLYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNK 61

Query: 62 EKRARYDKYGDAD 74
          +KR  YDKYG  D
Sbjct: 62 DKRQMYDKYGTVD 74

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 118/286 (41%), Gaps = 41/286 (14%)

Query: 110 EQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVEC 169
           ++ + R  D++  L  ++++ Y+GK  K + +RT  C +C G G               C
Sbjct: 224 DKNLKRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK---------SC 274

Query: 170 KKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXXXXXXXVGTGVTTESK 229
            KC G+G   + ++  P    T   TC  C G G  A              G G   E K
Sbjct: 275 SKCNGRGSLTQTKKFGP-MTQTFTQTCDGCGGNGTFADAQDICNECQ----GEGFLNEKK 329

Query: 230 SLTVSLPRGSRQDDQIVLKGEADQ----EVGKSQT--GNLVFTIKEGTECPEGVDLQRHG 283
              V +  G      I+L GEAD+     +GK +   G+++ TI      P+       G
Sbjct: 330 IFEVEITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTI---NLLPDPTFKVVQG 386

Query: 284 FDLI-THLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP-IDT 341
            DL+  +  ++L  ++ G S  +       ++++ I PG++I+ G I  + + G P ID 
Sbjct: 387 ADLLYANYKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDL 446

Query: 342 -------------TTSGDLYVVVHIEFPPDNWFSERSDLTQVKNVL 374
                        T  G+L +   I +P      E   + +++N+L
Sbjct: 447 SVGHSNDIQANKPTLKGNLVIHFEIVYPD---MLETDTVIELQNIL 489

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {ON}
           similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 429

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y++LGV  +A  +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL +E
Sbjct: 5   TTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNE 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E R +YDK+G  +        N FEDAA   F   FG +   +Y
Sbjct: 62  ELRTKYDKFGKEEAVP----QNGFEDAA-EQFSAIFGGDAFASY 100

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
          (REAL)
          Length = 536

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          ++LY+ L V   A+  EIKKAYR AAL++HPDK    +  EES+ +F+EI  AYEVL D 
Sbjct: 5  TSLYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDN 61

Query: 62 EKRARYDKYGDAD 74
            R+ YD+YG  D
Sbjct: 62 HLRSLYDQYGTTD 74

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 122/300 (40%), Gaps = 48/300 (16%)

Query: 99  SNPQNAYDHYG----EQKVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGW 154
           +N Q+    YG    E  ++R  D++  L  ++ + Y GK+ K    RT +C  C G G 
Sbjct: 166 NNLQSPPSKYGSDDDEHHLNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGG 225

Query: 155 RRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXXX 214
            ++           CK C GQG + + + + P    + + TC  C G G           
Sbjct: 226 LQK---------YTCKTCKGQGVQTQTKCMGP-LVQSWSQTCADCGGAGIFVESKDICQQ 275

Query: 215 XXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQ------TGNLVFTIK 268
                 G G   + K L V++  G+  +  IVL GE D+ + K         G++V TI 
Sbjct: 276 CQ----GLGFIKQRKILQVTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITI- 330

Query: 269 EGTECPEGVDLQRHGFDLITHLTL-------SLAEAITGFSKTLTKTLDGRILQLQIPPG 321
                   + L+   F +  + +L        L  ++ G    +     G++++L I PG
Sbjct: 331 --------LRLKDPKFQVTDNCSLIYKKCKVDLMTSLCGGIVYIEGHPSGKLIKLDIIPG 382

Query: 322 KVIRPGNIIQIPHEGWP--IDTTTS--GDLYVVVHIEFP----PDNWFSERSDLTQVKNV 373
           +V++P     I   G P  I+   S  G LYV   + +P    P+N    +  L   K +
Sbjct: 383 EVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVKFDVSYPERLEPENAMKLQKILAHDKYI 442

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
           Anc_7.157
          Length = 414

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 59/101 (58%), Gaps = 8/101 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE+LG+   AT +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL D+  R
Sbjct: 8   YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDDTLR 64

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
            +YDKYG  +          FEDAA   F   FG +  ++Y
Sbjct: 65  LKYDKYGKKEAVP----TGGFEDAA-EQFSAIFGGDAFSSY 100

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} similar
           to uniprot|P40564 YIR004W Saccharomyces cerevisiae DJP1
           Cytosolic J-domain-containing protein, required for
           peroxisomal protein import
          Length = 419

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 63/105 (60%), Gaps = 10/105 (9%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y++LGV  DA  ++IKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL  +
Sbjct: 5   TTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKD 61

Query: 62  EKRARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHSFGSNPQNAY 105
           + RA+YDK+G  +       P E FEDAA   F   FG +   +Y
Sbjct: 62  DLRAKYDKFGKEEAV-----PKEGFEDAA-EQFSMIFGGDAFASY 100

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 51/80 (63%), Gaps = 11/80 (13%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+ LE+KKAYRK ALQ+HPDK  D    EE+  +F  I AAYEVL D ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAIIRAAYEVLSDSQER 63

Query: 65 ARYDKYG---------DADG 75
          A YD +          DADG
Sbjct: 64 AWYDSHKEQILNDTPPDADG 83

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK Y+KAAL++HPDK A ++       +FKEI+ AYE+L D 
Sbjct: 5  TKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDT------EKFKEISEAYEILSDS 58

Query: 62 EKRARYDKYG 71
           KR  YD+YG
Sbjct: 59 SKREIYDQYG 68

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 65/137 (47%), Gaps = 11/137 (8%)

Query: 223 GVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRH 282
           G + E   + + L  G +   +I  K E D          L F ++E +        +R 
Sbjct: 214 GGSFEKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHP----LYKRD 269

Query: 283 GFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDT 341
           G +LI  L LS  E++ GFSKT+ +T+DGR L + +I P   ++P  +   P +G P+  
Sbjct: 270 GDNLIYSLPLSFKESLLGFSKTI-QTIDGRTLPISKIQP---VQPTEVSSYPGQGMPVSK 325

Query: 342 TTS--GDLYVVVHIEFP 356
                GDL V   I++P
Sbjct: 326 RPGQRGDLVVKYKIDYP 342

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 107/404 (26%), Positives = 165/404 (40%), Gaps = 85/404 (21%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y +LGV   A+  EIKKAY K A ++HPD     + + ++E +F ++  AYE+L DE KR
Sbjct: 81  YSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDENKR 136

Query: 65  ARYDKYG--------------------------------DADGSDFFNGPNEFED---AA 89
            +YD +G                                   G+ F +    FED   AA
Sbjct: 137 KQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINFEDLFGAA 196

Query: 90  FMNFFHSF-GSNPQNAYDHYGEQKVDRSADVQVPLNVSMADCYNG---KSFKFQSKRTLV 145
           F N  H+  G   +   + Y E K D    +++  N++  D   G    + KF S     
Sbjct: 197 FGNGPHATGGGRARRQSNIYREFKGD---PIEIVHNLNFKDAVFGVQNVNLKFNSMDP-- 251

Query: 146 CDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKC 205
           C++C GSG  R         +  C  C G G K  IR    GF      TC  C G+G  
Sbjct: 252 CNKCSGSGLNRN------AKRTTCPSCHGSGQKVHIRS---GFQMVS--TCNHCHGEGTI 300

Query: 206 ASXXXXXXXXXXXXVGTGV-TTESKSLTVSLPRGSRQDDQIVLKGEADQ-EVGKS----- 258
                          G GV    +KS+ V+LP G +  D I + G+ +  + G S     
Sbjct: 301 IDSKDICSSCH----GDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAM 356

Query: 259 ------QTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGR 312
                   G+L+  ++   +    +   R  +D+     + +  AI G    +  T+DG 
Sbjct: 357 MNSIKLSRGDLLVRVRVNKDPNFSI---RDKYDIWFTKQIPITTAILGGVVKIP-TVDGT 412

Query: 313 ILQLQIPPGKVIRPGNIIQIPHEGWP---IDTTTSGDLYVVVHI 353
            ++L++ PG   +   II IP+ G P   I+    G++ V   I
Sbjct: 413 QIRLKVSPG--TKHDQIISIPNLGVPRSSINKDNRGNMKVQYKI 454

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV   A+ +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VLGD E R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDNELR 64

Query: 65 ARYDKYG 71
           +YDKYG
Sbjct: 65 VKYDKYG 71

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A   EIKK YRKAALQ+HPDK    +       +FK+I+ AYE+L D 
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNT------EKFKQISEAYEILSDS 58

Query: 62 EKRARYDKYG 71
           KR  YD+YG
Sbjct: 59 NKREVYDQYG 68

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 64/138 (46%), Gaps = 9/138 (6%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G G + E K + + L RG +   +I  K E D          L F ++E          +
Sbjct: 195 GPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQEKAHPL----FK 250

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGW--P 338
           R G +L+  + LS  E++ GFSKT+ +T+DGR L L     + I+P      P +G   P
Sbjct: 251 RDGENLLYTVPLSFQESLLGFSKTV-QTIDGRSLSLSR--TQPIQPTETTTYPGQGMPNP 307

Query: 339 IDTTTSGDLYVVVHIEFP 356
            +    GDL +   I++P
Sbjct: 308 KNPNQRGDLIITYKIDYP 325

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
           {ON} highly similar to uniprot|P40564 Saccharomyces
           cerevisiae YIR004w DJP1
          Length = 425

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           ST Y++LG+   AT +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL  E
Sbjct: 5   STYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSE 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E RA+YDK+G  +          FEDAA   F   FG     +Y
Sbjct: 62  ELRAKYDKFGKQEAIP----KGGFEDAA-EQFSAIFGGEAFASY 100

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + EIKK YRKAAL++HPDK   ++       +FK+I+ AYE+L D 
Sbjct: 5  TKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKQISEAYEILSDS 58

Query: 62 EKRARYDKYG 71
           KR  YD+YG
Sbjct: 59 NKREIYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 60/138 (43%), Gaps = 9/138 (6%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G G   E   + + L  G +   ++  K + D          L F I E          Q
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHP----TFQ 271

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPID 340
           R   +L+  + L+  E++ GFSKT+ +T+DGR   L I   + I+P  I + P +G PI 
Sbjct: 272 REDDNLVCTVPLTFKESLLGFSKTV-QTIDGR--NLPISRSQPIQPTEITRYPGQGMPIS 328

Query: 341 TTTS--GDLYVVVHIEFP 356
                 GDL V   I +P
Sbjct: 329 KKPGQRGDLIVKYKIAYP 346

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 104/401 (25%), Positives = 167/401 (41%), Gaps = 84/401 (20%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG+  +A+Q +IKKAY K A ++HPD   +E+    +E +F ++  AYE+L DE+KR
Sbjct: 49  YKTLGINSNASQSDIKKAYYKLAKKYHPDINKEEN----AEAKFHDLQNAYEILSDEQKR 104

Query: 65  ARYDKYG----------DADGSDFFNGP-------NEFEDAAFMNFFHSFGSNPQNAYDH 107
            +YD++G            + + F + P       N F D   +NF   FG    NA+  
Sbjct: 105 KQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFG----NAFKQ 160

Query: 108 -------------YGEQKVDRSADVQVPLNVSMADCYNG-KSFKFQSKRTLVCDRCLGSG 153
                        + E K D    + +  N++  D   G K+ K        C+ C GSG
Sbjct: 161 QHSNNTSNSNRNFFREFKGDT---IHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSG 217

Query: 154 WRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXXXX 213
             + N H     +  C+ C G G +  IR    GF      TC  C+G+G          
Sbjct: 218 L-KHNAH-----KSTCQTCNGTGTRVHIR---GGFQMMS--TCNDCNGEG----TKIDPN 262

Query: 214 XXXXXXVGTGVT-TESKSLTVSLPRGSRQDDQIVL--KGEADQEVG----------KSQT 260
                  G GV    +K +TV LP   +  D I +  KG   Q             +   
Sbjct: 263 DYCNHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTR 322

Query: 261 GNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           G+++  I    +    +   R  +D+   + + +  A  G   T+  ++DG  ++L++ P
Sbjct: 323 GDILIKINVINDTKFKI---RDKYDIWYTMEIPITTAALGGIVTI-PSIDGTNVRLRVSP 378

Query: 321 GKVIRPGNIIQIPHEGWP--------IDTTTSGDLYVVVHI 353
           G   +   II IP+ G P         +TT  G++ V   I
Sbjct: 379 G--TQNDQIISIPNMGVPRSNIFSRSTNTTNRGNMKVQYKI 417

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LG+   A + EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREVYDQYG 68

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + + L  G +   +I  K   D      +   L F I+E           R G DL
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHP----FFTRDGNDL 265

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS- 344
           I  L L+  E++ GF+KT+ +T+DGR L + +I P   I+P      P +G PI  T   
Sbjct: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQP---IQPSEKSTYPGQGMPIPKTPGQ 321

Query: 345 -GDLYVVVHIEFP 356
            GD+ V   +++P
Sbjct: 322 RGDMIVNYKVDYP 334

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGV+I AT +E+KKAYRK ALQ HPDK  D ++ E +E+ F  I +AYEVL D ++R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 65 ARYDKY 70
          A YD +
Sbjct: 64 AWYDAH 69

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A   EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D+
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDK 58

Query: 62 EKRARYDKYG 71
           KR  YD+YG
Sbjct: 59 NKREVYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 61/138 (44%), Gaps = 9/138 (6%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G G   E   + + L  G +   +I  K + D          L F ++E          +
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNHPV----FK 269

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPID 340
           R G DL   L L+  E++ GF+K + +T+DGR   L I   + I+P      P +G PI 
Sbjct: 270 REGDDLTCTLPLTFKESLLGFNKQI-QTIDGRT--LPISRTQPIQPSETSVYPGQGMPIP 326

Query: 341 TTTS--GDLYVVVHIEFP 356
            T S  G+L V   I++P
Sbjct: 327 KTPSQRGNLIVRYKIDYP 344

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 2/73 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGV++ AT LE+KKAYRK ALQ HPDK  D ++ E +E+ F  I +AYEVL D ++R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 65 ARYDKYGDADGSD 77
          A YD + +   SD
Sbjct: 64 AWYDAHKEQILSD 76

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 11/134 (8%)

Query: 226 TESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFD 285
           +E   + + L  G +   +I  K + D      +   L F I+E +      + +R G D
Sbjct: 212 SEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHP----NFKRDGDD 267

Query: 286 LITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS 344
           LI  L LS  E++ GFSKT+ +T+DGR L L ++ P   ++P      P +G P     S
Sbjct: 268 LIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMPTPKNPS 323

Query: 345 --GDLYVVVHIEFP 356
             G+L V   +++P
Sbjct: 324 QRGNLIVKYKVDYP 337

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK + ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDA------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD YG
Sbjct: 59 QKREVYDTYG 68

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 72/141 (51%), Gaps = 15/141 (10%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ--EVGKSQTGNLVFTIKEGTECPEGVD 278
           G G  +E + + + L  G +   +I  K E D     G+ QT  L F ++E        +
Sbjct: 208 GPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQT--LQFILQEKPHS----N 261

Query: 279 LQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGW 337
             R G DLI  L L+  E++ GFSKT+ +T+DGR L + ++ P   ++P +    P +G 
Sbjct: 262 YTRDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRTLPISRVQP---VQPSDSSTYPGQGM 317

Query: 338 PIDTTTS--GDLYVVVHIEFP 356
           PI  T S  G+L V   I++P
Sbjct: 318 PIAKTPSQRGNLIVKYKIDYP 338

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 52/70 (74%), Gaps = 3/70 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y+IL V +DA+  EIKK+YRK A++ HPDK  D+    +++ +F+E+A AY+VL D+
Sbjct: 5  TTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDP---QAQTKFQELAKAYQVLIDD 61

Query: 62 EKRARYDKYG 71
          + R +YD++G
Sbjct: 62 DLRKKYDQFG 71

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDS 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 11/134 (8%)

Query: 226 TESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFD 285
           +E   + + L  G +   +I  K + D      +   L F I+E +      + +R G D
Sbjct: 226 SEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHP----NFKRDGDD 281

Query: 286 LITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS 344
           LI  L LS  E++ GFSKT+ +T+DGR L L ++ P   ++P      P +G P     S
Sbjct: 282 LIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMPTPKNPS 337

Query: 345 --GDLYVVVHIEFP 356
             G+L V   +++P
Sbjct: 338 QRGNLIVKYKVDYP 351

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LG+   A + EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDA 58

Query: 62 EKRARYDKYG 71
          +KR  YD YG
Sbjct: 59 QKREVYDTYG 68

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 61/140 (43%), Gaps = 13/140 (9%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ--EVGKSQTGNLVFTIKEGTECPEGVD 278
           G G  +E   + + L  G +   +I  KGE D     G  QT   V       E P    
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVL-----QEKPHEF- 262

Query: 279 LQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWP 338
             R   DLI  L LS  E++ GFSK + +T+DG+   + I   + I+P      P +G  
Sbjct: 263 FTRQDNDLIYTLPLSFKESLLGFSKQV-QTIDGKT--IPITRTQPIQPTQTSTYPGQGMT 319

Query: 339 IDTTTS--GDLYVVVHIEFP 356
           +    S  GDL +   I++P
Sbjct: 320 LSKNPSQRGDLIIKFKIDYP 339

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDA------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD YG
Sbjct: 59 QKREIYDNYG 68

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 15/141 (10%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQ--EVGKSQTGNLVFTIKEGTECPEGVD 278
           G G   E + + + L  G +   +I  K E D     G+ QT  + F I+E        +
Sbjct: 205 GPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQT--MQFIIQEKPHE----N 258

Query: 279 LQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGW 337
             R G DLI  L L+  E++ GF+KT+ +T+DGR L + ++ P   ++P ++   P +G 
Sbjct: 259 YTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPISRVQP---VQPSDVSTYPGQGM 314

Query: 338 PIDTTTS--GDLYVVVHIEFP 356
           P+    S  G+L V   I++P
Sbjct: 315 PVAKNPSQRGNLIVKYKIDYP 335

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 102/401 (25%), Positives = 162/401 (40%), Gaps = 84/401 (20%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG++  AT  EIKKAY K A ++HPD     +   ++E +F ++  AYE+L D+ KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDDTKR 118

Query: 65  ARYDK------------------------------YGDADGSDFFNGPNEFEDAAFMNFF 94
            ++D+                              + +A G   F G N FED     F 
Sbjct: 119 QQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGIN-FEDLFGAAFG 177

Query: 95  HSFGSNPQNA----------YDHYGEQKVDRSADVQVPLNVSMADC-YNGKSFKFQSKRT 143
                               Y  Y      R   +++   VS  D  +  K+ + +    
Sbjct: 178 GGGAGAGAGRGGSGGRSSPMYRQY------RGDPIEIVHKVSFKDAVFGAKNVQLKFSAL 231

Query: 144 LVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKG 203
             C  C G+G +  N H     +V C  C G G    +R    GF      TCPTC+G+G
Sbjct: 232 DPCGTCSGTGMKP-NTH-----KVSCTTCHGSGSTVHVR---GGFQMMS--TCPTCNGEG 280

Query: 204 KCASXXXXXXXXXXXXVGTGV-TTESKSLTVSLPRGSRQDDQIVLKG---------EAD- 252
                            G GV     KS+TV LP G +  D + + G         EAD 
Sbjct: 281 TMKRPQDNCTSCH----GEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADL 336

Query: 253 QEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGR 312
           Q+  K   G+++  I+   +    +   R+ +D+     + +  A  G + T+  T+DG+
Sbjct: 337 QDSIKLSRGDILVRIRVDKDPSFSI---RNKYDIWYDKEIPITTAALGGTITIP-TVDGQ 392

Query: 313 ILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHI 353
            +++++ PG   +   +I IP+ G P   T  GD+ V   I
Sbjct: 393 KIRIKVAPG--TQYNQVISIPNMGVPRTATLRGDMKVQYKI 431

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 54/80 (67%), Gaps = 11/80 (13%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+ LE+KKAYRK ALQ+HPDK  D +++E +E +F  I AAYEVL D ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 65 ARYDKYG---------DADG 75
          A YD +          DADG
Sbjct: 64 AWYDSHKEQILNDTAPDADG 83

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
          LY++L V   A + EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDAEK 60

Query: 64 RARYDKYG 71
          R  YD+YG
Sbjct: 61 REVYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + ++L  G +   +I  K + D          L F +KE        + +R   +L
Sbjct: 218 EKAQIEIALKAGWKAGTKITYKNQGDYNPSTGGRKTLQFILKEKPNT----NFKRDEDNL 273

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS- 344
           I  L L+  E++ GF KT+ KT+DG+ L + ++ P   ++P      P +G PI  +   
Sbjct: 274 IYTLPLTFKESLLGFQKTI-KTIDGKTLPISRVQP---VQPSECTTYPGQGMPISKSVGQ 329

Query: 345 -GDLYVVVHIEFP 356
            GD+ V   + +P
Sbjct: 330 RGDMIVKFKVGYP 342

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDS 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 66/139 (47%), Gaps = 11/139 (7%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G   T+E   + + L +G +   +I  K E D          L F ++E          +
Sbjct: 224 GPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVLQEKAHPL----FK 279

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPI 339
           R G +LI  L LS  E++ GFSKT+ +T+DGR L + ++ P   I+P    + P +G PI
Sbjct: 280 RDGDNLIYTLPLSFKESLLGFSKTI-QTIDGRTLPISRVQP---IQPSESSRYPGQGMPI 335

Query: 340 DTTTS--GDLYVVVHIEFP 356
                  GDL V   I++P
Sbjct: 336 TKKPGQRGDLIVKYKIDYP 354

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (64%), Gaps = 9/85 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILGVE DAT  EIKKAYR+ A+Q HPDK  D+    +++ +F+ +  AY+VL D   R
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDA 88
          +RYD++G  D       P + FEDA
Sbjct: 65 SRYDEFGKDDAV-----PKQGFEDA 84

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 67/135 (49%), Gaps = 11/135 (8%)

Query: 225 TTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF 284
           T+E   + + L  G +   +I  K + D     ++   L F I+E +      + +R G 
Sbjct: 218 TSEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQEKSHP----NFKRDGD 273

Query: 285 DLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTT 343
           DLI  L LS  E++ GFSKT+ +T+DGR L L ++ P   ++P      P +G P     
Sbjct: 274 DLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMPTPKNP 329

Query: 344 S--GDLYVVVHIEFP 356
           S  G+L V   +++P
Sbjct: 330 SQRGNLIVKYKVDYP 344

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 61/105 (58%), Gaps = 10/105 (9%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +T Y+ILG+   ATQ EIKKAYRK +++ HPDK  ++    E   RF++I+ AY+VL DE
Sbjct: 5   TTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDE 61

Query: 62  EKRARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHSFGSNPQNAY 105
             R  YD++G          P E FEDA  + F   FG +   +Y
Sbjct: 62  HLRNNYDQFGKEQAI-----PKEGFEDAGDL-FSVIFGGDAFESY 100

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 2/83 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++L V  DA+ L++KKAYR+ ALQ+HPDK  D    EE+   F EI AAYEVL D ++R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNV--EEATTIFAEIRAAYEVLSDPQER 63

Query: 65 ARYDKYGDADGSDFFNGPNEFED 87
          A YD + +   SD    PN+ +D
Sbjct: 64 AWYDSHKEQILSDTPLNPNDEDD 86

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LGV  DA  +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL  +
Sbjct: 5   TAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSD 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E RA+YDK+G  +        N FEDA    F   FG     +Y
Sbjct: 62  ELRAKYDKFGKEEAV----PQNGFEDAG-EQFAAIFGGEAFASY 100

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDA 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 11/133 (8%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + + L  G +   +I  K + D      +   L F I+E        + +R G DL
Sbjct: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHP----NFKRDGDDL 284

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS- 344
           I  L LS  E++ GFSKT+ +T+DGR L L ++ P   ++P      P +G P     S 
Sbjct: 285 IYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMPTPKNPSQ 340

Query: 345 -GDLYVVVHIEFP 356
            G+L V   +++P
Sbjct: 341 RGNLIVKYKVDYP 353

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRK+AL++HPDK   ++       +FKEI+ A+E+L D+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDT------EKFKEISEAFEILNDK 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 62/138 (44%), Gaps = 9/138 (6%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G G   E   + + L  G +   ++  K   D          L F I+E T        +
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQEKTHP----LYK 273

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPID 340
           R+G DL   L L+  E++ GFSKT+ +T+DGR L L       ++P    + P +G P+ 
Sbjct: 274 RNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLSR--SSPVQPTETSRYPGQGMPMP 330

Query: 341 TTTS--GDLYVVVHIEFP 356
              S  GDL V   I++P
Sbjct: 331 KMPSQRGDLVVRFKIDYP 348

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 110/443 (24%), Positives = 183/443 (41%), Gaps = 80/443 (18%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG++  AT  EIKKAY K A ++HPD     +   ++E +F ++  AYE+L DE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDESKR 118

Query: 65  ARYDKY-------------------------------GDADGSDFFNGPNEFEDAAFMNF 93
            +YD++                                +A GS  F G N FED     F
Sbjct: 119 QQYDQFGPAAFGGGDAAGGPSGGGSPFGSQFHDFSGFSNAGGSSPFGGIN-FEDLFGAAF 177

Query: 94  FHSFGSNPQNAYDHYGEQ----KVDRSADVQVPLNVSMADCYNGKSFKFQSKRTLV--CD 147
             +   +  +            +  R   +++  NVS  D   G S   Q K + +  C 
Sbjct: 178 GGAGRGSSSSGGGGSTRSSSMFRQYRGDPIEIVHNVSFKDAVFG-SNNVQLKFSALDPCG 236

Query: 148 RCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCAS 207
            C G+G +  N H     +V C  C G G    IR    GF      TCPTC+G+G    
Sbjct: 237 TCSGTGMKP-NTH-----KVNCGTCHGTGTTVHIR---GGFQMMS--TCPTCNGEGTMKR 285

Query: 208 XXXXXXXXXXXXVGTGV-TTESKSLTVSLPRGSRQDDQIVLKGEAD----------QEVG 256
                        G GV     K++TV LP G +  D + + G+            ++  
Sbjct: 286 PQDSCSKCH----GEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSV 341

Query: 257 KSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL 316
           K   G+++  I+   +    +   ++ +D+  +  + +  A  G + T+  T++G+ +++
Sbjct: 342 KLSRGDILVRIRVDKDPNFSI---KNKYDIWYNKEIPITTAALGGTVTIP-TVEGQKIRI 397

Query: 317 QIPPGKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPDNWFSERSDLTQVKNVLPG 376
           ++ PG   +   +I IP+ G P   T  GD+ V   I        +E+     + +V   
Sbjct: 398 KVAPG--TQYNQVISIPNMGVPKTPTIRGDMKVQYKIVVKKPQSLAEKCLWEALADV--- 452

Query: 377 ETNNNAAVED-DPGNTETVTNIN 398
            TN++ A +   PG     T I+
Sbjct: 453 -TNDDMAKKTMQPGAAAGATTIS 474

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 52/83 (62%), Gaps = 5/83 (6%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ LG+   AT  EIKKAYR+ A++ HPDK  D+    E+E +F+ +  AY+VL DE  R
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDP---EAENKFQAVGEAYQVLSDESLR 64

Query: 65 ARYDKYG--DADGSDFFNGPNEF 85
          ARYD+YG  DA     F   NE+
Sbjct: 65 ARYDEYGKDDAVPQQGFEDANEY 87

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (63%), Gaps = 5/88 (5%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV+  AT  EIKKAYR+ A+Q HPDK  D+    E++ +F+E+  AY+VL D   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDP---EAQAKFQEVGEAYQVLSDPGLR 64

Query: 65 ARYDKYG--DADGSDFFNGPNEFEDAAF 90
          +RYD++G  +A     F   NE+  A F
Sbjct: 65 SRYDEFGKDEAVPQQGFEDANEYFTAIF 92

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++L V+  A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD+YG
Sbjct: 59 QKREIYDQYG 68

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 9/132 (6%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + + L  G +   +I  K + D          L F I E          +R   +L
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNPKTGGRKTLQFIISEKPHP----HFKREDDNL 283

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-- 344
           I  L L+  E++ GFSKT+ +T+DG+ L L    G+ ++P      P +G PI       
Sbjct: 284 IYTLPLTFKESLLGFSKTI-QTIDGKNLPLSR--GQPVQPSETTTYPGQGMPITKKPGQR 340

Query: 345 GDLYVVVHIEFP 356
           GDL +   +++P
Sbjct: 341 GDLLIKYKVDYP 352

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV  +    E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
           KR  YDKYG
Sbjct: 59 NKREVYDKYG 68

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 62/132 (46%), Gaps = 9/132 (6%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E K + + L  G +   +I  K E D          L F I+E         L+R G DL
Sbjct: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD----FLKRDGNDL 263

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-- 344
              L LS  E++ GFSKT+  T+DGR  Q+ I   + ++P    + P +G P+    S  
Sbjct: 264 TYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSER 320

Query: 345 GDLYVVVHIEFP 356
           GDL V   I++P
Sbjct: 321 GDLIVKYKIDYP 332

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 111/443 (25%), Positives = 184/443 (41%), Gaps = 78/443 (17%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG++  AT  EIKKAY K A ++HPD     +   ++E +F ++  AYE+L DE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDETKR 118

Query: 65  ARYDK--------------------------------YGDADGSDFFNGPNEFEDAAFMN 92
            +YD+                                +  A GS F  G   FED     
Sbjct: 119 QQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPF--GGINFEDLFGAA 176

Query: 93  FFHSFGSNPQNAYDHYGEQKVDRSADVQVPLNVSMADC-YNGKSFKFQSKRTLVCDRCLG 151
           F      +   +      ++  R   +++   VS  D  +  K+ + +      C  C G
Sbjct: 177 FGGGGRGSGGASRSSSMFRQY-RGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSG 235

Query: 152 SGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXX 211
           +G +  N H     +V C  C G G    IR    GF      TCPTC+G+G        
Sbjct: 236 TGMKP-NTH-----KVSCSTCHGTGTTVHIR---GGFQMMS--TCPTCNGEGTMKRPQDN 284

Query: 212 XXXXXXXXVGTGV-TTESKSLTVSLPRGSRQDDQIVLKG---------EAD-QEVGKSQT 260
                    G GV    +K++TV LP G +  D + + G         EAD ++  K   
Sbjct: 285 CTKCH----GEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSR 340

Query: 261 GNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           G+++  I+   +    +   ++ +D+     + +  A  G + T+  T++G+ +++++ P
Sbjct: 341 GDILVRIRVDKDPNFSI---KNKYDIWYDKEIPITTAALGGTVTIP-TVEGQKIRIKVAP 396

Query: 321 GKVIRPGNIIQIPHEGWPIDTTTSGDLYVVVHIEFPPDNWFSERSDLTQVKNVLPGETNN 380
           G   +   +I IP+ G P  +T  GD+ V   I        +E+     + +V    TN+
Sbjct: 397 G--TQYNQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADV----TND 450

Query: 381 NAAVEDDPGNTETVTNINIVEEI 403
           + A +     T   T IN  EEI
Sbjct: 451 DMAKKTMQPGTAAGTAIN--EEI 471

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A   EIKK YRKAAL++HPDK    +       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNT------EKFKEISEAFEILSDS 58

Query: 62 EKRARYDKYG 71
           KR  YD+YG
Sbjct: 59 NKREVYDQYG 68

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 11/133 (8%)

Query: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286
           E   + + L  G +   +I  K   D          L F IKE        + +R    L
Sbjct: 216 EKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEKVHP----NFKREDDTL 271

Query: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTT--T 343
           + +L L+  E++ GF KT+ +T+DGR L + ++ P   ++P +    P +G P+      
Sbjct: 272 VYYLPLTFKESLLGFQKTI-QTIDGRTLPISRVQP---VQPNDSSTYPGQGMPMTKKPGQ 327

Query: 344 SGDLYVVVHIEFP 356
            GD+ V   IE+P
Sbjct: 328 RGDMIVKYKIEYP 340

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
          +KR  YD YG
Sbjct: 59 QKREIYDSYG 68

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 71/141 (50%), Gaps = 15/141 (10%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEAD--QEVGKSQTGNLVFTIKEGTECPEGVD 278
           G G   E K + + +  G +   +I  K E D  Q+ G  QT  + F I+E         
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQT--MQFVIQEKLHP----H 256

Query: 279 LQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGW 337
            +R G +LI  L LS  E++ GFSKT+ +T+DGR L + ++ P   I+P      P +G 
Sbjct: 257 FKRDGNNLIYTLPLSFKESLLGFSKTI-QTIDGRTLPISRVQP---IQPSETSTYPGQGM 312

Query: 338 PIDTTTS--GDLYVVVHIEFP 356
           P+  T +  GDL +   +++P
Sbjct: 313 PLPKTPAQRGDLIIKYKVDYP 333

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LG+   AT +EIKKAYRK +++ HPDK  ++    E   RF+ I+ AY+VL D++ R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 65 ARYDKYG 71
          + YDKYG
Sbjct: 65 SNYDKYG 71

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGV   A+ +EIKKAYRK A++ HPDK  D+    +++ +F+ +  AY+VL DEE R
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDP---DAQAKFQRVGEAYQVLSDEELR 64

Query: 65 ARYDKYG 71
           RYD++G
Sbjct: 65 KRYDEFG 71

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A+  E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58

Query: 62 EKRARYDKYG 71
           KR  YD YG
Sbjct: 59 NKREVYDTYG 68

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 10/137 (7%)

Query: 222 TGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQR 281
           TG+  E K + + L  G +   +I  K E D          + F I+E    P     +R
Sbjct: 206 TGIP-EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQE---KPHEF-FKR 260

Query: 282 HGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDT 341
            G DLI  L L+  E++ GF KT+ +T+DGR  Q+ I   + ++P   ++ P +G P+  
Sbjct: 261 DGNDLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPLSK 317

Query: 342 TTS--GDLYVVVHIEFP 356
             S  GDL V    ++P
Sbjct: 318 NPSERGDLIVKYKTDYP 334

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LG+E  AT +EIKKAYRK +++ HPDK  ++    E   RF+ I+ AY+VL D + R
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDSDLR 64

Query: 65 ARYDKYG 71
          A YDK+G
Sbjct: 65 ANYDKFG 71

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LG++ DAT  EIKKAYR+ A+Q HPDK  D+    +++ +F+ +  AY+VL D + +
Sbjct: 8  YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDP---DAQSKFQAVGEAYQVLSDPQLK 64

Query: 65 ARYDKYGDADG 75
          +RYD++G  D 
Sbjct: 65 SRYDQFGKDDA 75

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+  ++KKAYR+ ALQ+HPDK  D    EE+   F  I +AYEVL D ++R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNV--EEATTVFATIRSAYEVLADPQER 63

Query: 65 ARYDKYGDADGSDFFNGPN 83
          A YD +     SD F   N
Sbjct: 64 AWYDSHKQQILSDDFGAEN 82

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {ON}
           similar to gnl|GLV|CAGL0J01936g Candida glabrata
           CAGL0J01936g and some similarites with uniprot|P40564
           YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
           J-domain- containing protein, required for peroxisomal
           protein import
          Length = 418

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 57/101 (56%), Gaps = 8/101 (7%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LGVE+ AT +EIKKAYRK ++  HPDK  D+    E   RF+ I+ AY+VL +++ R
Sbjct: 8   YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           A YDK G             FEDAA   F   FG     AY
Sbjct: 65  ANYDKSGKEKAI----PKGGFEDAA-EQFSVIFGGEAFAAY 100

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE+ A+  E+KKAYRK ALQ HPDK  D    +E+   F  I AAYEVL D ++R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNV--DEATENFATIRAAYEVLSDPQER 63

Query: 65 ARYD 68
          A YD
Sbjct: 64 AWYD 67

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGV+  A+ LE+KKAYRK ALQ+HPDK  + +  EE+   F  I  AYEVL D ++R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK--NPTKVEEATEIFATIRTAYEVLSDPQER 63

Query: 65 ARYDKYGDADGSDFFNGPNEFEDAAF 90
          A YD + +   +D     NE+ED  +
Sbjct: 64 AWYDSHKEQILNDI--PLNEYEDEKY 87

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 EKRARYDKYG 71
            R  YD+YG
Sbjct: 59 NTREVYDQYG 68

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 64/138 (46%), Gaps = 9/138 (6%)

Query: 221 GTGVTTESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQ 280
           G G + E   + + L  G +   ++  K + D          L F I+E        D +
Sbjct: 182 GPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAHP----DFK 237

Query: 281 RHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPID 340
           R G DLI  L LS  E++ GFSKT+  T+DGR L L     + I+P  I   P +G P+ 
Sbjct: 238 RDGDDLIYILRLSFKESLLGFSKTIN-TIDGRKLPLSR--SQPIQPTEISTYPGQGMPVS 294

Query: 341 TTTS--GDLYVVVHIEFP 356
              S  G+L +   I++P
Sbjct: 295 KNPSQRGNLIIKYKIDYP 312

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {ON}
           YER048C (CAJ1) - homologous to E. coli DnaJ [contig 197]
           FULL
          Length = 393

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%), Gaps = 12/99 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LG++ DA+  +IKKAYRK A+  HPDK  D+    E++ +F+ I  AY+VL D + R
Sbjct: 8   YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGEAYQVLSDPDLR 64

Query: 65  ARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHS-FGSNP 101
           +RYD++G  +       P + FEDAA   FF + FG + 
Sbjct: 65  SRYDEFGKENAV-----PQQGFEDAA--EFFTTIFGGDA 96

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YE+LGV   A  LE+KKA+R+ ALQ+HPDK  D    EE+   F +I AAYEVL D ++
Sbjct: 5  YYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNV--EEATETFAQIRAAYEVLNDPQE 62

Query: 64 RARYDKYGDADGSDFFNG 81
          RA YD +     +D  NG
Sbjct: 63 RAWYDSHKSQILNDDING 80

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILG++  AT  EIKKAYRK A++ HPDK  D+    +++ +F+ +  AY+VL D++ R
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDP---DAQSKFQSVGEAYQVLSDDDLR 64

Query: 65 ARYDKYG 71
           RYD++G
Sbjct: 65 KRYDEFG 71

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 164/390 (42%), Gaps = 89/390 (22%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE LGV+  ++Q +IKKAY K A ++HPD +  E+    +E +F ++  AYE+L DE KR
Sbjct: 49  YETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEA---GAEKKFHDLQNAYEILSDESKR 104

Query: 65  ARYDK--------------------------YGDADGSDFFNGPN---------EFEDAA 89
            +YD+                          +G+  G DF  G            FED  
Sbjct: 105 KQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFEDL- 163

Query: 90  FMNFFHSFGSNP--------QNAYDHYGEQKVDRSADVQVPLNVSMADCYNGK---SFKF 138
              F  +FG  P        + +   + E K D    ++V  N+   D   GK   S KF
Sbjct: 164 ---FGTAFGGGPFGSSSNSGRRSSSMFREYKGD---TIEVIQNLDFKDAVFGKKNVSIKF 217

Query: 139 QSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPT 198
           ++     C  C GSG +          +  C  C G G    +R    GF      TC T
Sbjct: 218 RALDP--CGTCNGSGLKS------GASKTTCPSCHGSGTTVHVR---AGFQMMS--TCQT 264

Query: 199 CDGKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEA------- 251
           C G+G   +             G  V T+ K++TV LP G +  D + + G+        
Sbjct: 265 CGGEGTTVNASDFCKSCHGE--GVNVNTQ-KTITVDLPHGLQDGDVVRIPGQGSYPDIAV 321

Query: 252 DQEVGKS---QTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKT 308
           D+E+ KS     G+++  I+   +    +   ++ +D+     + +  A  G + ++  T
Sbjct: 322 DKEMAKSVKLSRGDILVRIRVNKDPHFSI---KNKYDIWYTKEIPITTAALGGTVSIP-T 377

Query: 309 LDGRILQLQIPPGKVIRPGNIIQIPHEGWP 338
           ++G  +++++P G    P  +I IP+ G P
Sbjct: 378 IEGTKIRIKVPAGTA--PEQVISIPNMGVP 405

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 8/104 (7%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
           +  Y++LG+  +AT +EIKKAYRK ++Q HPDK  ++    E   RF+ I+ AY+VL ++
Sbjct: 5   TAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSND 61

Query: 62  EKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           E RA+YD+ G  +          FEDAA   F   FG +   +Y
Sbjct: 62  ELRAKYDRLGKQEAVP----KGGFEDAA-EQFSAIFGGDAFASY 100

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+L V   A+ LE+KKAYRK ALQ+HPDK  +    EE+   F EI AAYEVL D ++R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENP--EEATAIFSEIRAAYEVLSDPQER 63

Query: 65 ARYDKY 70
          A YD +
Sbjct: 64 AWYDSH 69

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+ LE+KKAYRK AL++HPDK  +    EE+   F  I  AYEVL D ++R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNV--EEATQAFATIRLAYEVLSDPQER 63

Query: 65 ARYDKYGDADGSDFFNGPN 83
          A YD + +    D +N PN
Sbjct: 64 AWYDSHKNQILDDDYN-PN 81

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {ON}
           similar to uniprot|P48353 Saccharomyces cerevisiae
           YMR161W
          Length = 238

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 51/95 (53%), Gaps = 12/95 (12%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
            YEIL VE  A   EIKK+YRK A++ HPDK       E     FK I  A+EVLGD EK
Sbjct: 23  FYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA----FKLINRAFEVLGDSEK 78

Query: 64  RARYDKYG-DAD-------GSDFFNGPNEFEDAAF 90
           R+ YD+ G D D        S  FNG   FE+  F
Sbjct: 79  RSLYDRLGRDPDDRSVPSAASSAFNGDTGFENMFF 113

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.217
           YER048C
          Length = 380

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 12/98 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LGV  +AT  +IKKAYRK A+Q HPDK  D+    E++ +F+ +  AY+VL D   R
Sbjct: 8   YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 65  ARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHS-FGSN 100
           ++YD++G  D       PN  FEDA    FF + FG +
Sbjct: 65  SKYDQFGKDDAV-----PNAGFEDA--QEFFSTIFGGD 95

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILGV+ +AT  EIKKAYR+ A++ HPDK  D+    E++ +F+ +  AY+VL D   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 65 ARYDKYGDADG 75
          +RYD++G  D 
Sbjct: 65 SRYDEFGKDDA 75

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++L ++I AT +EIKKAYRK +++ HPDK  ++    E   RF+ I+ AY+VL D+  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDKNLR 64

Query: 65 ARYDKYG 71
          A YDK+G
Sbjct: 65 ANYDKFG 71

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 56/86 (65%), Gaps = 9/86 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILG++ DAT  EIKKAYR+ A++ HPDK  D+    +++ +F+ +  AY+VL D   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDAA 89
          ++YD++G  D       P + FEDA+
Sbjct: 65 SKYDEFGKEDAV-----PQQGFEDAS 85

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 54/88 (61%), Gaps = 5/88 (5%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILGV+ +AT  EIKKAYR+ A++ HPDK  ++     ++ +F+ +  AY+VL D+E R
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDP---NAQAKFQAVGEAYQVLSDDELR 64

Query: 65 ARYDKYGDADG--SDFFNGPNEFEDAAF 90
           RYD+ G         F  P+E+  A F
Sbjct: 65 KRYDQLGKESAVPQQGFVDPSEYFTAIF 92

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGVE  A+  ++KKAYRK AL +HPDK  D    EE+   F  I AAYEVL D ++R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNV--EEATAIFATIRAAYEVLADPQER 63

Query: 65 ARYDKY 70
          A YD +
Sbjct: 64 AWYDSH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++L V+ DAT  ++K+AYRK AL +HPDK  + ++ E +EV F +I AAYEVL D ++R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN-NIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 65 ARYDKYGD 72
          A YD + D
Sbjct: 64 AWYDAHKD 71

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 57/86 (66%), Gaps = 9/86 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILG++ +AT  EIKKAYR+ A++ HPDK  D+    +++ +F+ +  AY+VL D+  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDQGLR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDAA 89
          ++YD++G  D       P + FEDA+
Sbjct: 65 SKYDEFGKEDAV-----PQQGFEDAS 85

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YEIL V+  AT  EIKKAYRK A++ HPDK +     E     FK I  A+EVL +EEK
Sbjct: 22 FYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEA----FKVINRAFEVLSNEEK 77

Query: 64 RARYDKYG 71
          R+ YD+ G
Sbjct: 78 RSIYDRIG 85

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (59%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          T YEIL +  DATQ EIKKAYR   L  HPDK+   +    + V   +I  AY++L + +
Sbjct: 8  THYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQ 67

Query: 63 KRARYDK 69
          KR  YDK
Sbjct: 68 KRGEYDK 74

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YEIL V+  AT  EIKKAYRK A++ HPDK +     E     FK I  A+EVL +EEK
Sbjct: 22 FYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 64 RARYDKYG 71
          R+ YD+ G
Sbjct: 78 RSIYDRIG 85

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 4/61 (6%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YE+L VE  A+ LEIKKAYRK A++ HPDK       E     FK I  A+EVL DE+K
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQK 78

Query: 64 R 64
          R
Sbjct: 79 R 79

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES---EVRFKEIAAAYEVLGDE 61
           Y++LGV + A+  EIK AYRK +L+ HPDKVA +   EE    E  + +I+ AYE L DE
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 62  EKRARYDKYGDADG 75
             +  Y  YG  DG
Sbjct: 182 LVKQNYLMYGHPDG 195

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 97/388 (25%), Positives = 156/388 (40%), Gaps = 82/388 (21%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LG+  DA   EIKKAY K A ++HPD   D+     S+ +F +I  AYE+L DE+K+
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEILSDEKKK 104

Query: 65  ARYDKYGDA--------------DGSDFFNGPNEFEDA-------AFMNFFHSFGS---- 99
            +YD++G A               G+ F  G N F +A         +NF   FG+    
Sbjct: 105 MQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPFGFGGINFEDLFGAAFSK 164

Query: 100 ------------------NPQNAYDHYGEQKVDRSADVQVPLNVSMADC-YNGKSFKFQS 140
                             +P   +  Y E + D   +V+V   +S  D  +  ++     
Sbjct: 165 ANGAAGRGGGRSSGRGNGSPFGGF--YSEVRGD---NVEVIHTLSFKDAVFGSRNVTLNV 219

Query: 141 KRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCD 200
                C  C GSG +  +       + EC  C G G    +R    GF      TC +C 
Sbjct: 220 SSIEQCKTCTGSGMKPGSH------RSECSSCHGTGTTVHVR---AGFQMAS--TCMSCG 268

Query: 201 GKGKCASXXXXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEA--------- 251
           G G+  +             GT      +++ V LP G    D I + G+          
Sbjct: 269 GTGENIAREDVCRNCDGE--GTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAP 326

Query: 252 -DQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLD 310
             ++  K   G+L+  I+   +    +   R+G +L     + +  A+ G    +  TLD
Sbjct: 327 EQRDQVKVTRGDLLVRIRVKQDKVFSI---RNGNELWQTREIPVTTAVLG-GNVVIPTLD 382

Query: 311 GRILQLQIPPGKVIRPGNIIQIPHEGWP 338
           G  L+L++  G   R G  + +P +G P
Sbjct: 383 GNQLRLRVRSG--TRDGETVSVPGQGVP 408

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 9/86 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILG++ +AT  EIKKAYR+ A++ HPDK  D+    +++ +F+ +  AY+VL D   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDAA 89
          ++YD++G  D       P + FEDA+
Sbjct: 65 SKYDEFGKEDAV-----PQQGFEDAS 85

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 47/77 (61%), Gaps = 9/77 (11%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA------DESLREESEVRFKEIAAAYEVL 58
           YEILG+   A+  +IK AYRK +++ HPDKVA      ++S+ EE+ V   +I  AYE L
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYV---QITKAYESL 183

Query: 59  GDEEKRARYDKYGDADG 75
            DE  R  Y KYG  DG
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {ON}
           Anc_2.350 YMR161W
          Length = 227

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 56/116 (48%), Gaps = 25/116 (21%)

Query: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
             Y+IL V+  A   EIKK+YRK A++ HPDK       E     FK I  A+EVLGDE+
Sbjct: 24  AFYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEVLGDEK 79

Query: 63  KRARYDKYG-DAD---------------GSDFFNGPNEFEDAAFMNFFHSFGSNPQ 102
           KR  +D+ G D D               G +  N P+ FE     N F   G NPQ
Sbjct: 80  KRVLFDRIGRDPDDRSVPESSATASGFRGHNHGNMPSSFE-----NMFFQRGRNPQ 130

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LGVE ++T +EIKKAYRK +++ HPDK  +     ++  +F+ I+ AY+VL D+  R
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNP---DATKKFQAISEAYQVLSDKNLR 64

Query: 65 ARYDKYG 71
          + YDK+G
Sbjct: 65 SNYDKFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 9/86 (10%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y+ILG++ +AT  EIKKAYR+ A++ HPDK  D+    +++ +F+ +  AY+VL D   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 65 ARYDKYGDADGSDFFNGPNE-FEDAA 89
          ++YD++G  D       P + FEDA+
Sbjct: 65 SKYDQFGKEDAV-----PQQGFEDAS 85

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREE---SEVRFKEIAAAYEVLGDE 61
           Y+ILG+   A++ EIK AYRK +++ HPDK+A E   +E    E  + +I  AYE L DE
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 62  EKRARYDKYGDADG 75
             R  + KYG  DG
Sbjct: 181 LTRQNFLKYGHPDG 194

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YEIL V+  AT  +IKKAYRK A++ HPDK +     E     FK I  A+EVL +EEK
Sbjct: 22 FYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 64 RARYDKYG 71
          R+ YD+ G
Sbjct: 78 RSIYDRIG 85

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          S  YE+L VE  A+  EIKKAYR+ A++ HPDK         S   FK I  A+EVLGDE
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNG----HPRSAEAFKVINRAFEVLGDE 77

Query: 62 EKRARYDKYG 71
          +KR  +D+ G
Sbjct: 78 DKRRLFDQLG 87

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 157/378 (41%), Gaps = 76/378 (20%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LGV   A+Q EIKKAY K A ++HPD     +   ++E  F  +  AYE+L DE+KR
Sbjct: 58  YKTLGVARSASQSEIKKAYYKLAKKYHPDI----NKEPDAEKTFHNLQNAYEILSDEDKR 113

Query: 65  ARYDKYG------DADGSDFFNGPNEF----------------EDAAFMNFFHS------ 96
           A++D++G      +A  S    G N F                ED     F         
Sbjct: 114 AQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGGASGRSN 173

Query: 97  --FGSNPQNAYDHYGEQKVDRSADVQVPLNVSMADC---YNGKSFKFQSKRTLVCDRCLG 151
             FGS      ++ G+        +++  N+S  D     N  S  F +     CD C G
Sbjct: 174 GGFGSRVNMVREYKGDT-------IEIIHNLSFKDAVFGVNNVSLTFNALDP--CDTCHG 224

Query: 152 SGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXXX 211
           SG ++  +H     +  C  C G G +  +R    GF      TC  C G+G   +    
Sbjct: 225 SGLKKGENH----KRRSCSYCNGTGTQIHVR---SGFQMAS--TCNHCHGEGTIIAFEDM 275

Query: 212 XXXXXXXXVGTGVTTES-KSLTVSLPRGSRQDDQIVLKGEA----------DQEVGKSQT 260
                    G GV  ++ K + V+LP      D I + GE           D++  K   
Sbjct: 276 CTKCH----GDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLSR 331

Query: 261 GNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPP 320
           G+L+  I+     P+     ++ +D+ +   + +  A  G + T+ KT+D + ++L++  
Sbjct: 332 GDLLVRIRVK---PDPDYTIKNKYDIWSVKEIPITTAALGGTITI-KTIDDKQIRLKVMA 387

Query: 321 GKVIRPGNIIQIPHEGWP 338
           G   +   +  IP+ G P
Sbjct: 388 G--TQHDQVTSIPNMGVP 403

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 9/77 (11%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA------DESLREESEVRFKEIAAAYEVL 58
           YEILG+   A+  +IK AYRK +++ HPDK+A      ++S+ EE+ V   +I  AYE L
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYV---QITKAYESL 183

Query: 59  GDEEKRARYDKYGDADG 75
            DE  R  Y KYG  DG
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 53/80 (66%), Gaps = 2/80 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGV+  A+  ++KKAYR+ ALQ+HPDK    ++++ +E+ F  I AAYEVL D ++R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIG-NVQQATEI-FASIRAAYEVLSDAQER 63

Query: 65 ARYDKYGDADGSDFFNGPNE 84
          A YD + +   +D F    E
Sbjct: 64 AWYDAHREQILNDDFENDEE 83

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
            YE+L +E  A+  EIKK+YRK A++ HPDK       E     FK I  A+EVL DEE
Sbjct: 24 AFYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASEA----FKVINRAFEVLSDEE 79

Query: 63 KRARYDKYG 71
          KR  YD+ G
Sbjct: 80 KRRLYDRLG 88

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVR---FKEIAAAYEVLGDE 61
           YEILG+   A+  +IK AYRK +++ HPDK+A     +E +V    + +I  AYE L DE
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 62  EKRARYDKYGDADG 75
             R  Y KYG  DG
Sbjct: 187 LVRQNYLKYGHPDG 200

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           Y+IL V+  AT  EIKKAYRK A++ HPDK       E     FK I  A+EVL +EEK
Sbjct: 22 FYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEVLSNEEK 77

Query: 64 RARYDKYG 71
          R  YD+ G
Sbjct: 78 RGLYDRIG 85

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.217
           YER048C
          Length = 373

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 24/110 (21%)

Query: 2   STLYEILGVEIDATQLEIKKAYRKAAL----QHHPDKV-ADESLREESEVRFKEIAAAYE 56
           +  YE+LGVE DAT  EIKKAYRK AL    + HP  + A+E        +F+ IA AY+
Sbjct: 5   TAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE--------KFQAIAEAYQ 56

Query: 57  VLGDEEKRARYDKYGD---------ADGSDFFNGPNEFEDAAFMNFFHSF 97
           VL  +E R +YDK G           D S++F  P  F    F ++  SF
Sbjct: 57  VLHSKELREKYDKLGKEAAIPKKGFEDASEYF--PTIFGGEGFKDWIGSF 104

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREE---SEVRFKEIAAAYEVLGDE 61
           YE+LG+ + A+  +IK AYRK +++ HPDK++ +  +EE    E ++ +I  AYE L DE
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 62  EKRARYDKYGDADG 75
             +  + KYG  DG
Sbjct: 183 VIKENFLKYGHPDG 196

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 393

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 12/98 (12%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y+ LG+  DAT  EIKKAYRK A+  HPDK  ++    +++ +F+ +  AY+VL D   R
Sbjct: 8   YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDP---DAQAKFQAVGQAYQVLSDPGLR 64

Query: 65  ARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHS-FGSN 100
           +RYD++G  D       P + FEDA    FF + FG +
Sbjct: 65  SRYDEFGKDDAV-----PQQGFEDAG--EFFTTIFGGD 95

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          T YEIL +  DATQ EIKKAYR   L  HPDK+A ++  + + V    I  AY+VL + +
Sbjct: 8  THYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIK 67

Query: 63 KRARYDK 69
           R  YDK
Sbjct: 68 TRGEYDK 74

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA---DESLREESEVRFKEIAAAYEVLGDE 61
           YE+LGV + +T  EIK AYRK +++ HPDK++   +E  R   E +F  I  AY+ L DE
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 62  EKRARYDKYGDADG 75
             +  Y KYG  DG
Sbjct: 173 ITKENYRKYGHPDG 186

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           YE LGV  DA+  +IKKAY K A Q HPD   DE     +E +F ++  AYE+L DE KR
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILSDENKR 98

Query: 65  ARYDKY 70
            +YD++
Sbjct: 99  RQYDQF 104

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA---DESLREESEVRFKEIAAAYEVLGDE 61
           YE+LG+   A++ +IK AYRK +++ HPDK++    E  R   E  + +I  AYE L DE
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 62  EKRARYDKYGDADG 75
             R  + KYG  DG
Sbjct: 191 AMRENFLKYGHPDG 204

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {ON}
           some similarities with uniprot|P48353 Saccharomyces
           cerevisiae YMR161W
          Length = 233

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 57/112 (50%), Gaps = 12/112 (10%)

Query: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
             YE+L +E +A+  EIKKAYRK A++ HPDK       E     FK I  A+EVL DE+
Sbjct: 22  AFYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQ 77

Query: 63  KRARYDKYG-DADG---SDFFNGPNEFEDAAF----MNFFHSFGSNPQNAYD 106
           KR  +D+ G D D     D F        A F    M F  + G  PQ+ +D
Sbjct: 78  KRRIFDQVGHDPDERPVRDPFASGRSTATAGFPPENMFFRRAPGGQPQDIFD 129

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 5/75 (6%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVR----FKEIAAAYEVLGD 60
           YEILGV + +T+ EIKKAYR  +L+ HPDK+ D +L E+  +     F +I+ AYE L +
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKL-DRNLSEKERLSMEEIFVQISKAYEALTN 181

Query: 61  EEKRARYDKYGDADG 75
              +  Y  YG  DG
Sbjct: 182 PATKENYLLYGHPDG 196

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEV---RFKEIAAAYEVLGDE 61
           YEILGV   A+  +IK AYRK +++ HPDK+A     +E  V    + +I  AYE L DE
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 62  EKRARYDKYGDADG 75
             R  Y KYG  DG
Sbjct: 187 LVRQNYLKYGHPDG 200

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKV---ADESLREESEVRFKEIAAAYEVLGDE 61
           YE+LG+   A+  +IK AYRK +L+ HPDK+     E+ RE  E ++ +I  AYE L DE
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 62  EKRARYDKYGDADG 75
             R  Y  YG  DG
Sbjct: 183 LIRFNYLTYGHPDG 196

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
            YEIL VE  +T+ EIKKAYRK A++ HPDK       E     FK I  A+EVL D E
Sbjct: 21 AFYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASEA----FKIINRAFEVLSDNE 76

Query: 63 KRARYDKYG 71
          KR  +D+ G
Sbjct: 77 KRRIFDQLG 85

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +  Y++LG+  +AT  EIKKAYRK A+  HPDK  D+    E++ +F+ +  AY+VL D 
Sbjct: 5  TEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDP---EAQAKFQAVGEAYQVLNDP 61

Query: 62 EKRARYDKYG 71
            R +YD++G
Sbjct: 62 ALRKQYDEFG 71

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
            Y+IL V+  A  +EIKK+YRK A++ HPDK       E     FK I  A+EVL D+E
Sbjct: 24 AFYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGEA----FKVINRAFEVLSDDE 79

Query: 63 KRARYDKYG 71
          KR+ +D+ G
Sbjct: 80 KRSVFDRIG 88

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y++LG+   AT  EIKKAYR+ A++ HPDK  D+    E   RF+++  AY+VL D + R
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPDLR 64

Query: 65 ARYDKYG 71
           +YD++G
Sbjct: 65 KQYDEFG 71

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+L VE+ A+  ++KKAYR+ ALQ+HPDK  + +++E +++ F  I  AYE+L D ++R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDPQER 63

Query: 65 ARYDKY 70
            YD +
Sbjct: 64 VWYDSH 69

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 37/67 (55%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          T YEIL +  DATQ EIK+AYR   L  HPDK+   +    S V   +I  AY +L D  
Sbjct: 8  THYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIR 67

Query: 63 KRARYDK 69
           R  YD+
Sbjct: 68 SRCEYDR 74

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+L V+  A   E+KKAYR+ ALQ+HPDK   E++ E +E+ F  I AAYEVL D ++R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNP-ENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 65 ARYDKYGD 72
          A YD + +
Sbjct: 64 AWYDSHKE 71

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
            YEIL VE  A   EIKKAYRK A++ HPDK       E     FK I  A+EVL D E
Sbjct: 22 AFYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEA----FKIINRAFEVLSDVE 77

Query: 63 KRARYDKYG 71
          KR  YD+ G
Sbjct: 78 KRQLYDRIG 86

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADE---SLREESEVRFKEIAAAYEVLGDE 61
           YEILGV   A   EIK AYRK +++ HPDK+  +     R + E  + +I  AYE L DE
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 62  EKRARYDKYGDADG 75
             +  Y +YG  DG
Sbjct: 184 NVKENYLRYGHPDG 197

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 1  MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60
          +S+ YE LG+  D +  EIKKAY++  L  HPDK+ DES    S V   +I  AY+VL D
Sbjct: 2  ISSHYETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDES----SSVEVNKIQEAYKVLCD 57

Query: 61 EEKRARYDK 69
             R +YD+
Sbjct: 58 VNLREKYDE 66

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          + YEILGVE D  +++IKKAY+   L  HPDKV  +     ++V  +EI  AY VL +  
Sbjct: 6  SFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDV---GNKVLIEEIKEAYRVLIESP 62

Query: 63 KRARYDK 69
           R +YDK
Sbjct: 63 SREKYDK 69

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60
          M T YE+L V+ DA+ +EIK+AYR   L  HPDK  DE+ +    V    I  AY VL D
Sbjct: 1  MLTHYEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDEN-KPALNVSVNAIQEAYRVLSD 59

Query: 61 EEKRARYD 68
          E+ R  YD
Sbjct: 60 EKLRREYD 67

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
           [687 nt, 229 aa]
          Length = 228

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (52%), Gaps = 17/116 (14%)

Query: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
            Y +L VE  + + EIKK+YRK A++ HPDK       E     FK I  A+EVL D EK
Sbjct: 23  FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASEA----FKVINRAFEVLSDNEK 78

Query: 64  RARYDKYG-DAD------GSDFFNG-----PNEFEDAAFMNFFHSFG-SNPQNAYD 106
           R  +D+ G D D       +  FNG     P++FE+  F   F+  G + P++ +D
Sbjct: 79  REIFDRIGRDPDDRGVSSSASGFNGAQPGFPSDFENMFFRRQFNQGGHAAPEDIFD 134

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKV----ADESLREESEVRFKEIAAAYEVLGD 60
          YE+LGV +DA+  EIK  YRK  L  HPDK      D +++  S V   +I  AY VL +
Sbjct: 12 YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 61 EEKRARYDKYGDADGSDFFNGPNEFED 87
          ++ RA Y++    + S+   G N F D
Sbjct: 72 DQLRAAYNRA--LNDSNKLAGFNNFGD 96

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          + YE+L ++ +A+  ++KKAYRK A++ HPDK       E     FK+I  A+EVL DE 
Sbjct: 24 SFYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSDEN 79

Query: 63 KRARYDKYG 71
          KR  YD+ G
Sbjct: 80 KRKVYDQIG 88

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 39/67 (58%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          T YEIL +  DATQ EIKKAYR   L  HPDK++       S V   +I  AY++L + +
Sbjct: 8  THYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIK 67

Query: 63 KRARYDK 69
           R  YD+
Sbjct: 68 TRREYDR 74

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          T Y+++GV+I  +Q ++K +Y++   + HPDK +    +E     F  +  AY+ L +++
Sbjct: 23 TYYDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQ 78

Query: 63 KRARYDKYGD 72
          KRA YDKYG+
Sbjct: 79 KRAMYDKYGN 88

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES---EVRFKEIAAAYEVLGDE 61
           YE+LG+   AT+ E++ +YRK +++ HPDK++ +  +EE    E ++  I  AY+ L +E
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 62  EKRARYDKYGDADG 75
             R  Y KYG  DG
Sbjct: 177 VTRENYLKYGHPDG 190

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y +LGV  DAT  EI K+YRK A++ HPDK    S  ++ E  FK +  A+ VL + 
Sbjct: 8  TTHYSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVLTNG 63

Query: 62 EKRARYDK 69
          E+RA+Y+K
Sbjct: 64 EERAKYNK 71

>AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YJL162C
          (JJJ2)
          Length = 535

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 46/74 (62%), Gaps = 4/74 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y +LG+   A++L I+KAY + A + HPDK    S  +E+   FK +A A+ VL D+
Sbjct: 11 TTYYSLLGLPFGASELHIRKAYMRLARELHPDK----SKSKEAAELFKVVAHAHSVLTDK 66

Query: 62 EKRARYDKYGDADG 75
          EKR +YD+   A G
Sbjct: 67 EKRLKYDRQLIAKG 80

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {ON}
           Anc_2.350 YMR161W
          Length = 220

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 53/103 (51%), Gaps = 5/103 (4%)

Query: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
             YEIL V   A   EIKKAYRK A++ HPDK       E     FK I  A+EVLG+ E
Sbjct: 22  AFYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAEA----FKLINRAFEVLGNSE 77

Query: 63  KRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAY 105
           KR  +++ G  D  D     N   ++AF +    F  N +NA+
Sbjct: 78  KREIFNRIG-RDPDDRHVPSNAASESAFSSQSEHFPMNFENAF 119

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVA---DESLREESEVRFKEIAAAYEVLG 59
          + YEILG+E DA+ +EIK+AYR   L+ HPDK     + +    S     +I  AY+ L 
Sbjct: 4  SFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLI 63

Query: 60 DEEKRARYDK 69
          D++ R +YD+
Sbjct: 64 DQDLRKKYDE 73

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YE+L VE  A+  EIKKAYRK A++ HPDK       E     FK I  A+EVL D  K
Sbjct: 25 FYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSDVGK 80

Query: 64 RARYDKYG 71
          R  +D+ G
Sbjct: 81 RRMFDQLG 88

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES---EVRFKEIAAAYEVLGDE 61
           Y +LGV   AT  +IK AYRK +++ HPDK++ +   EE    E  + +I+ AYE L DE
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 62  EKRARYDKYGDADG 75
             +A Y  YG  DG
Sbjct: 185 ITKANYLTYGHPDG 198

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESL------REESEVRFKEIAAAYE 56
          T YE+L +  DAT  EIKKAY++  L  HPDK + + L       + + V   +I  AY+
Sbjct: 9  THYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYK 68

Query: 57 VLGDEEKRARYDK 69
          +L +E  R +YD+
Sbjct: 69 ILSNESTREQYDE 81

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
            Y+IL VE  ++ ++IKKAYRK A++ HPDK       E     FK I  A+EVL D +
Sbjct: 21 AFYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSDSQ 76

Query: 63 KRARYDKYG 71
          KR  YD+ G
Sbjct: 77 KRQIYDQIG 85

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          + YE+L V+  A+  +IKKAYRK A++ HPDK       E     FK++  A+EVL DE+
Sbjct: 24 SFYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSDEK 79

Query: 63 KRARYDKYG 71
          KR  YD+ G
Sbjct: 80 KRRVYDQLG 88

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVAD---ESLREESEVRFKEIAAAYEVLGDE 61
           Y +LGV   AT  E++ AYRK +++ HPDK+A    +  R E E ++  I  AY+ L DE
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 62  EKRARYDKYGDADG 75
             +  Y K+G  DG
Sbjct: 178 ITKENYLKFGHPDG 191

>Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar to
          Ashbya gossypii AEL112C
          Length = 543

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y +LG+  D T++ I+K+Y + A + HPDK    S  +E+   FK +A A+ +L D+
Sbjct: 11 TTYYSVLGLPFDTTEMHIRKSYMRLARELHPDK----SKSKEAAELFKIVAHAHSILTDK 66

Query: 62 EKRARYDK 69
          EK+ +YDK
Sbjct: 67 EKKLKYDK 74

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y +LG+  DAT  +I+K+Y K A + HPDK   E   E     FK +A A+ +L D 
Sbjct: 11 TTYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAE----LFKVVAHAHSILTDR 66

Query: 62 EKRARYDK 69
          EKR +YD+
Sbjct: 67 EKRLKYDR 74

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES---EVRFKEIAAAYEVLGDE 61
           Y++LG+   A+  +IK AYR+ +L+ HPDK++ E   EE    E  + +I+ A+E L D 
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 62  EKRARYDKYGDADG 75
             R  Y KYG  DG
Sbjct: 187 IVRENYLKYGHPDG 200

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 97/397 (24%), Positives = 158/397 (39%), Gaps = 75/397 (18%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
           Y++LG+   AT  EIKKAY K A ++HPD   + +    +E +F ++  AYE+L DE K+
Sbjct: 53  YKVLGINKSATSSEIKKAYYKLAKKYHPDINKEPT----AEKKFHDLQNAYEILSDETKK 108

Query: 65  ARYDKYGDA----DGSDFFNGPNE-------FEDAAFMNFFHSFGSNPQNAY-------- 105
           ++YD +G A    DGS   +  N               N F  FG N ++ +        
Sbjct: 109 SQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFEDLFGAAFGGGA 168

Query: 106 ---------------DHYGEQKVDRSADVQVPLNVSMADCYNG-KSFKFQSKRTLVCDRC 149
                          + Y E K D    +++   +   D   G  +   +      C  C
Sbjct: 169 GTGPGGARSGGARRSNMYREFKGD---PLEITHRIPFKDAVFGLANVSLKYNVMDPCHTC 225

Query: 150 LGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXX 209
            GSG ++         + +C  C G G K  IR    GF      TC  C G+G   +  
Sbjct: 226 HGSGIKQ------GAQKHQCPSCHGSGQKVHIRS---GFQMVS--TCNECHGEGTILNAS 274

Query: 210 XXXXXXXXXXVGTGVTTESKSLTVSLPRGSRQDDQIVLKGEA-------DQEVGKS---Q 259
                     V     T   S+ V+LP G +  D I + G+        D E+  S    
Sbjct: 275 DYCGTCHGDAV---EFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPELKNSVKLT 331

Query: 260 TGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIP 319
            G+++  I+   +    +   +  +D+     + +  A  G   T+  T+DG  L+L++ 
Sbjct: 332 RGDVLVRIRVDKDNRFSI---KDKYDIWFTKDIPITTAALGGIVTI-PTVDGTTLRLKVQ 387

Query: 320 PGKVIRPGNIIQIPHEGWP---IDTTTSGDLYVVVHI 353
            G   +   +I IP+ G P   I+    G++ V   I
Sbjct: 388 AG--TQHDQVISIPNLGVPRSSINKENRGNMKVQYRI 422

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 8/66 (12%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDK--VADESLREESEVRFKEIAAAYEVLGDEE 62
          Y +LG++ DA    IKKAYR+  L+ HPDK  +++ESL  +      ++  AY VL D+E
Sbjct: 6  YSVLGIDSDADSDTIKKAYRRRLLETHPDKKQISNESLSVD------QLQKAYRVLIDKE 59

Query: 63 KRARYD 68
           RA+YD
Sbjct: 60 LRAKYD 65

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA-DESLREES--EVRFKEIAAAYEVLGDE 61
           Y +L V   +T  EI+ AYRK +++ HPDK++ D S  E S  E ++  I  AY+ L DE
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 62  EKRARYDKYGDADG 75
             R  Y KYG  DG
Sbjct: 179 VTRENYLKYGHPDG 192

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 4  LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63
           YE+L V   A++ +IKKAYRK A++ HPDK       E     FK+I  A+EVL D+ K
Sbjct: 23 FYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEVLSDDSK 78

Query: 64 RARYDKYG 71
          R  +D+ G
Sbjct: 79 RRIFDQLG 86

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +TLY +L ++  AT+++I+KAY K A + HPDK    S  EE+   FK++A A+ +L D+
Sbjct: 13 TTLYSVLNLKYGATEVQIRKAYMKLARELHPDK----SKSEEAGELFKKVAHAHFILTDK 68

Query: 62 EKRARYD 68
          +++ +YD
Sbjct: 69 KEKMKYD 75

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y +LG+  DAT+ +IKKAYRK A+  HPDK    S  E     FK ++ A  VL D+
Sbjct: 11 TTHYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAE----LFKLVSHAQSVLIDK 66

Query: 62 EKRARYDK 69
          E+R  Y++
Sbjct: 67 EQRQSYNR 74

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 3  TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62
          + YEILGV+  +T  EIKKAY++  L  HPDK       E   V  +EI  AY+VL +  
Sbjct: 6  SYYEILGVDTKSTVAEIKKAYKEKLLCTHPDK---NRTVEAQNVSIEEIKEAYQVLVNPS 62

Query: 63 KRARYDK--YGDADGSDFFNGPNEFEDAAFMNF 93
           +  YDK          F+NG    ED +   F
Sbjct: 63 GKENYDKELAESYKKQGFYNGGEGLEDYSLDEF 95

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDK---VADESLREESEVRFKEIAAAYEVLGDE 61
           Y+ILGV+  AT  +++++Y +   + HPDK   + DE  R+++E +  EI  AYE+L D+
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQ-RQKNEEKMAEINEAYEILSDD 588

Query: 62  EKRARYD 68
           +KR +YD
Sbjct: 589 DKRTKYD 595

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEV--RFKEIAAAYEVLGDEE 62
           Y+ILG+   AT  +I++AY     ++HPDK    S +EES++  +  +I  AYE L D+ 
Sbjct: 496 YKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSDDT 555

Query: 63  KRARYDKYGDADGSDFFNGPNEFEDA 88
           +R  YD+   +        PN F  A
Sbjct: 556 RRKEYDQARSSGSRSGPMNPNMFRHA 581

>TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1.113
           YJR097W
          Length = 170

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 20/121 (16%)

Query: 1   MSTL--YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESL------------REESEV 46
           MS L  YEILG++ DAT+ +IK+AY++  L  HPDK+ + +               +S +
Sbjct: 1   MSLLSHYEILGIDSDATESDIKRAYKEKLLAIHPDKIKNNAKAKANTNENITGNENKSPI 60

Query: 47  RFKEIAAAYEVLGDEEKRARYDKYGDADGSD--FFNGPNEFEDAAFMNFFHSFGSNPQNA 104
               I  AY++L D + R +YDK  +       FFN  +  E+ +       F  N +N 
Sbjct: 61  SVNHIQDAYKILVDSKSRQQYDKELEEQFKKMGFFNNGDGVEEIS----LDEFEWNEKNE 116

Query: 105 Y 105
           Y
Sbjct: 117 Y 117

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEV--RFKEIAAAYEVLGDEE 62
           Y+ILG+  DA   +I++AY     ++HPDK  + S  E ++V  +   I  AYEVL DE 
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 63  KRARYDKYGDADGSDFFNG 81
           KR  YD      GS    G
Sbjct: 571 KRKEYDMLRSGGGSQHAGG 589

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKV--ADESLREESEVRFKEIAAAYEVLGDEE 62
           Y+ILG+  +AT  +I+KAY +   ++HPDK     ES ++++  +  EI  AYE L DE 
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 63  KRARYD 68
           K++ YD
Sbjct: 621 KKSEYD 626

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          ST Y ILGV  +A+  EI+K+Y K A + HPDK   E   E     FK +  A+ +L ++
Sbjct: 11 STYYSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAE----LFKLVVDAHSILNND 66

Query: 62 EKRARYDK 69
          + RA YDK
Sbjct: 67 QLRAEYDK 74

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 8/86 (9%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          YE+LGV    T+ E+KK YRK  L+ HPDK  D +   E++ +F +I  A+EVL  ++ +
Sbjct: 16 YEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWT--PEAKEKFHKIQFAFEVL--DKFK 71

Query: 65 ARYDKYGDAD----GSDFFNGPNEFE 86
            YDK G  +    GSDF +  + F+
Sbjct: 72 ETYDKTGSVEACFKGSDFADWKDLFD 97

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y  LG+  +A + EI K+Y   A Q HPDK   E+  E+    FK I+ A+ VL DE
Sbjct: 12 TTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQ----FKLISHAHSVLMDE 67

Query: 62 EKRARYD 68
           KR +YD
Sbjct: 68 AKRLKYD 74

>TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1.92
           YGL128C
          Length = 285

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 14/97 (14%)

Query: 4   LYEILGVEIDATQLE-----IKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVL 58
           LYE L ++I+++  +     IKK YRK AL +HPDK  D S    +  +F  ++ A  +L
Sbjct: 15  LYEELDIKIESSPQDVPLALIKKQYRKMALMYHPDKQPDNS---SAIHKFHMLSLATHIL 71

Query: 59  GDEEKRARYDKY------GDADGSDFFNGPNEFEDAA 89
            DE  RA YDK+       D   ++  N  NE E  A
Sbjct: 72  TDESSRAAYDKWLERRIDNDEQRNELINQLNERESRA 108

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADE---SLREESEVRFKEIAAAYEVLGDE 61
           Y+ILG++ +A+  EI+KAY     ++HPDK   +      ++++ +  EI  AYEVL DE
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 62  EKRARYDKYGDADGSDFFNGPNEF 85
           EKR  YD      GS  F   N F
Sbjct: 603 EKRKEYD--SIRSGSRQFQPRNNF 624

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA--DESLREESEVRFKEIAAAYEVLGDEE 62
           Y++LGV   AT  +I+K+Y     ++HPDK     E+ + +++ +  EI  AYE+L DE 
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 63  KRARYD--KYGDA---DGSDFFNGPNEFEDAAF-MNF--FH 95
           KR  YD  + G A    GS F  G   F    F MNF  FH
Sbjct: 567 KRKEYDDQRSGRAPQGQGSPFGQGGFPFGSGNFKMNFGGFH 607

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 2/67 (2%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64
          Y  L +  DA   ++KK+YR+  L++HPDK++++  +EE++ RF ++  +YEVL   + R
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT--KFR 71

Query: 65 ARYDKYG 71
            YDK G
Sbjct: 72 EIYDKSG 78

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 94/391 (24%), Positives = 154/391 (39%), Gaps = 73/391 (18%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPD--KVADESLREESEVRFKEIAAAYEVLGDEE 62
           Y  LGV   AT  EIKKAY K A ++HPD  K AD      ++ +F ++  AYE+L D+ 
Sbjct: 41  YSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAAD------AQKKFHDLQNAYEILSDDC 94

Query: 63  KRARYDKYGDADGSDFFNGPN------------------------------EFEDAAFMN 92
           KR ++D+YG A  S    GP+                               FED     
Sbjct: 95  KRQQWDQYGPAAFSQGDAGPSGAGGGAEGFGGFGGFGGGGFGGAGGGFGGINFEDLFGAA 154

Query: 93  FFHSFGSNPQNAYDHYGEQKVD-RSADVQVPLNVSMADCYNG-KSFKFQSKRTLVCDRCL 150
           F    G          G    + + + +++   +S  D   G K+   +      C+ C 
Sbjct: 155 FGGGAGGAGGAGGRSRGSMYREYQGSPIEISHRISFKDSVFGTKNVNLKYSAYDPCNTCD 214

Query: 151 GSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASXXX 210
           GSG +          +  C  C G G +  +R    GF      TC  C G+G       
Sbjct: 215 GSGLKPGAS------RSTCPGCSGTGTRVHVR---AGFQMAS--TCNQCGGEGSVLRDAD 263

Query: 211 XXXXXXXXXVGTGVTTE-SKSLTVSLPRGSRQDDQIVLKGE----------ADQEVGKSQ 259
                     G G   + +  L V LP G +  D I + G+          A ++  +  
Sbjct: 264 TCQTCH----GEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLS 319

Query: 260 TGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSKTLTKTLDGRILQLQIP 319
            G+L+  I+   +    +   ++ +D+     + +  A  G   T+  T+DG  ++L++ 
Sbjct: 320 RGDLLLRIRVDKDPRFQI---KNKYDIWFTQDIPITTAALGGVVTIP-TVDGEQVRLKVS 375

Query: 320 PGKVIRPGNIIQIPHEGWPIDT-TTSGDLYV 349
           PG   +  +++ IP +G P  +  T GD+ V
Sbjct: 376 PG--TQHHDVVSIPQKGVPRGSFGTRGDMKV 404

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEV---RFKEIAAAYEVLGDE 61
           Y +L +   +T  EI+ AYRK +++ HPDK++ +   +E  V   ++  I  AY+ L DE
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 62  EKRARYDKYGDADG 75
             R  Y +YG  DG
Sbjct: 177 ITRENYLRYGHPDG 190

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y ILG+  +AT  E+ K+Y K A   HPDK       ++SE  FK +  A+ +L DE
Sbjct: 12 TTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKS----DKSEELFKAVVHAHSILTDE 67

Query: 62 EKRARYDK 69
          +++ RYD+
Sbjct: 68 DQKLRYDR 75

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y ILG+   AT  EI+K+Y K A Q HPDK   +S  E     FK +  A+ +L DE
Sbjct: 6  TTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE----LFKLVVHAHSILTDE 61

Query: 62 EKRARYD 68
          E + +YD
Sbjct: 62 ETKRKYD 68

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 5  YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREE--SEVRFKEIAAAYEVLGDEE 62
          YE+L VE  A+  +IK+AYR+  L  HPDK   +  R +  ++   ++I  AY VL D  
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 63 KRARYD 68
          +R +YD
Sbjct: 66 RREQYD 71

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVA---DESLREESEVRFKEIAAAYEVLGDE 61
           YE+L V   AT  EI+ AYRK +++ HPDK+A    ++ R   E ++  I  AY+ L D+
Sbjct: 117 YELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDD 176

Query: 62  EKRARYDKYGDADG 75
             R  + +YG  DG
Sbjct: 177 ATRDNFLRYGHPDG 190

>Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C
          (REAL)
          Length = 565

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61
          +T Y ILG+  +AT LE+ K+Y K A   HPDK   +   E     FK +  A+ VL D+
Sbjct: 12 TTYYSILGLTSNATSLEVHKSYLKLARLLHPDKTKSDKCEE----LFKAVVHAHSVLTDK 67

Query: 62 EKRARYDK 69
          +++ RYD+
Sbjct: 68 DEKLRYDQ 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,937,442
Number of extensions: 1968434
Number of successful extensions: 6163
Number of sequences better than 10.0: 373
Number of HSP's gapped: 5638
Number of HSP's successfully gapped: 407
Length of query: 429
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 317
Effective length of database: 40,638,807
Effective search space: 12882501819
Effective search space used: 12882501819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)