Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039008.263ON55955930010.0
YLR089C (ALT1)8.263ON59256521470.0
NCAS0B050208.263ON56855421350.0
Skud_12.1578.263ON59251721350.0
Suva_10.1738.263ON59251821320.0
Smik_12.1488.263ON59256521280.0
ZYRO0C01628g8.263ON53452021070.0
NDAI0B019908.263ON58851621070.0
SAKL0H17006g8.263ON53148820800.0
KNAG0G020408.263ON59149720650.0
CAGL0L12254g8.263ON57450020260.0
KLLA0F19162g8.263ON52853120100.0
KAFR0B027308.263ON53949319350.0
Kpol_392.58.263ON51249019160.0
TPHA0J007508.263ON52252018880.0
NCAS0B038408.263ON49749118750.0
Skud_4.3728.263ON50748918280.0
YDR111C (ALT2)8.263ON50748918160.0
KLTH0G13662g8.263ON51948118130.0
KNAG0M012108.263ON52148918120.0
Suva_2.2718.263ON50748918090.0
Smik_4.3578.263ON50748918070.0
Kwal_56.237918.263ON51850618020.0
TBLA0E044408.263ON56248617900.0
KAFR0B055308.263ON51449117820.0
Ecym_43078.263ON53450117600.0
Kpol_543.398.263ON49248917530.0
KAFR0B05520singletonON51049117520.0
NDAI0J013608.263ON50149117350.0
AGR085W8.263ON52154417140.0
TPHA0A018008.263ON49849016870.0
TBLA0F030608.263ON50049715730.0
TBLA0G01630singletonON50049815190.0
Kwal_34.160181.472ON3791661491e-09
TPHA0O014501.321ON4431801341e-07
Kpol_1039.222.252ON3861731322e-07
ADL249W2.252ON3871801285e-07
KLTH0G09614g2.252ON3891271286e-07
KLLA0F03509g2.252ON3871741251e-06
KLLA0F10021g3.511ON4973231223e-06
ZYRO0A01672g2.252ON3861321205e-06
NCAS0A092001.321ON4453271205e-06
TDEL0D019001.321ON4433291197e-06
CAGL0J05126g1.321ON4333681198e-06
Kpol_1035.231.321ON4443281198e-06
NDAI0G057601.321ON4483261189e-06
SAKL0D06886g1.321ON4473271171e-05
Suva_6.1361.321ON4443601171e-05
KLTH0G19646g1.472ON3791311152e-05
Skud_10.1561.321ON4603281162e-05
KLTH0H10648g1.321ON4433761152e-05
KNAG0B053201.321ON4331681152e-05
NDAI0B045502.102ON5651681152e-05
Kwal_14.25741.321ON4433261134e-05
SAKL0E08492g2.252ON3841721124e-05
Ecym_32902.252ON3861931107e-05
YJL060W (BNA3)1.321ON4443281118e-05
NCAS0G040501.472ON3841651109e-05
Smik_10.1801.321ON4441351109e-05
KLLA0F01617g1.321ON4443611091e-04
SAKL0D11528g1.472ON3831521091e-04
KNAG0E018502.252ON3841411091e-04
Kwal_23.48882.252ON3891271072e-04
Kpol_1035.302.102ON5013181072e-04
TBLA0B009902.102ON5461591054e-04
ZYRO0G20636g1.321ON4531741045e-04
Ecym_6319singletonON3542991035e-04
YIL116W (HIS5)2.252ON3851341036e-04
KNAG0B006603.511ON4961251036e-04
SAKL0F02156g3.511ON4981321037e-04
NCAS0B064402.252ON3851681028e-04
NDAI0B037302.252ON3861301019e-04
Suva_9.782.252ON3861421010.001
YHR137W (ARO9)2.102ON5132691010.001
Ecym_62921.321ON4303281000.001
TDEL0C040902.252ON383131990.002
NCAS0E006703.511ON497148990.002
TPHA0D033703.511ON49764990.002
TPHA0F012602.252ON392177970.003
Smik_9.532.252ON388136970.003
Skud_9.552.252ON385136960.004
KAFR0J015802.252ON383134950.005
TDEL0A016008.204ON475247950.006
KAFR0A017101.321ON435366950.006
Smik_8.2182.102ON513272950.007
CAGL0G01254g3.511ON50458940.008
Kwal_47.189823.511ON496188930.010
AEL170C1.321ON458262930.011
SAKL0H21824gna 1ON499155920.013
NCAS0B072202.102ON51044920.013
KLTH0G02002g3.511ON496132920.015
Kpol_1032.398.204ON453197900.022
Suva_15.3342.102ON560264900.022
KLLA0E00969g8.204ON445236890.027
Skud_8.1982.102ON517267890.030
Kpol_480.11.472ON380153880.040
Kpol_278.23.511ON498122880.043
AFR548C3.511ON497124880.046
TDEL0D057903.511ON49758860.065
KNAG0G005501.472ON387176860.071
TPHA0O015202.102ON50349860.073
CAGL0C01243g2.252ON383133850.080
SAKL0H18612g8.204ON445183850.081
KLTH0G19624gsingletonON468184860.082
Kpol_431.132.475ON443237850.082
Kwal_47.17462na 1ON492133850.086
TBLA0B093302.420ON408137840.10
NDAI0I028303.511ON500126850.10
YGL202W (ARO8)3.511ON500123840.13
Smik_7.693.511ON500122840.13
CAGL0G06028g2.102ON537139830.18
Smik_5.3198.204ON44371820.22
KNAG0G016808.204ON45234820.24
KAFR0D014203.511ON492130810.26
CAGL0I06578g8.204ON436176810.27
Suva_5.2818.204ON450189810.32
KLLA0D11110g2.102ON530142800.35
TBLA0A103205.287ON62159800.36
KLTH0B00176g8.204ON44844800.39
ZYRO0C06028g3.511ON496224800.40
KLLA0A04906gna 1ON480136790.49
TPHA0J024306.221ON58799790.51
Kwal_26.77682.475ON422122780.71
YER152C8.204ON44334770.78
ZYRO0B11088g8.204ON45033770.89
NDAI0K02720na 2ON407161751.3
Skud_7.693.511ON50044751.4
AGR141C8.204ON43832751.5
Suva_7.613.511ON500126751.6
Ecym_7228na 1ON488135751.7
Skud_5.2908.204ON44334741.8
Kwal_8.5858.204ON44655741.8
Ecym_55428.204ON44633741.9
TDEL0A018502.411ON113881752.0
CAGL0H01089g5.294ON29573732.1
Kpol_1020.452.191ON165192732.8
TDEL0E003802.3ON50545733.0
TPHA0A021608.191ON412137723.3
NCAS0A038308.204ON44632714.2
NDAI0C059608.204ON47834706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03900
         (559 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...  1160   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   831   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   827   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   827   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   825   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   824   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   816   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   816   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   805   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   800   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   785   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   778   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   749   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   742   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   731   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   726   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   708   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   704   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   702   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   702   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   701   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   700   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   698   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   694   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            691   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   682   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   679   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   679   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   672   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   664   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   654   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   610   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              589   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    62   1e-09
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    56   1e-07
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    55   2e-07
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    54   5e-07
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    54   6e-07
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    53   1e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    52   3e-06
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    51   5e-06
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    51   5e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   7e-06
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    50   8e-06
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    50   8e-06
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    50   9e-06
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    50   1e-05
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   1e-05
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    49   2e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    49   2e-05
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    49   2e-05
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    49   2e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    49   2e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    48   4e-05
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    48   4e-05
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    47   7e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    47   8e-05
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    47   9e-05
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    47   9e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    47   1e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    47   1e-04
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    47   1e-04
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    46   2e-04
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    46   2e-04
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    45   4e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    45   5e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    44   5e-04
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    44   6e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    44   6e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    44   7e-04
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    44   8e-04
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    44   9e-04
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    44   0.001
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    44   0.001
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    43   0.001
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    43   0.002
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     43   0.002
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    43   0.002
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.003
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    42   0.003
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    42   0.004
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    41   0.005
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    41   0.006
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    41   0.006
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    41   0.007
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    41   0.008
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    40   0.010
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    40   0.011
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    40   0.013
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    40   0.013
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.015
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    39   0.022
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    39   0.022
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    39   0.027
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    39   0.030
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    39   0.040
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    39   0.043
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    39   0.046
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    38   0.065
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       38   0.071
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    38   0.073
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    37   0.080
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    37   0.081
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    38   0.082
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    37   0.082
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    37   0.086
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    37   0.10 
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    37   0.10 
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    37   0.13 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.13 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    37   0.18 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    36   0.22 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    36   0.24 
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    36   0.26 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    36   0.27 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    36   0.32 
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    35   0.35 
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    35   0.36 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    35   0.39 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    35   0.40 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    35   0.49 
TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {...    35   0.51 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    35   0.71 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    34   0.78 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   0.89 
NDAI0K02720 Chr11 complement(610291..611514) [1224 bp, 407 aa] {...    33   1.3  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    33   1.4  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    33   1.5  
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    33   1.6  
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    33   1.7  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    33   1.8  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   1.8  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    33   1.9  
TDEL0A01850 Chr1 complement(337255..340671) [3417 bp, 1138 aa] {...    33   2.0  
CAGL0H01089g Chr8 complement(102118..103005) [888 bp, 295 aa] {O...    33   2.1  
Kpol_1020.45 s1020 complement(100969..105924) [4956 bp, 1651 aa]...    33   2.8  
TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}...    33   3.0  
TPHA0A02160 Chr1 (441765..443003) [1239 bp, 412 aa] {ON} Anc_8.1...    32   3.3  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   4.2  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   6.3  

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score = 1160 bits (3001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/559 (100%), Positives = 559/559 (100%)

Query: 1   MSSIAVTQRCYMRSTSVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGL 60
           MSSIAVTQRCYMRSTSVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGL
Sbjct: 1   MSSIAVTQRCYMRSTSVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGL 60

Query: 61  HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK 120
           HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK
Sbjct: 61  HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK 120

Query: 121 IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD 180
           IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD
Sbjct: 121 IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD 180

Query: 181 VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ 240
           VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ
Sbjct: 181 VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ 240

Query: 241 ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300
           ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL
Sbjct: 241 ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300

Query: 301 VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK 360
           VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK
Sbjct: 301 VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK 360

Query: 361 EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ 420
           EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ
Sbjct: 361 EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ 420

Query: 421 ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480
           ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF
Sbjct: 421 ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480

Query: 481 PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 540
           PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
Sbjct: 481 PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 540

Query: 541 EWIKKWEDFHKKFYDQYRD 559
           EWIKKWEDFHKKFYDQYRD
Sbjct: 541 EWIKKWEDFHKKFYDQYRD 559

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/565 (70%), Positives = 464/565 (82%), Gaps = 24/565 (4%)

Query: 19  LISRASAMPHTITT------------------TLQGRSGLGRSYMNIKRARSTSSTAAGL 60
           L S A  MPH  T                    LQ  S       N +R+ S  S+   L
Sbjct: 28  LTSSAEKMPHITTPFSTSASSTKLKAFRKVRPVLQRHSSSWIVAQNHRRSLSGQSSLNDL 87

Query: 61  HHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPS 114
            H+    +H  K  + +FYPAE LT+ D+NENVLKAKYAVRG+IPMRAEEL+ QL++DP 
Sbjct: 88  RHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQ 147

Query: 115 SLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERA 174
           SLPFD+I+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+   +FK DAI+RA
Sbjct: 148 SLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRA 207

Query: 175 KRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLS 234
           K ++ D+GGSVGAYSSSQGV GIRK+VA+FIT+RD GE +YPEDIFLTAGASAAV+YLLS
Sbjct: 208 KSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLS 267

Query: 235 ILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESG 294
           I CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTN  EIE VV E+I++ 
Sbjct: 268 IFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNE 327

Query: 295 IRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKV 354
           I+P+VLVVINPGNPTG+VLS E+I +IF+VAAKYG VVIADEVYQENIF G++FHSMKK+
Sbjct: 328 IKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKI 387

Query: 355 LRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLC 414
           LR LQ+EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+RQV+LKLASISLC
Sbjct: 388 LRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLC 447

Query: 415 PVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPR 474
           PVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L++TFNSLEGIECQKP+
Sbjct: 448 PVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQ 507

Query: 475 GAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTT 534
           GAMYLFP+I LP+KA+Q A+HLE TPDEFYC+KLLE+TGICTVPGSGFGQEPGTYHLRTT
Sbjct: 508 GAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTT 567

Query: 535 FLAPGTEWIKKWEDFHKKFYDQYRD 559
           FLAPG EWIKKWE FHK+F+DQYRD
Sbjct: 568 FLAPGLEWIKKWESFHKEFFDQYRD 592

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/554 (71%), Positives = 463/554 (83%), Gaps = 7/554 (1%)

Query: 9   RCYMRSTSVGLISRA--SAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHK 66
           R   R+ SV L +    + MPH +  +   +      Y   KR  S+++T          
Sbjct: 19  RILTRTYSVNLTNNKFNNKMPHFMEPSTSPQ----YPYFETKRTISSAATKLKTKPKPTT 74

Query: 67  KC-HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNAN 125
           K  H +F PA+ LT+ +LN+NVLKAKYAVRG+IPMRAEEL+ QL+ DPSSLPFD IVNAN
Sbjct: 75  KKNHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNAN 134

Query: 126 IGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSV 185
           IGNPQQLNQKPLSFYRQVLS+LQYPE+L+Q E +L++ G+FK+DA+ERAK +L ++GG+V
Sbjct: 135 IGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTV 194

Query: 186 GAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVL 245
           GAYS+SQGVYGIRKTVA+FIT+RD+GEPAYPEDIFLTAGASAAV YLLSILC+G ETGVL
Sbjct: 195 GAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVL 254

Query: 246 IPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINP 305
           IPIPQYPLYTA+LALNNSH LPYYLDE+SGWSTN  EIE VV  + +  IRPSVLVVINP
Sbjct: 255 IPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGI 365
           GNPTG+VLS ++IE IF++AAKYGIVVIADEVYQEN+F   +FHSMKKVLR LQK+HPG+
Sbjct: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGV 374

Query: 366 YDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDL 425
           YD VQL SLHSTSKGVSGECGQRGGYMELTGFTHE+R V+LKLASISLCPVVTGQALVDL
Sbjct: 375 YDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDL 434

Query: 426 MVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKL 485
           MV PPK GDES+EQD+ ER+ I  EL  RA  L+  FN+LEGIECQKP+GAMYLFP++ L
Sbjct: 435 MVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDL 494

Query: 486 PYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKK 545
           P+KA+Q AQHLE +PDEFYC+ LLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI+K
Sbjct: 495 PFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEK 554

Query: 546 WEDFHKKFYDQYRD 559
           W+ FH+ FY+ YRD
Sbjct: 555 WKIFHQDFYNTYRD 568

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/517 (75%), Positives = 452/517 (87%), Gaps = 6/517 (1%)

Query: 49  RARSTSSTAAGLHHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRA 102
           R+ S  S+   L H+    +H  K  + DFYPAE LT+ D+NENVLKAKYAVRG+IPMRA
Sbjct: 76  RSLSGQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRA 135

Query: 103 EELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELIS 162
           EEL+ QL++DP SLPFDKI+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+ 
Sbjct: 136 EELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVD 195

Query: 163 KGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLT 222
             +FK DAI+RAK ++ D+GGSVGAYSSSQGV GIRK+VA+FIT+RD GE +YPEDIFLT
Sbjct: 196 SKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLT 255

Query: 223 AGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAE 282
           AGASAAV+YLLSI CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE+SGWSTN  E
Sbjct: 256 AGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEE 315

Query: 283 IEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENI 342
           IE VV E+I++ I+P+VLVVINPGNPTG+VLS E++ +IF+VAAKYG VVIADEVYQENI
Sbjct: 316 IETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENI 375

Query: 343 FAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIR 402
           F G++FHSMKK+LR LQ+EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+R
Sbjct: 376 FPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMR 435

Query: 403 QVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTF 462
           QV+LKLASISLCPVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L+DTF
Sbjct: 436 QVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTF 495

Query: 463 NSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGF 522
           NSLEGIECQKP+GAMYLFP+I LP+KA+Q A+HLE TPDEFYC+ LLE+TGICTVPGSGF
Sbjct: 496 NSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGF 555

Query: 523 GQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           GQEPGTYHLRTTFLAPG EWIKKWE FHK+F+DQYRD
Sbjct: 556 GQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/518 (75%), Positives = 453/518 (87%), Gaps = 6/518 (1%)

Query: 48  KRARSTSSTAAGLHHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMR 101
           KR+ S  S+   L H+    +H  K  + +FYPAE LT+ D+NENVLKA+YAVRG+IPMR
Sbjct: 75  KRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMR 134

Query: 102 AEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELI 161
           AEEL+ QL++DP SLPF+KI+NANIGNPQQL QKPL++YRQVLS+LQYPE+L   E+EL+
Sbjct: 135 AEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELV 194

Query: 162 SKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFL 221
              +FK DAI+RAK +++D+GGSVGAYSSSQGV GIRK+VADFIT+RD GE AYPEDIFL
Sbjct: 195 GSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFL 254

Query: 222 TAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTA 281
           TAGASAAV+YLLSI CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTN  
Sbjct: 255 TAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPE 314

Query: 282 EIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQEN 341
           EIE VV E+I++ I+P+VLVVINPGNPTG+VLS E+I +IF+VAAKYG VVIADEVYQEN
Sbjct: 315 EIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQEN 374

Query: 342 IFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEI 401
           IF G+EF+SMKKVLR LQ++HPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+
Sbjct: 375 IFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEM 434

Query: 402 RQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDT 461
           RQV+LKLASISLCPVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L+ RA  L++T
Sbjct: 435 RQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYET 494

Query: 462 FNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSG 521
           FNSLEGIECQKP+GAMYLFP+I +P+KAIQ A HLE TPDEFYC+KLLE+TGICTVPGSG
Sbjct: 495 FNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSG 554

Query: 522 FGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           FGQEPGTYHLRTTFLAPG EW+KKWE FHK+F+DQYRD
Sbjct: 555 FGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/565 (70%), Positives = 463/565 (81%), Gaps = 24/565 (4%)

Query: 19  LISRASAMPHT------------------ITTTLQGRSGLGRSYMNIKRARSTSSTAAGL 60
           L SRA  MPH                   I   LQ  S    +  N +R+ S  S+   L
Sbjct: 28  LTSRAEKMPHISTPFTTSASNTNLKAFRKIRPVLQRHSSSWIAAQNHRRSLSGQSSLNDL 87

Query: 61  HHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPS 114
            H+    +H  K  + +FYPAE LT+ D+NENVLKAKYAVRG+IPMRAEEL+ QL++DP 
Sbjct: 88  RHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQ 147

Query: 115 SLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERA 174
           SLPF+KI+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+   +FK DAI+RA
Sbjct: 148 SLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRA 207

Query: 175 KRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLS 234
           K ++ ++GGSVGAYSSSQGV GIR++VA+FIT+RD GE +YPEDIFLTAGASAAV+YLLS
Sbjct: 208 KSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLS 267

Query: 235 ILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESG 294
           I CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTN  EIE VV E+IE+ 
Sbjct: 268 IFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENE 327

Query: 295 IRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKV 354
           I+ +VLVVINPGNPTG+VLS E+I +IF+VAAKYG VVIADEVYQENIF G++FHSMKK+
Sbjct: 328 IKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKI 387

Query: 355 LRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLC 414
           LR LQ+EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+RQV+LKLASISLC
Sbjct: 388 LRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLC 447

Query: 415 PVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPR 474
           PVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L+ TFNSLEGIECQKP+
Sbjct: 448 PVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQ 507

Query: 475 GAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTT 534
           GAMYLFP+I LP++A+Q A+HLE TPDEFYC+KLLE+TGICTVPGSGFGQEPGTYHLRTT
Sbjct: 508 GAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTT 567

Query: 535 FLAPGTEWIKKWEDFHKKFYDQYRD 559
           FLAPG EWIKKWE FHK+F+D YRD
Sbjct: 568 FLAPGLEWIKKWETFHKEFFDHYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/520 (73%), Positives = 447/520 (85%), Gaps = 2/520 (0%)

Query: 42  RSYMNIKRARSTSSTAAGLHHIYHKKCH--QDFYPAESLTVRDLNENVLKAKYAVRGSIP 99
           R+ + + +   ++ T A LHHI+ K  +     YPAE L + ++NENVLKAKYAVRG+IP
Sbjct: 15  RTLLQVAQRYKSAQTEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIP 74

Query: 100 MRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEE 159
           M A EL  +LK+DP SLPFD IV+ANIGNPQ L QKPL+FYRQVLS+LQYP +LE+ E+ 
Sbjct: 75  MLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQV 134

Query: 160 LISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDI 219
           LI   ++++DAI RA+R+L D+G SVGAYS+SQG+ GIR+TVA FITERD GE AY EDI
Sbjct: 135 LIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDI 194

Query: 220 FLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTN 279
           FLTAGAS+AVSYLLSILC+GQETGVLIPIPQYPLYTA+LALNNSH LPYYLDE+SGWSTN
Sbjct: 195 FLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTN 254

Query: 280 TAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
             EIE VV  +IE  I+PSVLVVINPGNPTG+VLS E I +IF +AAKYGIVVIADEVYQ
Sbjct: 255 PTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314

Query: 340 ENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTH 399
           EN+F G+EFHSMKK+LR+LQK +PG++DNVQL SLHSTSKGVSGECGQRGGYME+TGF +
Sbjct: 315 ENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNN 374

Query: 400 EIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLH 459
           +IRQV+LKLASISLCPVVTGQALVDLMV PPKPGDESYE D++ER+ IHE L  RAG LH
Sbjct: 375 DIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLH 434

Query: 460 DTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPG 519
            TFNSLEGIECQKP GAMYLFP++ LP+KAIQ+A+H   TPD FYC+KLLEATGICTVPG
Sbjct: 435 ATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPG 494

Query: 520 SGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           SGFGQEPGTYHLRTTFLAPGTEWI++WE+FHK FY++YRD
Sbjct: 495 SGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 439/516 (85%), Gaps = 3/516 (0%)

Query: 44  YMNIKRARSTSSTAAGLHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAE 103
           + + KRA  T S +   HH       +DF PAE LT+ DLNENVLKAKYAVRGSIPMRAE
Sbjct: 76  FFDAKRALMTRSIS---HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAE 132

Query: 104 ELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISK 163
           EL+ QL+ +PS+LPF +IVNANIGNPQQL QKPLSFYRQVLSILQYP++L++ E+ LI  
Sbjct: 133 ELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDA 192

Query: 164 GVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTA 223
            V+KRDAI+RAK +L ++GGSVGAYS+SQGVYGIRKTVA+FITERD GEPAYPEDIFLT 
Sbjct: 193 KVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTV 252

Query: 224 GASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEI 283
                  YLLSILC+G +TGVLIPIPQYPLYTATLALNNSH LPYYLDE+SGWSTN  EI
Sbjct: 253 WCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEI 312

Query: 284 EGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIF 343
           E VV +++E  I PSVLVVINPGNPTG+VL+ E+IE IF++AAKYGIVVIADEVYQENI 
Sbjct: 313 EEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIA 372

Query: 344 AGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQ 403
            G +F+SMKKVLR+LQK HPG +DNVQL SLHSTSKGVSGECGQRGGYMEL GFTHE+R+
Sbjct: 373 DGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRK 432

Query: 404 VVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFN 463
           V+LKLASISLCPVVTGQALVDLMV PPK GD SYEQD+ ER  I  EL  RA  L++TF 
Sbjct: 433 VILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFV 492

Query: 464 SLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFG 523
            LEGIECQKP+GAMYLFP++ LP+KA+Q AQHLE TPDEFYC+ LL+ATGICTVPGSGFG
Sbjct: 493 GLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFG 552

Query: 524 QEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           QEPGTYHLRTTFLAPGTEWIKKWE FHK+FYD YRD
Sbjct: 553 QEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/488 (76%), Positives = 432/488 (88%), Gaps = 1/488 (0%)

Query: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131
           F PA+ L++ DLNENVL+AKYAVRG IP +AEEL+ QL RDP SLPFD+I+NANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 132 LNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSS 191
           L+QKPL+FYRQVLS+LQ P++LE+   E +S+ ++K DAI+RA R+L ++GGSVGAYS S
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ-IYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 192 QGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQY 251
           QGVYG RKTVADFIT+RD GE AY EDIFLTAGASAAVSY+LSILCRG +TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 252 PLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGS 311
           PLYTA+LALNNSH LPYYLDEES WSTN  EIE VVT SI  G+ P  LVVINPGNPTG+
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 312 VLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQL 371
           +LS E+IEKIF+VAAKYGIVVIADEVYQEN+F G+EFHSM+KVL+ LQ++H G +DN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 372 VSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPK 431
            SLHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMVCPPK
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 432 PGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQ 491
           PGD SYEQD+KER  IH+ LD RA +L++TFN LEGIECQKP+GAMYLFP++ L YKA+Q
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 492 AAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHK 551
            A+HL  +PDEFYCQ+LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WIK WE+FHK
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 552 KFYDQYRD 559
           KFY++YRD
Sbjct: 524 KFYNEYRD 531

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/497 (75%), Positives = 432/497 (86%), Gaps = 2/497 (0%)

Query: 65  HKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNA 124
           H K H  F PA  + + DLNENVLKAKYAVRGSIPMRAE+LQ QL+ DP SLPFDKI+NA
Sbjct: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154

Query: 125 NIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEE-LISKGVFKRDAIERAKRILRDVGG 183
           NIGNPQQLNQKPLSFYRQVLS+LQ+PE+L   +E    +  ++K DA+ RA+++L D+GG
Sbjct: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214

Query: 184 SVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETG 243
           SVGAYS+SQGV GIRKTVADFIT RD+ EPAYPEDIFLTAGASAAVSYLLSI C+G++TG
Sbjct: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274

Query: 244 VLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVI 303
           VLIPIPQYPLYTATLALNNSH LPYYLDE+SGWSTNT EI+ VV ++I+  I+PSVLVVI
Sbjct: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334

Query: 304 NPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIF-AGSEFHSMKKVLRQLQKEH 362
           NPGNPTG+VLS +AI +IF++AAKYGIVVIADEVYQENIF    +FHSMKKVLR+LQ+EH
Sbjct: 335 NPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394

Query: 363 PGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQAL 422
           PG +D VQL SLHSTSKGVSGECGQRGG+MELTGF+HEIRQV+LKLASISLCPVVTGQAL
Sbjct: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454

Query: 423 VDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQ 482
           VDLMV PP+ G+ESYE D+ ER  IH EL  RA  L +TFN LEGI+CQKP+GAMYLFP+
Sbjct: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514

Query: 483 IKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEW 542
           + LP+KA+Q AQH+E T DEFYC++LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEW
Sbjct: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574

Query: 543 IKKWEDFHKKFYDQYRD 559
           I  WE FHK+FY++YRD
Sbjct: 575 IDLWEKFHKEFYNKYRD 591

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/500 (73%), Positives = 430/500 (86%), Gaps = 4/500 (0%)

Query: 60  LHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFD 119
           +HH  H   +  F PAE  T++D+NE VL AKYAVRG+IPMRAEEL+ QL  +P SLPF+
Sbjct: 79  IHH--HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFN 136

Query: 120 KIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILR 179
            I+NANIGNPQQL QKPLSFYRQVLS+LQYPE++   E     + + K+DAI+RAKR+L 
Sbjct: 137 DIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN--PQTMIKQDAIDRAKRLLD 194

Query: 180 DVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRG 239
           D+GGSVGAYSSSQGV GIRKTVADFIT RD G  AYPEDIFLTAGAS+AV YLLSI CRG
Sbjct: 195 DIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRG 254

Query: 240 QETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSV 299
           +ETGVLIPIPQYPLYTATLAL NSH LPYYL+EE+GWST+  E+E ++ +SIE+ I+PSV
Sbjct: 255 EETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSV 314

Query: 300 LVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQ 359
           LVVINPGNPTG+VLS EAIE+IF +AAKYGI+VIADEVYQEN+F   +FHSMKKVLRQLQ
Sbjct: 315 LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQ 374

Query: 360 KEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTG 419
            + PG+YDNVQL SLHSTSKGVSGECGQRGGYMEL GFTH+IRQVVLKLASISLCPVVTG
Sbjct: 375 MKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTG 434

Query: 420 QALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL 479
           QALVDLMVCPP+ G+ESYEQD++ER  IH+EL  RA LLHD F  L+GI CQKP+GAMYL
Sbjct: 435 QALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL 494

Query: 480 FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPG 539
           FP+++LPYKAIQ A H + +PDEFYC+ LLE TGICTVPGSGFGQEPGTYHLRTTFLAPG
Sbjct: 495 FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPG 554

Query: 540 TEWIKKWEDFHKKFYDQYRD 559
           T+WI+ W DFH++FY+++++
Sbjct: 555 TKWIEDWVDFHQEFYNKFKN 574

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/531 (69%), Positives = 442/531 (83%), Gaps = 5/531 (0%)

Query: 29  TITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHKKCHQDFYPAESLTVRDLNENVL 88
           ++   L+ R   G   +N    +ST  +   L  +   +      PA  L++ D+NENVL
Sbjct: 3   SVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQL---RFSTTVKPAPKLSLDDVNENVL 59

Query: 89  KAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQ 148
           KAKYAVRG IPMRAEEL++QLK+DPSSLPF KI++ANIGNPQQL+QKPL+FYR+VLS+LQ
Sbjct: 60  KAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQ 119

Query: 149 YPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITER 208
           +PE+LE+ +E L  + ++K D+I+RAKR+L +VGGSVGAYS SQGV GIR+TVADFIT+R
Sbjct: 120 HPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKR 177

Query: 209 DSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY 268
           D GE +YPEDI+LTAGASAAVSY+LSILC+G  TGVLIPIPQYPLYTA+LALNNS  LPY
Sbjct: 178 DDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPY 237

Query: 269 YLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKY 328
           YL EE  WST+  EIE VV ++I+ GI+P+ LVVINPGNPTG++LS ++I+KIF+VAAKY
Sbjct: 238 YLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKY 297

Query: 329 GIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQR 388
           GIVVIADEVYQEN+F GS+F+SMKKVLR LQK + G YDN+QL SLHSTSKGVSGECGQR
Sbjct: 298 GIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQR 357

Query: 389 GGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIH 448
           GGYMEL GF H+IRQV LKLASISLCPVVTGQALVDLMV PP+PGDESYEQD++ERE IH
Sbjct: 358 GGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIH 417

Query: 449 EELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKL 508
           + LD RA  L +TF+ LEGIEC+KP+GAMYL+P++ LPYK IQ AQHLE  PDEFYC+ L
Sbjct: 418 DALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKAL 477

Query: 509 LEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           LE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F+D+YRD
Sbjct: 478 LENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/493 (73%), Positives = 420/493 (85%)

Query: 66  KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNAN 125
           +K + +F PA  LT+ DLNENVLKAKYAVRG IP RAEEL+ QL   P+SLPFDKI+NAN
Sbjct: 46  RKHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINAN 105

Query: 126 IGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSV 185
           IGNPQQL Q+PLSFYRQVLS+LQYP +L   E +  S  V+K+DAI RAK+IL+D+GGSV
Sbjct: 106 IGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSV 165

Query: 186 GAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVL 245
           GAYS SQGVYGIR+TVA+FITERD GEPAYPEDIFLTAGASAAV+YLLSILC+G++TGVL
Sbjct: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225

Query: 246 IPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINP 305
           IPIPQYPLYTATLALNNSH LPY+LDE +GWS N  EIE V+ ++++  I+P VLVVINP
Sbjct: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGI 365
           GNPTG+VLS EAI  I ++AAKYGIVVIADEVYQENIF G +FHS+K VLR+LQ+E PG 
Sbjct: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345

Query: 366 YDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDL 425
           +DNVQL SLHSTSKGVSGECGQRGGYME+ GFTHE+RQV+LKLASISLCPVVTGQALVDL
Sbjct: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405

Query: 426 MVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKL 485
           MV PPK G+ES+  D+ +R+ IH +L  RA LL  TFNSL+GIECQKP GAMYLFP++ L
Sbjct: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465

Query: 486 PYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKK 545
           PY+AIQ AQ LE +PDEFYC++LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI  
Sbjct: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525

Query: 546 WEDFHKKFYDQYR 558
           W+ FH +F ++Y 
Sbjct: 526 WKQFHIEFMEKYN 538

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/490 (70%), Positives = 413/490 (84%), Gaps = 8/490 (1%)

Query: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNP 129
            + YPA+ L + DLN+NVLKAKYAVRGSIP+RAEEL+  L+     LPFD ++NANIGNP
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNP 89

Query: 130 QQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYS 189
           QQL QKPL+FYRQVLSILQYPE+LE G        +FK+DAIERA+++L+++G SVG+YS
Sbjct: 90  QQLKQKPLTFYRQVLSILQYPELLESGS------NIFKKDAIERARKLLKEIG-SVGSYS 142

Query: 190 SSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIP 249
           SSQG+  IRKTVA+FIT+RD GE + P DIFLTAGAS+AV YLLSILC+ +++GVLIPIP
Sbjct: 143 SSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIP 202

Query: 250 QYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPT 309
           QYPLYTATLALNN+H LPYYLDE  GWST+  EIE V+ +S++ GI+P+ LV+INPGNPT
Sbjct: 203 QYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPT 262

Query: 310 GSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNV 369
           GS+LSVE++EKI +VAA +GIV+IADEVYQEN+F  ++FHSMKKVLR LQK  PG YD V
Sbjct: 263 GSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTV 322

Query: 370 QLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCP 429
           QL SLHSTSKGVSGECGQRGGYMELTGF  EI+QV+LKL SISLCPVVTGQALVDLMV P
Sbjct: 323 QLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSP 382

Query: 430 PKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKA 489
           P+ GDESYEQD+ ER  I  +L +RA LL + FNS+EG+ CQKP GAMYLFP+I LP+K 
Sbjct: 383 PQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKV 442

Query: 490 IQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDF 549
           +Q +Q L+ TPDEFYC+ LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI +W  F
Sbjct: 443 LQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKF 502

Query: 550 HKKFYDQYRD 559
           H +FYD+YRD
Sbjct: 503 HAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/520 (69%), Positives = 427/520 (82%), Gaps = 10/520 (1%)

Query: 49  RARSTSSTAAGLHHIYHKKC---------HQDFYPAESLTVRDLNENVLKAKYAVRGSIP 99
           R+RST+ T      +  K+          H++F PA+ LT+ DLNENVLKAKYAVRG IP
Sbjct: 4   RSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIP 63

Query: 100 MRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEE 159
            RAE L++QL  +PSSLPF K++NANIGNPQQLNQKPL+FYRQVLS+LQYP VL++    
Sbjct: 64  ARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSG 123

Query: 160 LISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDI 219
             +K ++K+DAIERAKRIL D+G SVG+YSSSQGV+G+RKTVA++I+ RD GE AY EDI
Sbjct: 124 -NTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDI 182

Query: 220 FLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTN 279
           FLTAGAS+AVSYLL+ILC+G+E+GVLIPIPQYPLYTATLALNN++ LPYYL+E SGWSTN
Sbjct: 183 FLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTN 242

Query: 280 TAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
             EIE VV  +I   I P VLVVINPGNPTG++LSVE+IEKIF VAA +GIVVIADEVYQ
Sbjct: 243 MEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302

Query: 340 ENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTH 399
           ENIF G+EFHSMKKVLR LQ+  PG Y+NVQL SLHSTSKGVSGECGQRGGYMELTGF+ 
Sbjct: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFST 362

Query: 400 EIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLH 459
           EI+  +LKL SISLCPVVTGQALVDLM CPPK G+ SYEQD+ ER  IH EL  RA  L 
Sbjct: 363 EIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLW 422

Query: 460 DTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPG 519
             FN +EG+ CQKP+G+MYLFP+I +P+KA++ AQ L+ TPDE YC +LLEATGICTVPG
Sbjct: 423 KAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPG 482

Query: 520 SGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559
           SGFGQ+PGT+HLRTTFLAPGT WI +W +FH+ F ++YRD
Sbjct: 483 SGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/491 (68%), Positives = 412/491 (83%), Gaps = 1/491 (0%)

Query: 69  HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGN 128
           + DF PA  L+++D+NENV+ AK+A+RGSI ++AE+LQ QL ++P  LPFD+I  ANIGN
Sbjct: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67

Query: 129 PQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAY 188
           PQ+LNQKPL+F RQV+SILQYPE+L    + L  + +F  D+ +RA+R+LRD+GGSVGAY
Sbjct: 68  PQELNQKPLTFARQVVSILQYPELL-NNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 189 SSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248
           S+SQGVYGIRKT A++IT+RD GEP+YPEDIFLT GA++A SYLLS+LCRG +TGVLIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308
           PQYPLYTATLALN S ++PYYLDEES WSTNT EIE +V +SI+ GI+PSV+VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368
           TG+VLS  AI KIFQ+AAKYGIVV+ADEVYQENIF G +FHS KKVLR LQK++PG +DN
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428
           +QL S+HSTSKGV GECGQRGGYMEL GFT E+RQ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488
           PPK GD SYE D+KER+ I + +  RA  L+  F+ L+GIECQKP+GAMYL+P + L  K
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548
           AI  A+ L  TPDEFYC +LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KWE 
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 549 FHKKFYDQYRD 559
           FHK FY++Y+D
Sbjct: 487 FHKHFYEKYQD 497

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/489 (66%), Positives = 404/489 (82%)

Query: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130
           DF PA  +T +DLN +V KA+YAVRGSIP RA+EL+E+LK++P  LPFD I+NANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190
           QL+QKPL+F RQVLSIL+YPE+L+   E+L S  +F +DA++RA+ +L+D+GGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250
           SQGV GIR+TVADFIT RD GEPA PEDI+LT GAS+A + LLS+LC+   TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310
           YPLYTA+ +L N+ VLPYYLDEE  WST + EIE VV +++E GIRPSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370
           +VL+ E I +I  +AAKYGI VI+DEVYQEN+F   +FHSMKKVLR+LQ  +PG +DNVQ
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490
           +PGDESYEQDR+ER  I  E+  RA LL++TFN LEGIECQ P+GAMYLFP++ LP KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550
           + ++ L   PDEFYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W++FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 551 KKFYDQYRD 559
           + F+++YRD
Sbjct: 499 QSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/489 (66%), Positives = 399/489 (81%)

Query: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130
           DF PA  +T +DLN  V KA+YAVRG+IP RA+EL+E+LK++P  LPFD I+NANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190
           QL+QKPL+F RQVL+IL+YPE+L  G  EL S  +F RDA+ERA+R+L D+GGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250
           SQGV GIR+TVADFIT RD GEPA PEDI+LT GAS+A + LLS+LC+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310
           YPLYTA+ +L N+ VLPYYLDEES WSTN+ EIE VV ++++  IRPSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370
           +VLS E I +I  +AAKYGI +I+DEVYQENIF   +FHSMKKVLR+LQ  +PG +DNVQ
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430
           L SLHS SKG   ECGQRGGYME+ GF+ EIR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490
           +PGDESYEQD  ER  I  E+  RA LL++TF  LEGIECQKP+GAMYLFP++ LP KA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550
             ++ L   PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ W++FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 551 KKFYDQYRD 559
           + F+ +YR+
Sbjct: 499 QDFFSKYRN 507

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 397/481 (82%), Gaps = 2/481 (0%)

Query: 79  TVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLS 138
           T+RD+N+ VL AKYAVRG IP+RAEEL+ +L  +P SLPF+KI+NANIGNPQQL+QKPL+
Sbjct: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 139 FYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIR 198
           FYRQVLS+LQ P ++E      + K +FK DA+ERAK++L+ VGGSVGAYS+SQGV G R
Sbjct: 101 FYRQVLSLLQNPALIESLPTGELHK-LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159

Query: 199 KTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATL 258
           ++VA+FI ERD GEPA   DIFLTAGAS+AVS +LS+ C G E G LIPIPQYPLYTATL
Sbjct: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218

Query: 259 ALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAI 318
           ALN++H LPYYLDE SGWS +T ++E VV ++I  G+RP+ LVVINPGNPTG++LS EAI
Sbjct: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278

Query: 319 EKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTS 378
           EKI  VAAKY +VVIADEVYQEN F  ++F SMKKVLR LQK  PG YDNVQL SLHSTS
Sbjct: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338

Query: 379 KGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYE 438
           KGVSGECGQRGGYMEL GF+ E++QV LKLASISLCPVVTGQALVDLMV PPK GD SYE
Sbjct: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398

Query: 439 QDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEK 498
            DR+ER  IH  L  ++ LL++TF SLEG+ CQKP+GAMYLFP++ L  KAI+ A+ L  
Sbjct: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458

Query: 499 TPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYR 558
            PDE+YC++LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW+  W+ FH+KF D++R
Sbjct: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

Query: 559 D 559
           D
Sbjct: 519 D 519

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/489 (67%), Positives = 399/489 (81%), Gaps = 2/489 (0%)

Query: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131
           F PA  L   DLN+N++ A+YAVRG+IPM+AEEL+ QL + P  LPF+ I  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 132 LNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSS 191
           L+QKPL+F RQV+SILQYP +L+  EE+L++ G +KRDA +RA  +L  +GGSVGAYS +
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152

Query: 192 QGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQY 251
           QGVYGIR++VADFIT RD GE A P+DIFLT GAS A +YLLSILCR   TG++IPIPQY
Sbjct: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212

Query: 252 PLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGS 311
           PLYTA++ + NS +LPYYLDEESGWST   EIE  V +SI+ G+ P V+VVINPGNPTG+
Sbjct: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272

Query: 312 VLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHP-GIYDNVQ 370
           VLS + I +I  +AAKYGIVV+ADEVYQ NI+ G +FHSMKKVLR LQ++HP G YDNVQ
Sbjct: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332

Query: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430
           L S+HSTSKGVSGECGQRGGYMEL GF++E+RQV+LKLASIS+C VVTGQALVDLM+ PP
Sbjct: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490
           + GD+SYE D +ER+ IH  +  R  LL+DTF  LEGIECQ+P+GAMYLFP++ L  KAI
Sbjct: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452

Query: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550
           + A+ L   PDEFYC +LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WIK WE FH
Sbjct: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512

Query: 551 KKFYDQYRD 559
           K FYD+YRD
Sbjct: 513 KAFYDKYRD 521

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/489 (65%), Positives = 401/489 (82%)

Query: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130
           DF PA  LT +DLN +V KA+YAVRG+IP RAEEL+E+LKR  +SLPF+ I+NANIGNPQ
Sbjct: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78

Query: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190
           QL+QKPL+F RQVLSIL+YPE+L    ++L S  +F +DA++RA+R+L D+GGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138

Query: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250
           SQGV GIR+TVADFITERD GEPA PEDI+LT GAS+A + LLS+LC+  +TG+L+PIPQ
Sbjct: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQ 198

Query: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310
           YPLYTA+ +L N+ VLPYYLDEE+ WST + EIE VV ++++ GIRPSVLVVINPGNPTG
Sbjct: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258

Query: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370
           +VL+   I KI  +AAKYGI +I+DEVYQENIF   +FHSMKK+LR+LQ  HPG +DNVQ
Sbjct: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318

Query: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C V TGQA++DLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490
           +PGDESY+QDRKER  I+ E+  RA LL++TFN LEGI+CQKP+GAMYLFP++ LP KA+
Sbjct: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438

Query: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550
           + ++ L   PD  YC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W  FH
Sbjct: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498

Query: 551 KKFYDQYRD 559
           + F+++YRD
Sbjct: 499 QDFFNKYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/489 (65%), Positives = 404/489 (82%)

Query: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130
           +F PA  +T +DLN  V KA+YAVRG+IP RA+EL+E+LKR P  LPFD I+NANIGNPQ
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190
           QL+QKPL+F RQVLSIL+YPE+L  G ++L S  +F++DA+ RA+ +L D+GGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138

Query: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250
           SQGV GIR++VA+FIT+RD GEPA PE+I+LT GAS+A + LLS+LC+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQ 198

Query: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310
           YPLYTA+ +L N+ VLPYYLDE S WST + EIE VV +++E GI+PSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258

Query: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370
           +VLS + I KI  +AAKYGI +I+DEVYQEN+F G +FHSMKKVLR+LQ+ +PG +DNVQ
Sbjct: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318

Query: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490
           +PGDESY+QD  ER  I  E+  RA LLH+TFN LEGIECQKP+GAMYLFP++ LP KA+
Sbjct: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438

Query: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550
           + ++ L   PDEFYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W+ FH
Sbjct: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498

Query: 551 KKFYDQYRD 559
           + F+++YRD
Sbjct: 499 QDFFNKYRD 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/506 (66%), Positives = 407/506 (80%), Gaps = 9/506 (1%)

Query: 55  STAAGLHHIYHKKCHQDFYPAESL-TVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDP 113
           ST  GL   Y +K      P  S  T++D+NE VL AKYAVRG IP+RAEEL+++L  +P
Sbjct: 21  STRPGLRKDYSQK------PLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74

Query: 114 SSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIER 173
            SLPFDKI+NANIGNPQQL+QKPL+FYRQVL++LQ P+++       + K  FK DA+ER
Sbjct: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHK-FFKPDAVER 133

Query: 174 AKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLL 233
           AK++L+ VGGSVGAYS+SQGV G R++VA+FI ERD GEPA  +DIFLT GAS AVSY+L
Sbjct: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192

Query: 234 SILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIES 293
           S+ C G E G LIPIPQYPLYTA+LALNNSH LPYYLDEESGWS +T +IE VV +SI+ 
Sbjct: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252

Query: 294 GIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKK 353
           GIRP+ LVVINPGNPTG++L+ + IE + +VAAKY +V+IADEVYQEN F  +EF SMKK
Sbjct: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312

Query: 354 VLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISL 413
           VLR LQK  PG YDNVQL SLHSTSKGVSGECGQRGGYMEL GF+ E++QV LKLASISL
Sbjct: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372

Query: 414 CPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKP 473
           CPVVTGQAL+DLMV PPK GD SYEQDR+ER  IH+ L  R+GLL+  F S+EG+ CQ+P
Sbjct: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432

Query: 474 RGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRT 533
           +GAMYLFP+++L  KAI  A+     PDE+YC++LLEATGICTVPGSGFGQ PGT+HLRT
Sbjct: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492

Query: 534 TFLAPGTEWIKKWEDFHKKFYDQYRD 559
           TFLAPGTEWI  W+ FH+KF + +RD
Sbjct: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/486 (67%), Positives = 400/486 (82%), Gaps = 2/486 (0%)

Query: 73  YPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQL 132
           Y AE L   DLN NV+KAKYAVRG+IP  A++L+ QL + P +LPF+ ++N+NIGNPQQL
Sbjct: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138

Query: 133 NQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQ 192
            QKPLSF RQVLSIL+YP +L+  E  L+    +  D+IERAK +L D+G S+GAYS+SQ
Sbjct: 139 GQKPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQ 196

Query: 193 GVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYP 252
           GV+GIR+TVADFIT RD GE AYP+DIFLTAGAS+AVS +LSILC+GQ+TGVLIPIPQYP
Sbjct: 197 GVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYP 256

Query: 253 LYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSV 312
           LYTATL LN++  LPYYLDE +GWST+  EI  V  +S+E+GI+P+ LVVINPGNPTGSV
Sbjct: 257 LYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSV 316

Query: 313 LSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLV 372
           L+VEAI+ +F VAAKYG+VVIADEVYQ+NIF GSEFHSMKK+LR LQKE P  YDN+QL 
Sbjct: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376

Query: 373 SLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKP 432
           SLHS SKG+ GECG RGGY E  GFT E++QV+ KL+SISLC  V GQALVDLM CPPK 
Sbjct: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436

Query: 433 GDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQA 492
           G+ SYE D+ ER+ I      R+  L++ FNSLEG+ CQKP+GAMY+FP I+LP+ AI+ 
Sbjct: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496

Query: 493 AQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKK 552
           AQ+L+ TPDEFYC++LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+K+WE FH +
Sbjct: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556

Query: 553 FYDQYR 558
           F+++YR
Sbjct: 557 FFEKYR 562

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/491 (68%), Positives = 400/491 (81%), Gaps = 4/491 (0%)

Query: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQ-EQLKRDPS-SLPFDKIVNANIG 127
            +F PA+ +T+ DLN+NVLK++YAVRGSIP RAEEL+ E L  D S SL F+ IV+ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 128 NPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGA 187
           NPQQL+QKPL+F RQV+SILQYPE+L Q    L+S G+FK DA+ERA+ +L  +GGSVGA
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGA 144

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           YSSSQGVYGIR+TVA++IT RD+GE A P+DIFLT GAS A SYLLS+LC+ + TGVLIP
Sbjct: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIP 204

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307
           IPQYPLYTAT+ L ++ +LPYYL+EESGWSTNT EIE VV ++I   ++PSV+VVINPGN
Sbjct: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGN 264

Query: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYD 367
           PTGSVLS + I  I  + AKYGIV+IADEVYQENIF G EFHSMKKVLR LQK++PG YD
Sbjct: 265 PTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYD 323

Query: 368 NVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMV 427
            VQL SLHSTSKGVSGECGQRGGYMEL GF  EIRQ +LKLASISLC V+TGQALVDLMV
Sbjct: 324 AVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMV 383

Query: 428 CPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPY 487
            PPK GDESYE D  ER+ IHE L  RA  L++ F  L+G+ECQKP+GAMYLFP++  P 
Sbjct: 384 NPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQ 443

Query: 488 KAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 547
             I  A +   +PDEFYC  LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+
Sbjct: 444 TLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWK 503

Query: 548 DFHKKFYDQYR 558
            FH++F+ +Y+
Sbjct: 504 LFHEEFFSKYQ 514

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/501 (64%), Positives = 394/501 (78%), Gaps = 3/501 (0%)

Query: 59  GLHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPF 118
           GL  I        F P + L + DLN NVL+AKYAVRG IP RA EL+ QL RDP SLPF
Sbjct: 37  GLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPF 96

Query: 119 DKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRIL 178
            KI+ ANIGNPQQL QKPLSF R+VLS+L+ P +L+   E L    ++K DA+ RAKR++
Sbjct: 97  KKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKRMM 154

Query: 179 RDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCR 238
           RD+  S+GAYS SQGV G RKTVA++++ RD GEPA  EDIFLT GAS   S ++ +LC+
Sbjct: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCK 213

Query: 239 GQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPS 298
           GQE+GVLIPIPQYPLYTAT+ LNN+  LPYYLDEESGWS N  ++E ++ ESIE G++P+
Sbjct: 214 GQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPA 273

Query: 299 VLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQL 358
            LVVINPGNPTG++L VE++E+IF +AAKY IVVIADEVYQEN+F G +F+SMKKVLR L
Sbjct: 274 CLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSL 333

Query: 359 QKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVT 418
           Q+ +  ++ NVQLVSLHSTSKG+SGECGQRGGYMEL GF+ +IR+V+LK+ASI LC  V 
Sbjct: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG 393

Query: 419 GQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMY 478
           GQALVDLM+  PKPGDESYE+D  ER  I   L  R+  L +TFN+LEG+EC+KP+G+MY
Sbjct: 394 GQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMY 453

Query: 479 LFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAP 538
           LFP++ LP KAI+AA+ L+  PDEFYC +LL +TGICTVPGSGFGQ P T HLRTTFL P
Sbjct: 454 LFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCP 513

Query: 539 GTEWIKKWEDFHKKFYDQYRD 559
           GTEWI+ WE FHK FYD+YRD
Sbjct: 514 GTEWIESWELFHKSFYDKYRD 534

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 392/489 (80%), Gaps = 3/489 (0%)

Query: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131
           F PAE L+V DLN++ + A YAVRGSIPMRAE+L  Q+  DP SLPFDKI+ ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 132 LNQKPLSFYRQVLSILQYPEVLEQGE--EELISKGVFKRDAIERAKRILRDVGGSVGAYS 189
           + QKPL+F RQVLSIL+YP +L   E  E+L+  GV++RD IERA+++L  +GGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 190 SSQGVYGIRKTVADFITERDS-GEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248
           +SQGV G R+TVADFI +RD   + A P DIFLT GAS+AV YLLSILC G E GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308
           PQYPLYTATL L+NS  +PYYL E + WSTNT EIE  + ES+ +G++P  +V+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368
           TG++LS   +  I +++AKYGI +IADEVYQENIF G EFHSM+KVL  LQ E PG YDN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428
           VQL SLHSTSKG  GECGQRGGYMEL GF  E+  +VLKLASIS+C VVTGQAL+DL+ C
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488
           PP+PGD SY+ D++ER  I ++L  RA  L+  F SLEG+ECQ+P+GAMYLFP++ LP K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548
           AI+ A  LE  PDE+YC++LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWI++W +
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 549 FHKKFYDQY 557
           FH++FY+++
Sbjct: 483 FHQQFYERF 491

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/491 (65%), Positives = 404/491 (82%), Gaps = 4/491 (0%)

Query: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQL--KRDPSSLPFDKIVNANIG 127
            DF PA  ++V DLN+ ++ A+YAVRGSI MRAEEL+ +L  K  P S PF++I+ ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 128 NPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGA 187
           NPQQL+QKPL+F RQV+SIL+YP +L + ++ L+S+G++K+DA+ERA+ +   +G SVGA
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGA 140

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           YS +QGVYGIR+T A FI++RD+ E A  +DIFLT GAS AV+YL+  LC+ + TG+LIP
Sbjct: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307
           IPQYPLYTA++ ++N+ +LPYYLDEESGWST   EIE  V  +IE+GI+PS +VVINPGN
Sbjct: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260

Query: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYD 367
           PTG+VLSV+ I++I  VAAKYGIV+IADEVYQ+NIF G EFHSMKK+LRQLQK++PG YD
Sbjct: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319

Query: 368 NVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMV 427
           NVQL SLHSTSKGVSGECGQRGGYME+ GF+ E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379

Query: 428 CPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPY 487
            PP  GDESYE+D++ER  IH  L  RA  L+DTF++LEGIECQKP+GAMYLFP++ LP 
Sbjct: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439

Query: 488 KAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 547
           +AI+ A+ L+   DEFYC KLLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI  W+
Sbjct: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499

Query: 548 DFHKKFYDQYR 558
            FH+KF  +Y+
Sbjct: 500 KFHEKFMKEYQ 510

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 399/491 (81%), Gaps = 4/491 (0%)

Query: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNP 129
            DF PA  L+++DLN NV+KA++AVRG+IPM+A+ELQ QL ++P SLPF++I  ANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 130 QQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKG--VFKRDAIERAKRILRDVGGSVGA 187
           Q+L+QKPL+F RQV+SILQYPE+L +   EL S    ++  D+ +RA+++L ++GGSVGA
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNR-RNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGA 129

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           YS+SQGVYGIRKT+A++IT+RD GE A P DIF+T GA+AA SYLLSIL  G +TGVL+P
Sbjct: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTE-SIESGIRPSVLVVINPG 306
           IPQYPLYTA LAL+N+ +LPYYL+EESGWS +T EIE  + + ++  GI+P V+V+INPG
Sbjct: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIY 366
           NPTGS+LS +++ KIF +AAKYGIV+IADEVYQEN+F G++FHS KKVLR LQK+ P  Y
Sbjct: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQY 309

Query: 367 DNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLM 426
           +NVQL SLHSTSKG+ GECGQRGGYME+ GF +++R ++LKLA I +CPVVTGQA++DLM
Sbjct: 310 NNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLM 369

Query: 427 VCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLP 486
           + PPK GD+SY+ D  ER+ IH ++ +RA  L+D F+ +EGI+CQKP+GAMYLFP++ L 
Sbjct: 370 ILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLS 429

Query: 487 YKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKW 546
            K I  A+  E  PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KW
Sbjct: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKW 489

Query: 547 EDFHKKFYDQY 557
           E FHK F  +Y
Sbjct: 490 EKFHKAFLKRY 500

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/544 (61%), Positives = 407/544 (74%), Gaps = 24/544 (4%)

Query: 16  SVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHKKCHQDFYPA 75
           ++G++ R S+   T  + LQGR         + R R  SS   G            F PA
Sbjct: 2   AIGMLRRNSS--GTAVSVLQGR---------VLRTRRLSSVKDG----------SRFVPA 40

Query: 76  ESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQK 135
           E +T+ D+NENV+KAKYAVRG IP RAEEL+ +L+  P SLPF KI+ ANIGNPQQL QK
Sbjct: 41  EPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQK 100

Query: 136 PLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVY 195
           PL+FYRQV+S++Q P++LE   E L  +  FK D + RA+R+L+D GGSVGAYS+SQGV 
Sbjct: 101 PLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQGVK 158

Query: 196 GIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYT 255
           G R+TVA FI  RD G PA P++++LTAGAS+AVS LLS  C+G ETGVLIPIPQYPLYT
Sbjct: 159 GYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT 217

Query: 256 ATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSV 315
           AT+  NN+  LPYYL+E  GWSTN  E+E V+ +S +  I P  LVVINPGNPTGSVLSV
Sbjct: 218 ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSV 277

Query: 316 EAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLH 375
           + +E I  +AAKYGIVVIADEVYQ+N+F  ++FHSM+KVL+ LQ   P +Y NVQL SLH
Sbjct: 278 KDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLH 337

Query: 376 STSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDE 435
           S SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP  GD 
Sbjct: 338 SISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDP 397

Query: 436 SYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQH 495
           SYEQ  +E   I+ EL+ R+ LL  TF SLEGIEC  P+GA+YLFP++ LP KAI+AAQ 
Sbjct: 398 SYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQK 457

Query: 496 LEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYD 555
           L    DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WI+ W+DFHKKFYD
Sbjct: 458 LGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYD 517

Query: 556 QYRD 559
           +YRD
Sbjct: 518 KYRD 521

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/490 (61%), Positives = 385/490 (78%), Gaps = 2/490 (0%)

Query: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130
           DF P   +T++DLN  ++K +YAVRG IP RAEEL+ QL++DP SLPF+KI+NANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 131 QLNQKPLSFYRQVLSILQYPEVLEQGE--EELISKGVFKRDAIERAKRILRDVGGSVGAY 188
           QL QKPLSF R+VLSILQYP++LE     + LI   V+++D + RA+++L ++GGSVGAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 189 SSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248
           S SQGV GI++TVAD+IT+RDSGE AYPEDIFLT GAS+AVS++L + C G  TGVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308
           PQYPLYTAT+ L  +  + YYL+EE  WS NT E+E  + ESI+SGI+P+ +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368
           TGS+L+ + I  I +++AKYG+++IADEVYQEN+F+G+EFHS+KKVLR+LQ+++ G Y+ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428
           VQL SLHSTSKG+ GECGQRGGYMEL G T ++R  V+KL SIS+C VVTGQAL+D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488
           PP+PGDESYE D+ ER  I  +L  R+  LH  F SLEG+EC +P+GAMYLFP+   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548
            I  AQ L    D  YC++LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 549 FHKKFYDQYR 558
           FH +F ++YR
Sbjct: 488 FHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/497 (58%), Positives = 380/497 (76%), Gaps = 8/497 (1%)

Query: 69  HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGN 128
            + F PA   ++ D+NE++LKA+YA+RG+IP RAEEL  QL  +  SLPF KIV ANIGN
Sbjct: 5   QKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGN 64

Query: 129 PQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAY 188
           PQQL+Q+PL+F RQV+S++Q+P++L + ++ L+++ ++ +D+IERA ++L  +GGSVGAY
Sbjct: 65  PQQLDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAY 123

Query: 189 SSSQGVYGIRKTVADFITERD-SGEPA------YPEDIFLTAGASAAVSYLLSILCRGQE 241
           SSSQGV  IRK VA FI +RD   +P          ++FLTAGAS AV ++L +  + + 
Sbjct: 124 SSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDES 183

Query: 242 TGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLV 301
            GVL+PIPQYPLYTA + L  S +LPYYL+E + WST+  +IE +V ++I+  I+P+ LV
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243

Query: 302 VINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKE 361
           VINPGNPTG++L+ ++I  I  +AA+YGIV+IADEVYQEN++   EFHS KKVL +L+K 
Sbjct: 244 VINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303

Query: 362 HPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQA 421
           +P  YDNVQL SLHS SKGV+GECGQRGGYME+TGF++++++V+LK+ASIS+C VVTGQ 
Sbjct: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363

Query: 422 LVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFP 481
           LVDLMV PP+PGDESYE D+ ER +IH  L  ++  L+D F  L GI CQKP+GAMYLFP
Sbjct: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423

Query: 482 QIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTE 541
           ++ L   AI AA  L   PDEFYC KLLE TGICTVPGSGFGQ PGTYHLRTTFL PG E
Sbjct: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483

Query: 542 WIKKWEDFHKKFYDQYR 558
           WI  WE FH +F ++Y+
Sbjct: 484 WINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/498 (55%), Positives = 364/498 (73%), Gaps = 10/498 (2%)

Query: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNP 129
           +D  PA   ++ D+++++L  +YA+RG+IP RA+ELQEQL   P+ LPF KI+ ANIGNP
Sbjct: 4   KDCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNP 63

Query: 130 QQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYS 189
           QQL Q+PL+F RQVLS+++YP ++   +  L+   ++  DAI+RA+ IL  +GGSVGAYS
Sbjct: 64  QQLEQEPLTFQRQVLSLVEYPNLV-NSKNILVENKIYAPDAIKRAETILNSIGGSVGAYS 122

Query: 190 SSQGVYGIRKTVADFITERDSGEPAYPE---------DIFLTAGASAAVSYLLSILCRGQ 240
           SSQG+  IRK VA  I +RD+ E    +         +IFLT GA+ AVSY+L +  + +
Sbjct: 123 SSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDE 182

Query: 241 ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300
             GVL+PIPQYPLYTA + L NS +LPYYL+E+  WST+  EIE ++ ++I   I+P+ L
Sbjct: 183 NCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTL 242

Query: 301 VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK 360
           V+INPGNPTG++LSVE+I +I  +AAKYGIV+IADEVYQ NI+   +FHS KK+L  L+ 
Sbjct: 243 VIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKL 302

Query: 361 EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ 420
           ++P  YDNVQL SLHS SKGV+GECGQRGGY EL GF+ EI++++LKLASI +C VVTGQ
Sbjct: 303 QYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQ 362

Query: 421 ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480
            LVDLM  PP+ GD SY+ D++ER  I   L  ++  L+D F+ L GI CQKP+GAMYLF
Sbjct: 363 ILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLF 422

Query: 481 PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 540
           P++ L    I  A+     PDEFYC KLLE TGICTVPGSGFGQ+ GTYH+RTTFL  G 
Sbjct: 423 PRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGI 482

Query: 541 EWIKKWEDFHKKFYDQYR 558
           EWIK WE FH +F +QY+
Sbjct: 483 EWIKLWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 15/166 (9%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           Y + QG + +RK +A+  +  D       E++ LT GA AA ++L      G+    +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDV--TLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307
            P Y   ++   +  + V   +L +E+ +  N  E+E ++  + +       +V+  P N
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK------CIVLNTPNN 165

Query: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKK 353
           P  SV+  E + +I ++A K+GIVV  DEVY         FHS +K
Sbjct: 166 PLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 88/180 (48%), Gaps = 31/180 (17%)

Query: 185 VGAYSSSQGVYGIRKTVADFITERDSGEPAY-----PEDIFLTAGASAAV-SYLLSILCR 238
           V  YS ++G   + K++ D  +      P Y     PE++ +T GA+  + + L+ IL +
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYS------PLYKLTLKPENVLVTTGANEGILACLMGILNQ 137

Query: 239 GQETGVLIPIPQYPLYTATLALNNSHVL------PYYLDEE----SGWSTNTAEIEGVVT 288
             E  V++  P +  Y   + L    V+      P  LD+     + W+ +  + E V+T
Sbjct: 138 NDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVIT 195

Query: 289 ESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEF 348
              ++      +++  P NP G V + E +++I  +  K+ +++I+DEVY +N++   EF
Sbjct: 196 NKTKA------IIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVY-DNLYFVDEF 248

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 85/173 (49%), Gaps = 15/173 (8%)

Query: 212 EPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY-YL 270
           EP   +++ L  G+   +  L+   CR +   +L   P Y +Y+    +N+  ++    +
Sbjct: 80  EPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLI 139

Query: 271 DEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGI 330
            E++ +  N  E    V  ++++  +  +L + +PGNPTG +++ + IE I +     G+
Sbjct: 140 TEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWTN-GL 194

Query: 331 VVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           VV+ DE Y +   A    +SM K++ +        Y N+ ++   S S G++G
Sbjct: 195 VVV-DEAYIDFADAEGTTYSMAKLVTK--------YPNLTVLQTLSKSFGLAG 238

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDE 272
           P   ++I L  G+  ++  ++   C  +E  V++  P Y +Y     +N+      Y++ 
Sbjct: 84  PLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEV 139

Query: 273 ESGWSTNTAEI-EGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
               S N+ +I E  + E +       V+ + +PGNPTG+ + V  +EK+ +     GIV
Sbjct: 140 PLISSDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR-NWTAGIV 198

Query: 332 VIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGY 391
           V+ DE Y        +F + K  L  L  +HP       LV L + SK  SG  G R G+
Sbjct: 199 VV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY-YLD 271
           P   +++ L  G+  ++  L+   C   +  +LI  P Y +Y+    +N+  ++    + 
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
           E++ +  NT +    V E+++      +  V +PGNPTG+++ + +IEKI     + GIV
Sbjct: 144 EDNSFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIV 198

Query: 332 VIADEVY 338
            I DE Y
Sbjct: 199 AI-DEAY 204

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 84/174 (48%), Gaps = 17/174 (9%)

Query: 212 EPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSH--VLPYY 269
           +P   +++ L  G+  ++  L+   C   +  +LI    Y +YT    +N+     +P  
Sbjct: 83  KPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLL 142

Query: 270 LDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYG 329
           L EE  +  +    E  + E++++     ++ + +PGNPTG+ + V  IEKI     + G
Sbjct: 143 LSEEDKFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTG 197

Query: 330 IVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           +VV+ DE Y +    GS+  S+  +  +        Y+N+ ++   S S G++G
Sbjct: 198 LVVV-DEAYID-FVEGSDKGSLAPLATK--------YENIAVLQTLSKSFGLAG 241

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 136/323 (42%), Gaps = 33/323 (10%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLAL--NNSHVLPYYLDEESG 275
           D+  T G + A   +L I C   +T   I   Q+   ++  A      +V P  LDE   
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQFAFSSSISAAEAQGVNVFPIPLDEHG- 189

Query: 276 WSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
                +++E ++    E   +P +L  +  G NPTGS LS +  E+I+++A K+  ++I 
Sbjct: 190 --IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIE 247

Query: 335 DEVYQENIFAGSE----------FHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGE 384
           DE Y        E          +   K+ ++ L+K    I    +++ L S SK ++  
Sbjct: 248 DEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA-- 305

Query: 385 CGQRGGYMELTGFTHEIRQVVLKLASISL-CPVVTGQALVDLMVCPPKPGDESY-EQDRK 442
            G R G+  + G   +I   +L L  +++  P    Q+++   +   + G E Y +    
Sbjct: 306 PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGYLDWLIG 360

Query: 443 EREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQI---KLPYKAIQAAQHLEKT 499
            R    ++ D     L+     ++ I+   P   M+    I   K P  A +     EK 
Sbjct: 361 LRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDPEKV 420

Query: 500 PDEFYCQKLLEATGICTVPGSGF 522
               + + +  A+G+  VPG+ F
Sbjct: 421 EKAIFDRSI--ASGVLVVPGNWF 441

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 7/132 (5%)

Query: 208 RDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLP 267
           +D  +P   E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  ++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 268 YYL-DEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAA 326
             L   ++ +  NT E+  + T   +  I+  ++ + +PGNPTG+ +    IEKI Q   
Sbjct: 138 CPLITSDNSFQANTDEV--IKTAQNDPSIK--LIFITSPGNPTGAKVETSRIEKILQNWD 193

Query: 327 KYGIVVIADEVY 338
           + G+VV+ DE Y
Sbjct: 194 R-GMVVV-DEAY 203

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 131/327 (40%), Gaps = 57/327 (17%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PYY 269
           E++ +T GA+  + S L+ +L  G E  V++  P +  Y + + L    ++      P  
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 270 LD----EESGWSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQV 324
           LD    E + W+ +  + +  +T   ++       V+IN P NP G V + E + +I  +
Sbjct: 175 LDQRVTEGTEWTVDMEQFKNAITSKTKA-------VIINTPHNPIGKVFTREELLQIGNI 227

Query: 325 AAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGE 384
             +  +++I+DEVY E+++   EF  +  +  ++           QL     ++      
Sbjct: 228 CVEKNVIIISDEVY-EHLYFTDEFTRIATLSPEIG----------QLTLTVGSAGKTFAA 276

Query: 385 CGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKER 444
            G R G++       E+ Q V K A   +C               P P  E+      + 
Sbjct: 277 TGWRIGWV--ISLNSELLQYVSK-AHTRIC------------FASPSPLQEACANSINDA 321

Query: 445 ------EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQH 495
                 E + +E   +  +    F  L G+   KP G  ++   F ++K+P       + 
Sbjct: 322 LESNYFEKMRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEI 380

Query: 496 LEKTPDEFYCQKLLEATGICTVPGSGF 522
           L K  D      L+   G+  +P + F
Sbjct: 381 LNKGKDFRISHWLINELGVVAIPPTEF 407

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 130/329 (39%), Gaps = 61/329 (18%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PYY 269
           E++ +T GA+  + S L+ IL  G E  V++  P +  Y   + L    V+      P  
Sbjct: 115 ENVTVTTGANEGILSCLMGILNPGDE--VIVFEPFFDQYIPNIELLGGKVVYVPINPPKD 172

Query: 270 LDEE----SGWSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQV 324
           +D+     + W+ +  +    +T+  ++       V+IN P NP G V + E + +I ++
Sbjct: 173 MDQRVVKGTEWTVDYEQFANAITDKTKA-------VIINTPHNPIGKVFTREELTRIGEI 225

Query: 325 AAKYGIVVIADEVYQENIFAGS--EFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS 382
             K  +V+I+DEVY+   F  S     ++   + QL             +S+ S  K  +
Sbjct: 226 CVKKNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLT------------LSVGSAGKSFA 273

Query: 383 GECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRK 442
              G R G++       E+   V K A   +C               P P  E+      
Sbjct: 274 A-TGWRVGWV--VSLNPELLSYVSK-AHTRIC------------FASPSPLQEAVANSIN 317

Query: 443 ER------EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAA 493
           +       E + +E  H+  +    F  L G+   +P G  ++   F ++K+P       
Sbjct: 318 DALEINYFENMRQEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPE 376

Query: 494 QHLEKTPDEFYCQKLLEATGICTVPGSGF 522
           +   K  D      L+   G+  +P + F
Sbjct: 377 EIANKAKDFRIAYWLINELGVVAIPPTEF 405

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 85/368 (23%), Positives = 155/368 (42%), Gaps = 48/368 (13%)

Query: 170 AIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAV 229
           AI  AK  L DV   V  YS ++G   + K++ + + +   G+    +++ +T GA+  +
Sbjct: 61  AINAAKSAL-DVP-LVNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGI 117

Query: 230 -SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDEESGWSTNTAEIEGV 286
            S L+ IL  G E  V++  P +  Y   + L    V  +P +  +E      T +   +
Sbjct: 118 LSCLMGILNAGDE--VIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQI 175

Query: 287 VTESIESGI--RPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFA 344
             +++E     +   +++  P NP G V + + + K+ Q+  ++  VVI+DEVY E+++ 
Sbjct: 176 DWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLYF 234

Query: 345 GSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-GECGQRGGYMELTGFTHEIRQ 403
              F  +             I +++  ++L   S G S    G R G+  +     ++  
Sbjct: 235 TESFPRIA-----------NINEDIANLTLTVGSAGKSFAATGWRIGW--IISKNDQLLN 281

Query: 404 VVLKLASISLCPVVTGQALVDLMVCPPKPGDE----SYEQDRKEREM--IHEELDHRAGL 457
            V K A   +C               P P  E    S E   K      + EE   +  +
Sbjct: 282 YVSK-AHTRIC------------FASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEI 328

Query: 458 LHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGI 514
           L   F+ L G+   +P G  ++   F ++K+P   +   + LEK  D      L+   GI
Sbjct: 329 LTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGI 387

Query: 515 CTVPGSGF 522
             +P + F
Sbjct: 388 VAIPPTEF 395

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 128/328 (39%), Gaps = 57/328 (17%)

Query: 216 PEDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PY 268
           PE++ +T GA+  + S L+ I+  G E  V  P   +  Y   + L    V+      P 
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDEVIVFEPF--FDQYIPNIELCGGKVVYVPINPPK 172

Query: 269 YLDEE----SGWSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQ 323
            LD      + W+ +  E    +T   ++       V+IN P NP G V + E + K+  
Sbjct: 173 ELDNRVTKGTEWTVDFDEFTRAITPKTKA-------VIINTPHNPIGKVFTREELTKLGN 225

Query: 324 VAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           +  +  +++IADEVY+   F                 E P I    + +   + S G +G
Sbjct: 226 ICVENNVIIIADEVYEHLYFVD---------------EFPRIATLSEEIGQLTLSVGSAG 270

Query: 384 ECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDE--SYEQDR 441
           +     G+    G+       +L+ AS         +A   +    P P  E  SY  D 
Sbjct: 271 KSFAATGWR--IGWVVSQNPDLLQYAS---------KAHTRICFASPSPIQEACSYSIDH 319

Query: 442 KER----EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQ 494
             +    E + +E   +  +    F+ L G+    P G+ ++   F ++K+P       +
Sbjct: 320 ALKIDYFENMRQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEE 378

Query: 495 HLEKTPDEFYCQKLLEATGICTVPGSGF 522
            + K  D      L+   G+  +P + F
Sbjct: 379 IMSKGKDFRISNWLINELGVVAIPPTEF 406

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 128/326 (39%), Gaps = 55/326 (16%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PYY 269
           E+I +T GA+  + S L+ +L  G E  V++  P +  Y + + L    V+      P  
Sbjct: 120 ENITITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKD 177

Query: 270 LD----EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVA 325
           LD    E + W+ +  +    +T       +   ++V +P NP G V + E + K+ ++ 
Sbjct: 178 LDQRITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEIC 231

Query: 326 AKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGEC 385
            +  +++I+DEVY        EF        ++    P I    QL     ++       
Sbjct: 232 VENNVIIISDEVY--------EFLYFNDSFTRIATLSPEI---GQLTLTVGSAGKTFAAT 280

Query: 386 GQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKER- 444
           G R G++       E+ Q V K A   +C               P P  E+      +  
Sbjct: 281 GWRIGWV--ISQNPELLQYVSK-AHTRIC------------FASPSPLQEACANSINDAL 325

Query: 445 -----EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHL 496
                E + +E   +  + +  F  L G+   KP G  ++   F ++K+P       + L
Sbjct: 326 ESGYFEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEIL 384

Query: 497 EKTPDEFYCQKLLEATGICTVPGSGF 522
           +K  D      L+   G+  +P + F
Sbjct: 385 DKGKDFRISHWLINELGVVAIPPTEF 410

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 138/327 (42%), Gaps = 55/327 (16%)

Query: 216 PEDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDE 272
           P ++ +T GA+ A+ S L+ +L +G E  V++  P +  Y + + +    V  +P +  +
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 273 E--------SGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQV 324
           E        + W+ +  E+   +T   ++      L++  P NP G V + E + +I  +
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITPKTKA------LILNTPHNPIGKVFTREELLEIGNI 229

Query: 325 AAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGE 384
             +  +V+I+DEVY E+++  SEF  +  +  ++         N+ L      S G +G+
Sbjct: 230 CVENNVVIISDEVY-EHLYFTSEFTRIATLSPEI--------GNLTL------SVGSAGK 274

Query: 385 CGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQD---- 440
                G+    G+       +LK AS+         A   +    P P  E+  +     
Sbjct: 275 TFAATGWR--IGWIVSQNAELLKYASM---------AHTRICFASPSPFQEACAKSIEIA 323

Query: 441 --RKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQH 495
                 E + +E  ++  +    F+ L G+   +P G  ++   F ++K+P       + 
Sbjct: 324 LQNNYFEKMRQEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEEL 382

Query: 496 LEKTPDEFYCQKLLEATGICTVPGSGF 522
           L K  D      L+   G+  +P + F
Sbjct: 383 LSKAKDFRISYWLINELGVVAIPPTEF 409

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 77/360 (21%), Positives = 146/360 (40%), Gaps = 60/360 (16%)

Query: 185 VGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAV-SYLLSILCRGQETG 243
           V  YS ++G   +  ++ D  T   + E    E++ +T GA+  + S L+ +L  G E  
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKE-LKAENVVVTTGANEGILSCLMGLLNSGDE-- 141

Query: 244 VLIPIPQYPLYTATLALNNSHVL------PYYLDEESG----WSTNTAEIEGVVTESIES 293
           V++  P +  Y   + L    V+      P  LD+ +     W+ +  + E  +T   ++
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKA 201

Query: 294 GIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMK 352
                  V+IN P NP G V + + +  +  +  K+ +V+I+DEVY+   F  S F  + 
Sbjct: 202 -------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTDS-FTRVA 253

Query: 353 KVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-GECGQRGGYMELTGFTHEIRQVVLKLASI 411
            +  ++ +           ++L   S G S    G R G+             VL L + 
Sbjct: 254 TLSPEIGQ-----------LTLTVGSAGKSFAATGWRIGW-------------VLSLNAE 289

Query: 412 SLCPVVTGQALVDLMVCPPKPGDESYEQDRKER------EMIHEELDHRAGLLHDTFNSL 465
            L      +A   +    P P  E+      +       E + +E   +  +L   F+ L
Sbjct: 290 LLS--YAAKAHTRICFASPSPLQEACANSINDALKIGYFENMRQEYITKFKILTSVFDEL 347

Query: 466 EGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGF 522
            G+    P G+ ++   F ++K+P       + ++K  D      L+   G+  +P + F
Sbjct: 348 -GLPYTAPEGSYFVLVNFSKVKIPEDYPYPQEIMDKGKDFRISHWLINELGVVAIPPTEF 406

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 66/131 (50%), Gaps = 8/131 (6%)

Query: 217 EDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGW 276
           +++ +T GA  A ++L+     G    ++   P Y   ++  ++  + V   +L+ E G+
Sbjct: 82  DNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGY 140

Query: 277 STNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
           + N  +++  V  + +       +V+ NP NP GSV+S E + +I   A +  I ++ DE
Sbjct: 141 TPNIQKLKSKVRANTK------YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDE 194

Query: 337 VYQENIFAGSE 347
           VY   +F  SE
Sbjct: 195 VYSP-LFHSSE 204

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 132/328 (40%), Gaps = 59/328 (17%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PYY 269
           E++ +T GA+  + S L+ +L  G E  V++  P +  Y   + L    V+      P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 270 LDEESG----WSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQV 324
           LD+ +     W+ +  + E  +T   ++       V+IN P NP G V + E +  +  +
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNI 242

Query: 325 AAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-G 383
             K+ +V+I+DEVY E++F    F  +  +  ++ +           ++L   S G S  
Sbjct: 243 CVKHNVVIISDEVY-EHLFFTDSFTRIATLSPEIGQ-----------LTLTVGSAGKSFA 290

Query: 384 ECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKE 443
             G R G+             VL L +  L      +A   +    P P  E+      +
Sbjct: 291 ATGWRIGW-------------VLSLNAELLS--YAAKAHTRICFASPSPLQEACANSIND 335

Query: 444 R------EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQ 494
                  E + +E   +  +    F+ L G+    P G  ++   F ++K+P       +
Sbjct: 336 ALKIDYFEKMRQEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKE 394

Query: 495 HLEKTPDEFYCQKLLEATGICTVPGSGF 522
            L+K  D      L+   G+  +P + F
Sbjct: 395 ILDKGKDFRISHWLINELGVVAIPPTEF 422

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 157/376 (41%), Gaps = 64/376 (17%)

Query: 170 AIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAY-----PEDIFLTAG 224
            +E A++ L D    V  YS ++G    R ++ + + ++ S  P Y       +I +T G
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKG----RMSLINSLIKQYS--PLYNTQLQANNIQVTTG 122

Query: 225 ASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDEE-------- 273
           A+  + + L+ +L  G E  V  P   +  Y + + +    V  +P +  +E        
Sbjct: 123 ANEGILACLVGLLNPGDEVIVFEPF--FDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEG 180

Query: 274 SGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVI 333
           + W+ +  E+   +T   ++      L++  P NP G V + E + +I Q+  +  +V+I
Sbjct: 181 TEWTVDYDELRAAITPKTKA------LILNTPHNPVGKVFTREELLQIGQICVENNVVII 234

Query: 334 ADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-GECGQRGGYM 392
           +DEVY E+++   EF  +  +  ++ +           ++L   S G S    G R G+ 
Sbjct: 235 SDEVY-EHLYFTPEFTRVATLSPEIGQ-----------ITLTIGSAGKSFAATGWRIGW- 281

Query: 393 ELTGFTHEIRQVVLKLASISLC---PVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHE 449
            +     E+ +    +A   +C   P    +A  + +   P   D  Y +  +      E
Sbjct: 282 -IVSLNPELLEYA-SMAHTRICFASPSPLQEACANAL---PIALDNGYFKKMR------E 330

Query: 450 ELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTPDEFYCQ 506
           E  H+  +    F+ L G+   KP G  ++   F ++K+P       +   K  D     
Sbjct: 331 EYIHKFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISY 389

Query: 507 KLLEATGICTVPGSGF 522
            L+   G+  +P + F
Sbjct: 390 WLINELGVVAIPPTEF 405

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 13/168 (7%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAV-SYLLSILCRGQETGVLI 246
           YS ++G   + K +AD  T    G+    ++I +  GA+ A+ S L+ +L +G E  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 247 PIPQYPLYTATLALNNSHVL------PYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300
           P   +  Y + + L    V       P  LD+     T       ++ ++I S  R   +
Sbjct: 136 PF--FDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINS--RTKCV 191

Query: 301 VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEF 348
           ++  P NP G V + E + ++ ++     IV+I+DEVY E+++   EF
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEF 238

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 78/168 (46%), Gaps = 26/168 (15%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPE---DIFLTAGASAAVSYLLSILCRGQETGV 244
           YS +QG+  +   +  FIT+ ++  P Y E   DI L  G+S ++  +   LC    T +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNT-PPYNETLYDIMLANGSSDSMFKVFETLCDESTTVL 195

Query: 245 LIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGI--------- 295
           +      P+ +  +A   +  +P  L+          E +G+  E +E+ +         
Sbjct: 196 MEEFTFVPVISNVMA-TGAKCIPLKLNL-------NYEDQGIDIEYLENLLDNWGGKSNT 247

Query: 296 ----RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
               +P +L  I+ G NP G  LS+E   KI+ +A ++ ++++ D+ Y
Sbjct: 248 KHLSKPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 135/326 (41%), Gaps = 57/326 (17%)

Query: 218 DIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDEE- 273
           ++ +T GA+  + S L+ +L  G E  V  P   +  Y + + +    V  +P +  +E 
Sbjct: 116 NVQVTTGANEGILSCLVGLLNPGDEVIVFEPF--FDQYISNIQIPGGKVTYVPMHPPKEM 173

Query: 274 -------SGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAA 326
                  + W+ N  E+E  +T   ++      L++  P NP G V + E + +I ++  
Sbjct: 174 NVRNTKGTEWTVNYDELEAAITPKTKA------LILNTPHNPVGKVFTREELLRIGEICV 227

Query: 327 KYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-GEC 385
           K+ +V+I+DEVY E+++   EF  +  +  ++ +           ++L   S G S    
Sbjct: 228 KHNVVIISDEVY-EHLYFTPEFTRIATLSPEIGQ-----------ITLTVGSAGKSFAAT 275

Query: 386 GQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQ------ 439
           G R G++        +   +LK AS+         A   +    P P  E+         
Sbjct: 276 GWRIGWVV------SLNPELLKYASM---------AHTRICFSSPSPLQEACANSLNTAL 320

Query: 440 DRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHL 496
           D    E + +E  ++  +    F+ L G+   +P G  ++   F ++K+P       +  
Sbjct: 321 DNGYFEKMRQEYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELR 379

Query: 497 EKTPDEFYCQKLLEATGICTVPGSGF 522
            K  D      L+   G+  +P + F
Sbjct: 380 SKGKDFRISYWLVNELGVVAIPPTEF 405

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 78/172 (45%), Gaps = 20/172 (11%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYL-D 271
           P   E+I L  G+  ++  L+ + C   +  ++I  P Y +Y+    +N+   +   L  
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
           E++ +  +T++    V E++       ++ + +PGNPT +++    IEK+       G +
Sbjct: 144 EDNSFQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGL 197

Query: 332 VIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           V+ DE Y +    GS    + K            Y N+ ++   S S G++G
Sbjct: 198 VVVDEAYID-FCGGSTTPLVNK------------YPNLAVIQTMSKSFGLAG 236

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 92/193 (47%), Gaps = 23/193 (11%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDE 272
           P   ++I L  G+   V  L+   C  +   VL+  P Y +Y+    +N++ V+   L  
Sbjct: 84  PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 273 ESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVV 332
           E   ++   +++ V+ E++ +     +L +  PGNPTG+ +S + IE +    +  GIVV
Sbjct: 144 ED--NSFDMDLDNVL-ETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWSA-GIVV 199

Query: 333 IADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYM 392
           + DE Y +  F+ S+  +       L  ++P       LV + + SK   G  G R G  
Sbjct: 200 V-DEAYID--FSSSDSAA------PLVNKYP------NLVVIQTLSKSF-GLAGVRLG-- 241

Query: 393 ELTGFTHEIRQVV 405
            LT  + +I +V+
Sbjct: 242 -LTFASEDISKVL 253

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 129/328 (39%), Gaps = 59/328 (17%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL------PYY 269
           E++ +T GA+  + S L+ +L  G E  V++  P +  Y   + L    V+      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 270 LDEESG----WSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQV 324
           LD+ +     W+ +  + E  +T   ++       V+IN P NP G V + E +  +  +
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNI 226

Query: 325 AAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-G 383
             K+ +V+I+DEVY+   F  S          ++    P I      ++L   S G S  
Sbjct: 227 CVKHNVVIISDEVYEHLYFTDS--------FTRIATLSPEIGQ----LTLTVGSAGKSFA 274

Query: 384 ECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKE 443
             G R G+             VL L +  L      +A   +    P P  E+      +
Sbjct: 275 ATGWRIGW-------------VLSLNAELLS--YAAKAHTRICFASPSPLQEACANSIND 319

Query: 444 R------EMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQ 494
                  E + +E  ++  +    F+ L G+    P G  ++   F ++K+P       +
Sbjct: 320 ALKIGYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEE 378

Query: 495 HLEKTPDEFYCQKLLEATGICTVPGSGF 522
            L K  D      L+   G+  +P + F
Sbjct: 379 ILNKGKDFRISHWLINELGVVAIPPTEF 406

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 187 AYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLI 246
            Y S +G   +R  +A          P + +D  L    + A ++L+     G    V+ 
Sbjct: 54  TYGSIKGSDKLRSLIASMYG------PEFNKDNVLVTNGAIAANFLIYYTLVGPGDHVIC 107

Query: 247 PIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPG 306
             P Y    +   +  + V    L +E G+  N   ++ ++  + +      ++++ NP 
Sbjct: 108 VDPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPN 161

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSM 351
           NP GS +S E +  I Q+  +  I +  DEVY+        FHSM
Sbjct: 162 NPLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 7/135 (5%)

Query: 217 EDIFLTAGASAAV-SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL--PYYLDEE 273
           E++ +T GA+  + S L+ +L  G E  V++  P +  Y + + L    V+  P    +E
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 274 SGWSTNTAEIEGVVTESIESGIRPSVLVVI--NPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
                   E   +  E  E  I P    VI   P NP G V + E +  +  +  K+ ++
Sbjct: 174 LDLRNTRGEEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVI 233

Query: 332 VIADEVYQENIFAGS 346
           +I+DEVY+   F  S
Sbjct: 234 IISDEVYEHLYFTDS 248

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/361 (21%), Positives = 143/361 (39%), Gaps = 68/361 (18%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPE-----DIFLTAGASAAV-SYLLSILCRGQE 241
           YS ++G   + K++ DF +      P Y E     ++ +T GA+  + + L+ +L  G E
Sbjct: 88  YSPTRGRPSLLKSLTDFYS------PIYNETLNESNVTITTGANEGILASLVGLLNPGDE 141

Query: 242 TGVLIPIPQYPLYTATLALNNSHV------LPYYLDEE----SGWSTNTAEIEGVVTESI 291
             V++  P +  Y + + +    V       P  L E     + W  +   +   + E  
Sbjct: 142 --VIVFEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE-- 197

Query: 292 ESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSM 351
               R   +++  P NP G V + E + ++  +  K  I +I+DEVY E+++ G EF  +
Sbjct: 198 ----RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRI 252

Query: 352 KKVLRQLQKEHPGIYDNVQLVSLHSTSKGVS-GECGQRGGYMELTGFTHEIRQVVLKLAS 410
             + +++             ++L   S G S    G R G++       E+   V K A 
Sbjct: 253 ATISKEIGD-----------LTLSVGSAGKSFAATGWRIGWV--VSRNAELLSYVSK-AH 298

Query: 411 ISLCPVVTGQALVDLMVCPPKPGDESYEQD------RKEREMIHEELDHRAGLLHDTFNS 464
             +C               P P  E+              E + EE   +  +L   F+ 
Sbjct: 299 TRIC------------FSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDE 346

Query: 465 LEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSG 521
           L G+   KP G  ++   F ++++P +     +  E+  D      L+   G+  +P + 
Sbjct: 347 L-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTE 405

Query: 522 F 522
           F
Sbjct: 406 F 406

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 74/152 (48%), Gaps = 9/152 (5%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           Y + +G   +R  VA   ++++       +++ +T GA  A ++L+S    G    V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDKEV--KLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVICV 111

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307
            P Y   ++   +  + V    L+ E+ +  +  +++ ++  + +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           P GSV+    +E+I  +A K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 67/141 (47%), Gaps = 9/141 (6%)

Query: 206 TERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV 265
           T  +   P    +I L  G+  ++  ++   C      +L+  P Y +Y+    +N+  V
Sbjct: 77  TADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEV 136

Query: 266 LPY-YLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQV 324
           +    + E++ +  ++ ++  ++    E      +L + +PGNPTG+ +    IEK+ Q 
Sbjct: 137 VTCPLITEDNSFQMDSDKVLDILNNDQEI----KLLFITSPGNPTGAQIETARIEKVLQN 192

Query: 325 AAKYGIVVIADEVYQENIFAG 345
             + G+VV+ DE Y +  F G
Sbjct: 193 WDR-GLVVV-DEAYVD--FCG 209

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNN-SHVLPYYLD 271
           P   E++ L  G+   +  L+   C   +  +LI  P Y +Y+    +N+  +V    + 
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
           E++ +  +T +    V E++++     ++ + +PGNPTG+++  E IEK+     + G V
Sbjct: 144 EDNSFQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFV 198

Query: 332 VIADEVY 338
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 131/318 (41%), Gaps = 48/318 (15%)

Query: 208 RDSGEPAYPE-DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL 266
           + +  PAY   D+ L  G+S ++  L   +C    T ++      P+     A   +H+ 
Sbjct: 113 KKANNPAYDNWDVILGNGSSDSMFKLFETICDENTTVMMEEFTFSPVIYNIKATGAAHI- 171

Query: 267 PYYLD-----EESGWSTNTAE--IEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAI 318
           P  ++     E+ G   +  +  +E   +   +   +P+VL  I  G NPTG  LS+E  
Sbjct: 172 PIKMELSENPEKQGIDVDYMQTLLENWDSSEHKHLPKPTVLYTIATGQNPTGMTLSMEKR 231

Query: 319 EKIFQVAAKYGIVVIADEVY-------------QENIFAGSEFHSMKKVLRQ-LQKEHPG 364
            KI+++  K+ I+++ D+ Y              +N +   E  ++ K +   L K    
Sbjct: 232 RKIYKICQKHDIIIVEDDPYGYLYLPKYDKSKPDKNPYLDDENLTVDKYINDYLVKSFMT 291

Query: 365 IYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVD 424
           I  + ++V L + SK  +   G R  +M    F   I +V+      +  P  T QA++ 
Sbjct: 292 IDTDARVVRLETFSKVYAP--GLRLSFMAANKFI--IDKVLTYTEITTRAPSGTSQAILY 347

Query: 425 LMVCP-PKPGDESYEQ-DRKERE-------MIHEELDHRAGLLHDTFNSLEGIECQK--- 472
             +    KP ++ +E  D  + E        +  E  HR  ++   F +L G E  K   
Sbjct: 348 TTIKELAKPYEDKFENVDYAQLEGWFHWIMKVAAEYTHRRNVM---FKALYGTEAFKKGY 404

Query: 473 -----PRGAMYLFPQIKL 485
                P   M++  ++ L
Sbjct: 405 LEVLEPSAGMFINVKVNL 422

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 74/159 (46%), Gaps = 10/159 (6%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247
           YS +QG+  I   +   I    +  P    D+ L  G+S ++  L   L   + T VL+ 
Sbjct: 112 YSQTQGLAPILDFLK-LIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLT-DETTTVLVE 169

Query: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGV--VTESIESG-----IRPSVL 300
              +    + +    +  +P  L+  S  S     +  +  + E+ +SG      RPS+L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 301 VVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
             I+ G NPTG  +S+E   +I+++A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 22/174 (12%)

Query: 185 VGAYSSSQGVYGIRKTVADFITERDS---GEPAYPEDIFLTAGASAAV-SYLLSILCRGQ 240
           V  YS ++G    R +V + + +  S   G+    E++ +T GA+  + S L+ IL  G 
Sbjct: 92  VNQYSPTKG----RPSVINSLKKLYSPLYGQELKDENVTITTGANEGILSSLMGILNPGD 147

Query: 241 ETGVLIP-----IPQYPLY---TATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIE 292
           E  V  P     IP   L       + +N    +   + E   W+ +  E+    T   +
Sbjct: 148 EVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTSKTK 207

Query: 293 SGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGS 346
           +      L++  P NP G V + E + KI  +  +  +V+I+DEVY+   F  S
Sbjct: 208 A------LILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDS 255

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 121/299 (40%), Gaps = 71/299 (23%)

Query: 216 PEDIFLTAGASAAV-SYLLSILCRGQETGVLIPI-PQYPLYTATLALNNSHV-------L 266
           PE+I +T GA+  + + L+S+L  G E  VL P   QY      L     HV       L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 267 PYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVIN-PGNPTGSVLSVEAIEKIFQVA 325
                + S W+ +  +    ++E  ++       V+IN P NPTG V + E +  +  + 
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISEKTKA-------VIINSPHNPTGKVFTREELLTLGNIC 211

Query: 326 AKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGEC 385
            +  + +I+DEVY EN++   E                     V+L SL      ++   
Sbjct: 212 VEKNVYIISDEVY-ENLYFTPEC--------------------VKLASLSPEISNITLTI 250

Query: 386 GQRGGYMELTGFTHEIRQVV------LKLAS---ISLC------PVVTGQALVDLMVCPP 430
           G  G    +TG+   I  ++      LKLAS   I +C      P +     +D+ +   
Sbjct: 251 GSAGKIFAVTGW--RIGWIISENVELLKLASSAHIKICFSSPSPPQLACAHAIDIAL--- 305

Query: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLP 486
                S   DR  ++ I      +  +L   F  L G+    P G+ ++   F ++K+P
Sbjct: 306 ----NSDYFDRMRKDYI-----EKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 66/134 (49%), Gaps = 7/134 (5%)

Query: 212 EPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLD 271
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V+   L 
Sbjct: 83  KPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLT 142

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
              G  +   + E V+T  +++     ++ V +PGNPTG+ +    IEK+ Q     G+V
Sbjct: 143 VSDG--SFQMDTEAVLT-ILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLV 198

Query: 332 VIADEVYQENIFAG 345
           V+ DE Y +  F G
Sbjct: 199 VV-DEAYVD--FCG 209

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSH---VLPYYLDEES 274
           D+  T G + A    L + C   + G +I + +   +++ LA   +      P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 275 GWSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVI 333
                  ++E ++    E   +P +L  I  G NPTGS LS +  EKI++VA K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 334 ADEVY 338
            DE Y
Sbjct: 245 EDEPY 249

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 25/132 (18%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLAL--NNSHVLPYYLDEESG 275
           D+  TAG + A    L + C   +T   I    Y   ++  A      +V P  LDE   
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDT---ILAEAYSFSSSLYAAEAQGVNVFPVPLDEF-- 189

Query: 276 WSTNTAEIEGVVTESIESGI--------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAA 326
                    G++ E +ES +        +P +L  I  G NPTGS LS +   KI+++A 
Sbjct: 190 ---------GIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQ 240

Query: 327 KYGIVVIADEVY 338
           K+  ++I DE Y
Sbjct: 241 KHNFIIIEDEPY 252

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 82/168 (48%), Gaps = 20/168 (11%)

Query: 217 EDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLD-EESG 275
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V+   L  E++ 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 276 WSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIAD 335
           +  N+ +    V + +++     ++ + +PGNPTG  +  + IEK+ Q     G+VV+ D
Sbjct: 148 FQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 336 EVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           E Y +  F G    S+  ++ Q        Y N+ ++   S S G++G
Sbjct: 202 EAYID--FCGG---SLAPLVTQ--------YQNLIVLQTLSKSFGLAG 236

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 65/130 (50%), Gaps = 13/130 (10%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDE 272
           P   E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  ++   L  
Sbjct: 85  PLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPL-- 142

Query: 273 ESGWSTNTAEIEGVVTESIESGIRPS----VLVVINPGNPTGSVLSVEAIEKIFQVAAKY 328
              +  N+ +++   TES+ + ++      +L + +PGNPTG+ +  E IE + Q     
Sbjct: 143 --LYKNNSFQMD---TESVLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD- 196

Query: 329 GIVVIADEVY 338
           G+VV+ DE Y
Sbjct: 197 GLVVV-DEAY 205

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 71/142 (50%), Gaps = 15/142 (10%)

Query: 210 SGEPAY----PEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV 265
           S +PA      +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V
Sbjct: 77  SNDPAVKSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEV 136

Query: 266 L--PYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQ 323
           +  P  + + S       ++E V+T  +E+     ++ V +PGNPTG+ +    IE++ Q
Sbjct: 137 VQCPLVVSDNSFQ----MDVEAVLT-ILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ 191

Query: 324 VAAKYGIVVIADEVYQENIFAG 345
              + G+VV+ DE Y +  F G
Sbjct: 192 -NWQNGLVVV-DEAYID--FCG 209

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 119/269 (44%), Gaps = 46/269 (17%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPE------DIFLTAGASAAVSYLLSILCRGQE 241
           Y+ ++G+  +   V DF++  +   PA+ +      D+ L+ G++ ++  +   +C  + 
Sbjct: 102 YAETKGLPPLLHFVKDFVSRIN--RPAFSDETESNWDVILSGGSNDSMFKVFETIC-DES 158

Query: 242 TGVLIPIPQYPLYTATLALNN-----SHVLPYYLD-----EESGWSTN--TAEIEGVVTE 289
           T V+I       +T T A++N     + V+P  ++     E  G      T  ++   T 
Sbjct: 159 TTVMIE-----EFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTG 213

Query: 290 SIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY---------- 338
             +   +P VL  I  G NPTG  +     EKI+Q+A ++  +++ D+ Y          
Sbjct: 214 PYKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNP 273

Query: 339 ---QENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELT 395
               EN +  S+  + + +   L K    +  + +++ L + SK  +   G R  ++   
Sbjct: 274 QEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFIVAN 331

Query: 396 GFTHEIRQVVLKLASISL-CPVVTGQALV 423
            F   + Q +L LA I+   P  T QA+V
Sbjct: 332 KF---LLQKILDLADITTRAPSGTSQAIV 357

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/328 (19%), Positives = 136/328 (41%), Gaps = 58/328 (17%)

Query: 217 EDIFLTAGA-SAAVSYLLSILCRGQETGVLIPIPQYPLYTATLA--------LNNSHVLP 267
           E+I +T GA  A +  L++++  G E  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 268 YYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAK 327
             + E + W  +   +    T+      +  ++++ NP NP G V + + + ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 328 YGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQ 387
            G  +IADEVY+   F  +    +  +   + +         + +++ S  K +    G 
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQ---------KTITIGSAGK-IFRVTGW 262

Query: 388 RGGYMELTGFTHEIRQVVLKLASI---------SLCPVVTGQALVDLMVCPPKPGDESYE 438
           R G+M       + R++V K+ ++         S+  V +G  +   + C        Y 
Sbjct: 263 RVGWM-----ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQRALEC-------GYF 310

Query: 439 QDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQH 495
                   +  E D +  +++   + L G+   KP+GA ++   F ++K+P +  Q  ++
Sbjct: 311 LS------MPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIP-EDYQFPEY 362

Query: 496 LEKTPDEFYCQKLL-EATGICTVPGSGF 522
           L+    +F+    L +   I  +P S F
Sbjct: 363 LKNRARDFFISYWLTQEFCILLLPCSEF 390

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 67/131 (51%), Gaps = 15/131 (11%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCR-GQETGVLIPIPQYPLYTATLALNNSHVLPYYLD 271
           P   E++ L  G+  ++  ++   C  G+E  + +P P Y +Y+   ++N+  ++   L 
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYGMYSVCASVNDVEIVKCPL- 138

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLV----VINPGNPTGSVLSVEAIEKIFQVAAK 327
                S N+ +++   TE++   ++   L+    + +PGNPTG+ +    IEKI Q    
Sbjct: 139 ---VTSDNSFQVD---TEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWD 191

Query: 328 YGIVVIADEVY 338
            GI+V+ DE Y
Sbjct: 192 QGILVV-DEAY 201

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 66/148 (44%), Gaps = 21/148 (14%)

Query: 218 DIFLTAGASAAVSYLLSILC-RGQETGVLIPIPQYPLYTATLALNNSH---VLPYYLDEE 273
           D+  TAG + A    L + C RG      + + +   +++ LA   +      P  +D++
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGD-----VILAEAHSFSSCLAAAQAQGITTFPVPIDDK 187

Query: 274 SGWSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVV 332
                  A++E ++        +P +L  I  G NPTG+ L+ E   +IF++A K+  ++
Sbjct: 188 G---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLI 244

Query: 333 IADEVYQENIFAGSEFHSMKKVLRQLQK 360
           I D  Y         F  M K  R LQK
Sbjct: 245 IEDAPYY--------FLQMDKYERDLQK 264

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 9/64 (14%)

Query: 284 EGVVTESIESGI--------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
           +G++ E +ES +        +P +L  I  G NPTGS LS E  E I+++A K+  ++I 
Sbjct: 186 DGIIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIE 245

Query: 335 DEVY 338
           DE Y
Sbjct: 246 DEPY 249

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 86/177 (48%), Gaps = 27/177 (15%)

Query: 217 EDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL--PYYLDEES 274
           +++ L  G+   +  L+   C+     +++  P Y +Y+    +N+  V+  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 275 GWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
                   +E +  + +   IR  +L + +PGNPTG +++++ I  + +   K G+VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDL---IR--LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 335 DEVYQENIFA--------GSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSG 383
           DE Y +  F+         +E+ S+ K++ +        Y N+ ++   S S G++G
Sbjct: 198 DEAYVD--FSTYFNEETKKTEYFSVAKLVTK--------YPNLTVLQTLSKSFGLAG 244

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 67/136 (49%), Gaps = 11/136 (8%)

Query: 212 EPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL--PYY 269
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V+  P  
Sbjct: 83  KPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 270 LDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYG 329
           + + S +  NT   E V+T  + +     ++   +PGNPTG+ +    IE++ Q     G
Sbjct: 143 VSDNS-FQMNT---EAVLT-ILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNG 196

Query: 330 IVVIADEVYQENIFAG 345
           IVV+ DE Y +  F G
Sbjct: 197 IVVV-DEAYVD--FCG 209

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 212 EPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL--PYY 269
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V+  P  
Sbjct: 83  KPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 270 LDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYG 329
           + + S      A +  +  + +       ++ V +PGNPTG+ +    IEKI Q   + G
Sbjct: 143 VSDNSFQMDTEAALTILKNDPL-----IKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENG 196

Query: 330 IVVIADEVYQENIFAG 345
           +VV+ DE Y +  F G
Sbjct: 197 LVVV-DEAYID--FCG 209

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 69/134 (51%), Gaps = 9/134 (6%)

Query: 213 PAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY-YLD 271
           P   E+  L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+  V+    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 272 EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIV 331
           E++ +  +  EI  ++    +  I+  ++ + +PGNPTG+ + ++ IE + +   + G+V
Sbjct: 143 EDNSFQIDATEILNILAN--DPLIK--LVFITSPGNPTGAKIEIDRIEYLLKNWDQ-GLV 197

Query: 332 VIADEVYQENIFAG 345
           ++ DE Y +  F+G
Sbjct: 198 IV-DEAYID--FSG 208

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 98/247 (39%), Gaps = 49/247 (19%)

Query: 188 YSSSQGVYGIRKTVADFITE------RDSGEPAYPEDIFLTAGASAAVSYLLSILCR--- 238
           Y S +G   +R+ +  F  +      RD    + PE + L++GAS  V   LSIL +   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGV---LSILLQATL 107

Query: 239 ---GQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTA-------EIEGVVT 288
              G      I  P Y L                +DE+   S + A       E E   T
Sbjct: 108 AHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFT 167

Query: 289 E---------------SIESGIRPSVLVVI-NPGNPTGSVLSVEAIEKIFQVAAKYGIVV 332
           E               ++   I   V+  I    NPTG+  S E   K+ ++A KY +++
Sbjct: 168 EEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLI 227

Query: 333 IADEVYQENIFAGSEFHSM---KKVLRQLQKE---HPGIYDNVQLVSLHSTSKGVSGECG 386
           IAD+VY    F+   F ++   KK    L +E    P  Y N   +S  + SK ++   G
Sbjct: 228 IADDVYDMLDFS-PPFDNLPQPKKRFVHLDRETNNDPESYGNT--ISNATFSKLIA--PG 282

Query: 387 QRGGYME 393
            R GY E
Sbjct: 283 LRFGYHE 289

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 73/366 (19%), Positives = 141/366 (38%), Gaps = 44/366 (12%)

Query: 170 AIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAV 229
           AI+ A+R L      V  YS ++G   +  ++  F T   + +         T    A  
Sbjct: 63  AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 230 SYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIE--GVV 287
           S L+ +L  G E  V  P   +  Y   + L+   V+   +       T   + E   + 
Sbjct: 121 SILIGLLNPGDEVIVFEPF--FDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 288 TESIESGI--RPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAG 345
            +S+++ +  +   +++  P NP G V +   + ++  +  K  +V+I+DEVY+   F  
Sbjct: 179 WDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKD 238

Query: 346 SEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVV 405
           S          ++    P I    QL    + + G +G+     G+    G+   + Q +
Sbjct: 239 S--------FTRIATLSPEI---GQL----TLTVGSAGKSFAATGWR--IGWALSLNQEL 281

Query: 406 LKLASISLCPVVTGQALVDLMVCPPKPGDESYE---QDRKEREMIHE---ELDHRAGLLH 459
           L  A+         +A   +    P P  E+      D ++ E   E   +   +  +  
Sbjct: 282 LSYAA---------KAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRLQYIRKYEIFT 332

Query: 460 DTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICT 516
           +  N L G+   +P G  ++   F ++K+P       + L K  D      L+   G+  
Sbjct: 333 NVLNEL-GLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVA 391

Query: 517 VPGSGF 522
           +P + F
Sbjct: 392 IPPTEF 397

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 115/272 (42%), Gaps = 52/272 (19%)

Query: 188 YSSSQGVYGIRKTVADFITERD----SGEPAYPEDIFLTAGASAAVSYLLSILCRGQETG 243
           Y+ ++G+  +   V D +   +    S E     D+ L+ G++ ++  +   +C  + T 
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 244 VLIPIPQYPLYTATLALNN-----SHVLPYYLDEESGWSTNTAEIEGVVTESIESGI--- 295
           V+I       +T T A++N     + V+P  +D      T   E +G+  E +   +   
Sbjct: 161 VMIE-----EFTFTPAMSNVEATGAKVIPIKMD-----LTFDRERQGIDVEDLTRLLDNW 210

Query: 296 ---------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY------- 338
                    +P VL  I  G NPTG  +     EKI+Q+A K+  +++ D+ Y       
Sbjct: 211 STGPYKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYFPS 270

Query: 339 ------QENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYM 392
                  EN +  S+    + +   L K    +  + +++ L + SK  +   G R  ++
Sbjct: 271 YNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFI 328

Query: 393 ELTGFTHEIRQVVLKLASISL-CPVVTGQALV 423
               F   + Q +L LA I+   P  T QA+V
Sbjct: 329 VANKF---LLQKILDLADITTRAPSGTSQAIV 357

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 282 EIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           ++E ++    E   +P +L  I  G NPTGS L+ E  ++I+++A K+  ++I DE Y
Sbjct: 192 KLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 21/188 (11%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNS--HVLPYYLDEESG 275
           ++  T G + +    L I C   +T   I   QY   ++  A      +V P  LD +  
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 276 WSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
                  +E ++        +P +L  I  G NPTGS LS +   +I+++A K+ +++I 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 335 DE--------VYQENIFAGSEFH--SMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGE 384
           DE         YQ+++    E H  S +  +  L K    +    +++ L S SK +   
Sbjct: 249 DEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG-- 306

Query: 385 CGQRGGYM 392
            G R G++
Sbjct: 307 PGTRLGWI 314

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 102/262 (38%), Gaps = 47/262 (17%)

Query: 281 AEIEGVVTESIESGIRPSVL----------VVIN-PGNPTGSVLSVEAIEKIFQVAAKYG 329
           AE+   VTE  E  I   +L          V+IN P NP G V + E + K+  +  + G
Sbjct: 186 AELSKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 330 IVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRG 389
           I +I+DEVY E+++   EF  +  +  +              +S H+ + G +G+     
Sbjct: 246 IYIISDEVY-EHLYFTDEFTRIATLSEE--------------ISQHTLTVGSAGKSFAAT 290

Query: 390 GYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHE 449
           G+    G+     + +L LAS         +A V +    P P  E+     +       
Sbjct: 291 GWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTTY 339

Query: 450 ELDHRAGL------LHDTFNSLEGIECQKPRGAMYL---FPQIKLPYKAIQAAQHLEKTP 500
             D RA            F+ L G+   +  G+ +L   F ++ LP       +  +K  
Sbjct: 340 YADTRAAYQKKYERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGR 398

Query: 501 DEFYCQKLLEATGICTVPGSGF 522
           D      L+   G+  +P S F
Sbjct: 399 DFRVAYWLINELGLVAIPCSSF 420

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 188 YSSSQGVYGIRKTVADFITERDS---GEPAYPEDIFLTAGASAAVSYLLSILCRGQETGV 244
           Y +S+G    +K +  F+ E  S     P    DI  T G++ A    L I C   +T V
Sbjct: 104 YGNSRG----QKELVSFLKEHTSIFHSIPYNDWDIITTTGSTQAWDASLRIFCNKGDT-V 158

Query: 245 LIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVIN 304
           L+    Y            + +P  +D +        E+    T+       P +L  I 
Sbjct: 159 LLEEFTYSSSVEAADAQGLNCIPVPMDNQGIIPEKLEEMLSNWTDRYPGIPMPKLLYTIP 218

Query: 305 PG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
            G NPTG  LS      I+++A KY I+++ D+ Y
Sbjct: 219 TGQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPY 253

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 296 RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           +P +L  I+ G NP G  LS+E  EKI+Q+A ++ ++++ D+ Y
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 25/132 (18%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLAL--NNSHVLPYYLDEESG 275
           D+  T G + +    L I C   +T   I   +Y   ++  A      +V P  LD +  
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDAD-- 189

Query: 276 WSTNTAEIEGVVTESIESGI--------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAA 326
                    G++ E +E+ +        +P +L  I  G NPTGS LS +  ++I+++A 
Sbjct: 190 ---------GLIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQ 240

Query: 327 KYGIVVIADEVY 338
           K+  ++I DE Y
Sbjct: 241 KHDFIIIEDEPY 252

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 84/197 (42%), Gaps = 53/197 (26%)

Query: 187 AYSSSQGVYGIRKTVADFITE------RDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ 240
            Y S++G   +R  + +F+ E      RD    + PE + LT+GAS  V   L+IL +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 241 --ETGV----LIPIPQYPLYTATLALNNSHVLPYY------LDEESGWSTNTAEIEGVVT 288
              TGV     I  P Y L      +N+  +   +      +DE+   S +   +E  + 
Sbjct: 107 LPHTGVTKQAFIVSPTYFL------INDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLK 160

Query: 289 --ESI------ESGIRPSVL------------------VVINPGNPTGSVLSVEAIEKIF 322
             ESI      E+G   S++                  V+    NP+G   ++E   K+ 
Sbjct: 161 HFESIDPNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLI 220

Query: 323 QVAAKYGIVVIADEVYQ 339
           ++A KY +++I D+VY 
Sbjct: 221 ELARKYDMLIITDDVYD 237

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 116/264 (43%), Gaps = 36/264 (13%)

Query: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPE------DIFLTAGASAAVSYLLSILCRGQE 241
           Y+ ++G+  + +   D +   +   PA+ +      D+ L+ G++ ++  +    C  + 
Sbjct: 150 YAETKGMPPLLQFTKDMVARIN--RPAFSDETDSNWDVILSGGSNDSMYKVFETFC-DES 206

Query: 242 TGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGV--VTESIESG----- 294
           T V+I    +    + +    + V+P  ++  +   T + +++ +  + E+  +G     
Sbjct: 207 TTVMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVDYLSQLLENWSTGPYRHL 266

Query: 295 IRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY-------------QE 340
            +P VL  I  G NPTG  +     EKI+++A ++  +++ D+ Y              E
Sbjct: 267 NKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYLYFPPFDPENPLE 326

Query: 341 NIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHE 400
           N +  S   + + +   L K    +  + +++ L + SK  +   G R  ++    F   
Sbjct: 327 NPYQSSSVTTERYLNEFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFIVANKF--- 381

Query: 401 IRQVVLKLASISL-CPVVTGQALV 423
           I + VL LA I+   P  T QA+V
Sbjct: 382 ILEKVLDLADITTRAPSGTSQAIV 405

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 96/236 (40%), Gaps = 41/236 (17%)

Query: 133 NQKPLSFYRQVLSILQYP-EVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSS 191
           NQ+P++F++   S    P E + +   +L+       D I+  +  L         Y   
Sbjct: 4   NQRPINFFKGHPSFRLLPREAIVEATSQLLLPECRDYDDIDEDRHPL--------TYGPD 55

Query: 192 QGVYGIRKTVADFITE----RDSGEPAYPEDIFLTAGASAAVSYLL---SILCRGQETGV 244
           +G   +R  +A F  +            PE I LTAGAS  V  +L   ++   G     
Sbjct: 56  EGSKWVRTAIAAFSNDCFQLPSEEMKTKPEHINLTAGASYGVMNILEQTTLPHTGYTRQA 115

Query: 245 LIPIPQYPL-------------YTATLALNNSHV--------LPYYLDEESGWSTNTAEI 283
            I  P Y L              TA   L +  +        L Y+   +S  + N++E+
Sbjct: 116 FIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYF---DSISNDNSSEL 172

Query: 284 EGVVTESIESGI-RPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           + +   +    + R  + +V    NP G   S+E   K+ ++A K+ +++++D+VY
Sbjct: 173 QLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVY 228

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 115/267 (43%), Gaps = 42/267 (15%)

Query: 188 YSSSQGVYGIRKTVADFITERD----SGEPAYPEDIFLTAGASAAVSYLLSILCRGQETG 243
           Y+ S+G   + + V D ++  +    S E     D+ L+ G++ ++  +   +C  + T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 244 VLIPIPQYPLYTATLALNN-----SHVLP----YYLDEES-GWSTN--TAEIEGVVTESI 291
           VLI       +T T A++N     + V+P      LD +S G   +  T  ++   T   
Sbjct: 161 VLIE-----EFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGPY 215

Query: 292 ESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY------------ 338
           +   +P VL  I  G NPTG  +     EKI+++A K+  +++ D+ Y            
Sbjct: 216 KHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGYLYFPPFNSED 275

Query: 339 -QENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGF 397
             EN +  S   + + +   L K    +  + +++ L + SK  +   G R  ++    F
Sbjct: 276 PSENPYQSSNLTTERYLNDYLMKSFLTLDTDARVIRLETFSKIFA--PGLRLAFIVANKF 333

Query: 398 THEIRQVVLKLASISL-CPVVTGQALV 423
             E    +L LA I+   P    QA+V
Sbjct: 334 FLE---RILDLADITTRAPSGASQAIV 357

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 70/153 (45%), Gaps = 12/153 (7%)

Query: 187 AYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLI 246
           +Y + +G   +R ++A        G     +DI LT GA  A ++L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 247 PIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPG 306
             P Y    +   +  + V    L +E  +  N   ++ ++  + +      ++++ NP 
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPN 161

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           NP GSV+  + +++I ++  +  I + +DEVY+
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           DI LT G +      L + C   +  +L     +    A+         P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHG--- 187

Query: 278 TNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
               ++E ++        +P +L  I  G NPTG+ L+ E   +I+++A K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 337 VY 338
            Y
Sbjct: 248 PY 249

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDEESG 275
           D+  T G ++A    L + C   +T   I   +Y   ++ +A     V   P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVPLDENGM 188

Query: 276 WSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
                 E+        +   RP +L  +  G NPTG+ LS +  + ++++A ++ ++++ 
Sbjct: 189 VPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVE 248

Query: 335 DEVY 338
           DE Y
Sbjct: 249 DEPY 252

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 282 EIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           ++E ++ E      RP +L  I  G NPTG+ L+ +  ++I+++A K+  ++I DE Y
Sbjct: 191 KLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 80/176 (45%), Gaps = 17/176 (9%)

Query: 217 EDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGW 276
           +++ +T GA  A ++LL     G+   V+   P Y    +   +  + V    L E+  +
Sbjct: 80  DNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSF 138

Query: 277 STNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
             N   ++    ++I+S  +  ++++ NP NP G V+S E +  I ++  +  + +  DE
Sbjct: 139 LPNLDTLK----KAIKSNTK--LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDE 192

Query: 337 VYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYM 392
           VY+        FHS+   +    +    IYDN   V   S SK  S   G R G++
Sbjct: 193 VYR------PIFHSLPSGVTT-PRSAAQIYDNA--VVSGSMSKAFS-LAGIRLGWI 238

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 296 RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIF 343
           +P +L  I  G NPTG  LS+E   KI+++  K+ I+++ D+ Y   +F
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLF 256

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 208 RDSGEPAYPED-IFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVL 266
           +D   P   ED + L  G+  ++  ++   C   +  +L   P Y +Y+    +N+  VL
Sbjct: 77  KDLSLPPLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVL 136

Query: 267 PYYLD-EESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVA 325
              L  E++ +  ++ ++  +++    S     ++ + +PGNPTG+ +    I KI +  
Sbjct: 137 ECPLIYEDNSFQPDSQKVISILS----SDPLIKLVFLTSPGNPTGAKIDSNIIIKILE-- 190

Query: 326 AKYGIVVIADEVY 338
           +  G  V+ DE Y
Sbjct: 191 SWDGGFVVVDEAY 203

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 72/183 (39%), Gaps = 32/183 (17%)

Query: 187 AYSSSQGVYGIRKTVADF---ITERDSGEPAYPEDIFLTAGASAAVSYLL---SILCRGQ 240
            Y S +G   +R+ + DF   +        + PE I LT GAS  V  +L   ++   G 
Sbjct: 50  TYGSDEGALWVRQAICDFSNHVFGLSDSVKSKPEFINLTGGASYGVMNILEQTTLAHTGY 109

Query: 241 ETGVLIPIPQYPLYTATL---ALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRP 297
                I  P Y L   T      N        L +   + T  +++E    +SI+ GI  
Sbjct: 110 TRQAFIVSPTYFLINETFIDAGFNGKLTAINELGDSIDFETLKSKLEHF--DSIDDGIDH 167

Query: 298 SV-LVVINP--------------------GNPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
           S  L +IN                      NP G   ++E   K+  +A K+ +++I+D+
Sbjct: 168 SKDLDLINSPSTAHPKKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARKHDMLIISDD 227

Query: 337 VYQ 339
           VY 
Sbjct: 228 VYD 230

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 73/184 (39%), Gaps = 33/184 (17%)

Query: 188 YSSSQGVYGIRKTVADFITER-----DSGEPAYPEDIFLTAGASAAVSYLL---SILCRG 239
           Y S  G   +R  +A+F          S     PE + LT+GAS  +  +L   ++   G
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTLPHTG 107

Query: 240 QETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVV-----TESIESG 294
                 I  P Y L      L+          EE G   + A +E  +     + + ESG
Sbjct: 108 YTKQAFIVTPTYFLVNKAF-LDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 295 IRPS-VLVVINP------------------GNPTGSVLSVEAIEKIFQVAAKYGIVVIAD 335
            +    L +IN                    NPTG++ S  +  K+ ++A KY I++I+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 336 EVYQ 339
           +VY 
Sbjct: 227 DVYD 230

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 94/237 (39%), Gaps = 28/237 (11%)

Query: 126 IGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRD--------AIERAKRI 177
           I N   L Q PL+   +VL + +     +   +  ++ G++K          AI +A+ I
Sbjct: 22  IRNVSTLTQIPLAPPDRVLGLTEQFVKDKNTNKVNLTVGIYKDGHGKVSTLPAITKAQEI 81

Query: 178 --LRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDI-------FLTA----G 224
             L D      +Y    G    R  V +F+  RDS  P Y + +       F+ +    G
Sbjct: 82  IDLDDALNKNLSYLPISGCPNYRDNVLNFLF-RDS-VPKYGDKLIADNRVSFIQSLSGTG 139

Query: 225 ASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIE 284
           A A  S LLS         V IP P +P +     +N    L YY     G  T    +E
Sbjct: 140 AIAVASKLLSSFI---SDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLE 196

Query: 285 GVVTE--SIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
              TE  S  S +  S+++     NPTG   +++   +I     +  ++ I D  YQ
Sbjct: 197 STETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQ 253

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 52/133 (39%), Gaps = 24/133 (18%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           DI  T G++      L I C   +T VL+    Y            + +P  LD E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLDGE---- 186

Query: 278 TNTAEIEGVVTESIESGI-----------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVA 325
                  G++ E +E  +            P +L  I  G NPTG  LS      I+ +A
Sbjct: 187 -------GIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLA 239

Query: 326 AKYGIVVIADEVY 338
            KY +++I DE Y
Sbjct: 240 QKYDMIIIEDEPY 252

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 21/137 (15%)

Query: 267 PYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVV-INPGNPTGSVLSVEAIEKIFQVA 325
           PY+ ++     T T +I+G + ++IE+  + SV V+     NPTG   + E  E++    
Sbjct: 151 PYWKED-----TKTLDIDGWL-KTIEAAKKGSVFVLHACAHNPTGMDPTPEEWEQVLDAM 204

Query: 326 AKYGIVVIADEVYQENIFAGSEFHSMKKVLR----QLQKEHPGIYDNVQLVSLHSTSKGV 381
           AKY  + + D  YQ   FA  +     K +R    +L K+ P       ++   S SK +
Sbjct: 205 AKYHHIALFDSAYQG--FASGDLDRDAKAIRLGHAKLSKQSP-------IIICQSFSKNL 255

Query: 382 SGECGQRGGYMELTGFT 398
            G  G+R G + +   T
Sbjct: 256 -GLYGERIGCLHIVNPT 271

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 218 DIFLTAGASAAVSYLLSILC-RGQETGVLIPIPQYPLYTATLALNNSH---VLPYYLDEE 273
           DI  TAG + A    L + C RG      + + +   +++ LA   +      P  +D+ 
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGD-----VILAEAHSFSSCLAAAQAQGITTFPIPIDDN 187

Query: 274 SGWSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVV 332
                   ++E ++        +P +L  I  G NPTG+ L    +E+I+++A K+  ++
Sbjct: 188 G---IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLI 244

Query: 333 IADEVY 338
           + D  Y
Sbjct: 245 VEDAPY 250

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           D+  TAG + A    L + C   +  +L+    +    A+         P  +D +    
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPIDADGIIP 192

Query: 278 TNTAEIEGVVTESIESGI-RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIAD 335
              A+    V E+   G  +P +L  I  G NPTG+ ++    E I+++A KY  +++ D
Sbjct: 193 EKLAK----VMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVED 248

Query: 336 EVY 338
           E Y
Sbjct: 249 EPY 251

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           D+F TAG + A    L + C   +  +L     +    A+         P  +D +    
Sbjct: 134 DVFATAGNTNAWESTLRLFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDADGIIP 192

Query: 278 TNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
              A+I    T +     +P +L  I  G NPTG+ ++    E I+++A K+  +++ DE
Sbjct: 193 EKLAKIMDNWTPN---APKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 337 VY 338
            Y
Sbjct: 250 PY 251

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 211 GEPAYPED---IFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLP 267
            +PAY  D   + L++G+  ++       C  + T ++      P+ +   A   +  +P
Sbjct: 146 NKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLMEEFTFTPVISHVKA-TGAECIP 204

Query: 268 YYLDEESGWSTNTAEIEGV--VTESIESG-----IRPSVLVVINPG-NPTGSVLSVEAIE 319
             ++     ST   +++ +  + ++  SG      +P +L  I  G NPTG  + +E   
Sbjct: 205 LKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRILYTICTGQNPTGVTIPMENRR 264

Query: 320 KIFQVAAKYGIVVIADEVY 338
           KI+++A K+  +++ D+ Y
Sbjct: 265 KIYELAHKHNFLILEDDPY 283

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 270 LDEESGWSTNTAEIEGVVTESIESGIRPSVLVVI-NPGNPTGSVLSVEAIEKIFQVAAKY 328
           LD   G S   +  E +   ++   I   VL  I    NP+G+  S+E   ++  +A KY
Sbjct: 158 LDHHEGESQPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKY 217

Query: 329 GIVVIADEVYQ 339
            ++VI+D+VY 
Sbjct: 218 DMLVISDDVYD 228

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
            NP+G   S+E  +K+  +A KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 21/130 (16%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           ++ +TAG ++A    L I C   +T +L     +    +          P  +D++    
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT-ILAEAHSFSSSLSAAQAQGIITFPVPIDDK---- 186

Query: 278 TNTAEIEGVVTESIESGI--------RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKY 328
                  G++ E + + +        +P +L  I  G NPTGS L  E   +++++A K+
Sbjct: 187 -------GIIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKH 239

Query: 329 GIVVIADEVY 338
             +++ DE Y
Sbjct: 240 DFLIVEDEPY 249

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 70/176 (39%), Gaps = 24/176 (13%)

Query: 187 AYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGAS-AAVSYLL-SILCRGQET-G 243
            Y   +G   +R+ + DF   R  G  + PE + L++G+S   +S LL + L     T  
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVLLHTTLPHTNFTRQ 110

Query: 244 VLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVT--ESIESGIRPSVLV 301
             I  P Y L                +DEE   S N  ++   +   E +       V +
Sbjct: 111 AFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSI 170

Query: 302 VINP------------------GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           + NP                   NP+G   S+E   K+ ++A +Y +++I D+VY 
Sbjct: 171 IQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 77/189 (40%), Gaps = 40/189 (21%)

Query: 188 YSSSQGVYGIRKTVADFITER----DSGEPAY--PEDIFLTAGASAAVSYLL---SILCR 238
           Y S +G   +R+ + +F+ ++    D G PA   PE + L  GAS  +  +L   ++   
Sbjct: 50  YGSDEGALWVREQICEFLNDQVFRFDGGSPARTRPEYLNLDNGASYGMLNILLQTTLPHN 109

Query: 239 GQETGVLIPIPQYPLYTATL----------ALN-------NSHVLPYYLDEESGWSTN-- 279
           G      I  P Y L    L          A+N       +   L   LD+    +    
Sbjct: 110 GYTRQAFIITPTYFLINDCLTDAGFNGKLTAINEKGHDSIDFESLLAALDQHEASAAAAT 169

Query: 280 --------TAEIEGVVTESIESGIRPSVLVVI-NPGNPTGSVLSVEAIEKIFQVAAKYGI 330
                   TA I+G     +   I   V+  I    NP+G+  S+E   ++ ++A KY +
Sbjct: 170 NSAAGSDPTAMIQG---SKLTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYDM 226

Query: 331 VVIADEVYQ 339
           +VI D+VY 
Sbjct: 227 LVITDDVYD 235

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 64/142 (45%), Gaps = 20/142 (14%)

Query: 211 GEPAYPE-DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYY 269
            +PAY   D+ L  G+S ++S + + L   ++  VL+    +    + +  N    +P  
Sbjct: 152 NKPAYDNWDVMLANGSSDSLSKVFTTLT-DEDVTVLMEEFTFTPTISNVTANGGIPIPLK 210

Query: 270 LDEESGWSTNTAEIEGVVTESIESGI------------RPSVLVVINPG-NPTGSVLSVE 316
           +D      T+ A  +G+  E ++  +            +P +L  I  G NPTG     E
Sbjct: 211 VD-----ITDDASQQGINVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKE 265

Query: 317 AIEKIFQVAAKYGIVVIADEVY 338
             +KI+ +  K+ I+++ D+ Y
Sbjct: 266 KRQKIYDLCEKHDIIIVEDDPY 287

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 6/59 (10%)

Query: 350 SMKKVLRQLQKEHPGIYDNVQL-VSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLK 407
           +MKK++  +QK H  I+DN +L  +    S G+  +CG+R      + FT  +R + L+
Sbjct: 403 NMKKIIDHIQKSHTNIFDNFRLNWATLLFSYGIFSKCGERQ-----SRFTDNLRCIYLE 456

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 296 RPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           R  + +V    NPTG++ S  +  K+ ++A KY I++I+D+VY 
Sbjct: 188 RYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVYD 231

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 99/224 (44%), Gaps = 30/224 (13%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHV--LPYYLDEESG 275
           ++  + G + A    L I C   + G ++   +Y   +   A     V  +P  +D    
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYSFSSCLAACEAQGVTTIPIPID---A 184

Query: 276 WSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIA 334
           +     ++E ++     +  +P +L  I  G NPTG+ L  +  E I+++A K+  +++ 
Sbjct: 185 FGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVE 244

Query: 335 DEVY--------------QENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKG 380
           DE Y              +E +++  +  S ++  + L K    +    +++ L S SK 
Sbjct: 245 DEPYYFLQVGDYIEDLKKREQVYSAPK-QSHEEFKKSLVKSFLSLDTEGRVIRLDSFSK- 302

Query: 381 VSGECGQRGGYMELTGFTHEIRQVVLKLASISL-CPVVTGQALV 423
           V G  G R G+  +TG + ++ +  + L  +++ CP    Q LV
Sbjct: 303 VLGP-GTRLGW--ITG-SKQLMKAYVSLHEMTIQCPSGFSQVLV 342

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 6/136 (4%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           D+  TAG++ A    L + C   ET VL+    Y            + +   +D++    
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKV 186

Query: 278 TNTAEIEGVVTESIESGIRPSVLVVI-NPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336
              +E+      +++ G  P +L  I N  NPTG  L  E   ++ ++A++Y  ++I D+
Sbjct: 187 DKLSEMLRDWDVAVQ-GPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDD 245

Query: 337 VY---QENIFAGSEFH 349
            Y   Q N F   E +
Sbjct: 246 PYYFLQMNEFGAPELN 261

>TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {ON}
           Anc_6.221 YPL208W
          Length = 587

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 84  NENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQV 143
           N+NV K     R  + +  +E+   L  +PS L F  +VN N+GN   +  K  S Y++ 
Sbjct: 93  NDNVRKLSMKFRPYLDLLPKEMHSPLIWNPSELQF--LVNTNLGN--SIKNKLQSIYKEW 148

Query: 144 LSILQYPEVL----EQGEEELISKGVFKRDAIERAKRIL 178
             I ++ E L    E  EE +I +   +   +E  +R+L
Sbjct: 149 YQITKFNESLFNHNEIKEEFIIYESFDELSELELYERLL 187

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 223 AGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAE 282
            GA A  S LLS+        V IP P +P +      N    + YY    S +   + +
Sbjct: 122 TGALAVASKLLSLF---MSRSVWIPNPSWPNHANVFQNNGFKEINYY----SYYKDGSLD 174

Query: 283 IEGVVTE----SIESGIRPSVLVV-INPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEV 337
           IEG + +    + + G  P  +V+     NPTG   S E  ++I     +  ++ I D  
Sbjct: 175 IEGWIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMA 234

Query: 338 YQ 339
           YQ
Sbjct: 235 YQ 236

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
            NP+G+  S+E   ++  +A KY +++I D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYD 228

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 23/33 (69%)

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
            NP+G   ++E   ++ ++A KY ++++AD+VY
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>NDAI0K02720 Chr11 complement(610291..611514) [1224 bp, 407 aa] {ON}
           
          Length = 407

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 64/161 (39%), Gaps = 8/161 (4%)

Query: 187 AYSSSQGVYGIRKTVADFITERDSGEPAYPED----IFLTAGASAAVSYLLSILCRGQET 242
           +Y    G       V +F+      +P   ED       T   + A+S   + + +    
Sbjct: 100 SYLPITGCKDFETNVTNFLFNDSINKPTLIEDNRISFIQTLSGTGAISIASTFITKFLSN 159

Query: 243 GVLIPIPQYPLYTATLALN----NSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPS 298
            ++IP   +  ++  L  N    N +  PYY       S N  +     T S +S +  S
Sbjct: 160 EIIIPNYSWANHSNILQKNGFKNNINHYPYYDPITGKLSINKWKQYLRSTHSSKSTMPRS 219

Query: 299 VLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           +L+  +  NPTG   +++  E+I  +  +  ++ I D  YQ
Sbjct: 220 ILLHASCHNPTGVDPTLKQWEEIIDIIHELKMIPIIDMAYQ 260

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 296 RPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           +P +L  I  G NPTG+ ++    E I+++A K+  +++ DE Y
Sbjct: 208 KPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPY 251

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           NP+GS  S+E   ++ ++A +Y +++I+D++Y
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 218 DIFLTAGASAAVSYLLSILC-RGQETGVLIPIPQYPLYTATLALNNSH---VLPYYLDEE 273
           D+  TAG + A    L + C RG      + + +   ++++LA   +      P  +D +
Sbjct: 134 DVVATAGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLAAAEAQGIIAFPVPIDAD 188

Query: 274 SGWSTNTAEIEGVVTESIESGIRPSVLVVINPG-NPTGSVLSVEAIEKIFQVAAKYGIVV 332
                  A+I    T       +P +L  I  G NPTG+ ++    E I+++A K+  ++
Sbjct: 189 GIIPEKLAKIMDNWTPG---APKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLI 245

Query: 333 IADEVY 338
           + DE Y
Sbjct: 246 VEDEPY 251

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 218 DIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWS 277
           D+ +TAG++ A    L + C   ++ +L    +   Y++++             E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAA----------EAQGMY 174

Query: 278 TNTAEIEG--VVTESIESGIR-----------PSVLVVINPG-NPTGSVLSVEAIEKIFQ 323
               EI+G  VV E +E  ++           P +L VI  G NP G  L+ E    I+ 
Sbjct: 175 CVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYN 234

Query: 324 VAAKYGIVVIADEVY 338
           +  KY +V+I D+ Y
Sbjct: 235 IIQKYDMVLIEDDPY 249

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
            NP+G+  S+E   ++  +A +Y ++VI D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVYD 228

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 296 RPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHS 350
           R  + +V    NP+G+  S E   K+  +A +Y I++I+D+VY    F G    S
Sbjct: 189 RYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
           NP+G   SV    K+ ++A KY I++I+D+VY 
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYD 231

>TDEL0A01850 Chr1 complement(337255..340671) [3417 bp, 1138 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1138

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 421 ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480
           AL D +   P   D   +QD    E+I  E D     L    N    ++ Q P+      
Sbjct: 330 ALFDKLRVRPVTNDNKSQQDA---EVIDLEDDGNPSELKKLDNEHGSLDDQHPQEDTMNL 386

Query: 481 PQIKLPYKAIQAAQHLEKTPD 501
            Q++L YKA Q+ + LEK P+
Sbjct: 387 NQLQLFYKATQSVESLEKLPE 407

>CAGL0H01089g Chr8 complement(102118..103005) [888 bp, 295 aa] {ON}
           similar to uniprot|Q05533 Saccharomyces cerevisiae
           YDR287w
          Length = 295

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%)

Query: 118 FDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRI 177
            +++ +A++GN   LN +P++  ++ LS+ +    LE G E    KG       +  +++
Sbjct: 133 LNQLFHASLGNGAYLNDEPINIEKRTLSLKKSIIGLEGGSEREDGKGTNFTKKFDTYRKL 192

Query: 178 LRDVGGSVGAYSS 190
           L D G  +  + S
Sbjct: 193 LSDRGAFIHGFRS 205

>Kpol_1020.45 s1020 complement(100969..105924) [4956 bp, 1651 aa]
           {ON} complement(100969..105924) [4956 nt, 1652 aa]
          Length = 1651

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 391 YMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEE 450
           YM LT F   I    + + ++  C +V    + ++ +      DE Y+ DR    + H +
Sbjct: 609 YMRLTTFGFPIPDSTICVVNLDDCTLVPDLTVGEIWISSKSLCDEFYQMDRVNEFIFHAK 668

Query: 451 LDHRAGLLHDTFNSLEGIEC-QKPRGAMYLFP 481
           LD+   L +    S+  ++  +K    M L P
Sbjct: 669 LDYPRMLSYTKGTSITAVQANEKINMIMNLCP 700

>TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}
           Anc_2.3 YNL241C
          Length = 505

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 186 GAYSSSQGVYGIRKTVADFITERDSGEP------AYPEDIFLTAG 224
           GAY ++ G   +RK++ +F +ER   EP      A P  +FLT  
Sbjct: 91  GAYDTADGYVKLRKSIEEFESERKVSEPHRLFYFALPPSVFLTVA 135

>TPHA0A02160 Chr1 (441765..443003) [1239 bp, 412 aa] {ON} Anc_8.191
           YER145C
          Length = 412

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 51/137 (37%), Gaps = 14/137 (10%)

Query: 137 LSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAK-RILRDVGGSVGAYSSSQGVY 195
           L +Y    S LQ   V+  G   LIS G+F R A      R  +  GG         G Y
Sbjct: 199 LLYYGASRSSLQVFLVISTGILYLISAGLFSRGAWYFENYRFNKATGGDASESGDGNGSY 258

Query: 196 GIRKTVADFIT---ERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYP 252
            I+K V        E D+G      DIF          YL SILC       LI      
Sbjct: 259 NIKKAVYHINCCNPELDNG-----WDIFNALLGWQNTGYLSSILCYNFYWLALIIALSLM 313

Query: 253 LYTATLALNNSHVLPYY 269
           +Y       N+H LP++
Sbjct: 314 IYEE----RNNH-LPFF 325

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVY 338
           NP+G+  S++   K+ ++A +Y +++I+D+VY
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339
            NP+G   S++   K+  +A  Y I++I D+VY+
Sbjct: 225 ANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,735,309
Number of extensions: 2495311
Number of successful extensions: 6928
Number of sequences better than 10.0: 147
Number of HSP's gapped: 7092
Number of HSP's successfully gapped: 148
Length of query: 559
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 444
Effective length of database: 40,294,809
Effective search space: 17890895196
Effective search space used: 17890895196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)