Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038908.262ON47647624380.0
KAFR0B055408.262ON51936610261e-134
ZYRO0C01650g8.262ON5863669421e-121
SAKL0H17028g8.262ON5503659111e-117
NDAI0J013808.262ON6243629091e-115
NCAS0B038508.262ON5883628731e-110
YDR110W (FOB1)8.262ON5663938711e-110
Suva_2.2708.262ON6324018761e-110
Smik_4.3568.262ON5764018671e-110
KLTH0G13684g8.262ON5083708441e-107
Skud_4.3718.262ON5803648491e-107
Kwal_56.237998.262ON4883738381e-106
AGR086C8.262ON5343467898e-99
Ecym_43088.262ON5293497871e-98
Kpol_543.388.262ON4423897671e-96
CAGL0B01771g8.262ON5363727428e-92
Kpol_392.68.262ON4573487315e-91
KLLA0F19140g8.262ON5273747226e-89
KNAG0H032408.262ON5193776354e-76
TBLA0E044308.262ON4813665575e-65
TPHA0J007408.262ON4083964844e-55
TPHA0A018108.262ON4573624524e-50
TBLA0F030708.262ON4453674351e-47
NDAI0D03010na 1ON778133930.010
NCAS0A06040na 1ON588177810.27
SAKL0H00550g5.13ON551112751.2
KLTH0G13838g8.256ON121472741.8
KLLA0C14113g5.13ON54189741.8
TBLA0E029805.564ON43867704.6
NDAI0C054408.526ON94174714.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03890
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   943   0.0  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   399   e-134
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   367   e-121
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   355   e-117
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   354   e-115
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   340   e-110
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   340   e-110
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   342   e-110
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   338   e-110
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   329   e-107
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   331   e-107
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   327   e-106
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   308   8e-99
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   307   1e-98
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   300   1e-96
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   290   8e-92
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   286   5e-91
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   282   6e-89
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   249   4e-76
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   219   5e-65
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   191   4e-55
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   178   4e-50
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   172   1e-47
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    40   0.010
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    36   0.27 
SAKL0H00550g Chr8 (67033..68688) [1656 bp, 551 aa] {ON} similar ...    33   1.2  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...    33   1.8  
KLLA0C14113g Chr3 (1220244..1221869) [1626 bp, 541 aa] {ON} simi...    33   1.8  
TBLA0E02980 Chr5 (741757..743073) [1317 bp, 438 aa] {ON} Anc_5.5...    32   4.6  
NDAI0C05440 Chr3 complement(1260473..1263298) [2826 bp, 941 aa] ...    32   4.8  

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/476 (95%), Positives = 453/476 (95%)

Query: 1   MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMEL 60
           MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMEL
Sbjct: 1   MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMEL 60

Query: 61  LERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRY 120
           LERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRY
Sbjct: 61  LERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRY 120

Query: 121 YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM 180
           YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM
Sbjct: 121 YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM 180

Query: 181 AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRD 240
           AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRD
Sbjct: 181 AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRD 240

Query: 241 YHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNM 300
           YHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNM
Sbjct: 241 YHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNM 300

Query: 301 KLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPND 360
           KLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPND
Sbjct: 301 KLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPND 360

Query: 361 LLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLLYLXXXXXXXXXXXXXXXXXXXXX 420
           LLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLLYL                     
Sbjct: 361 LLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLLYLEDENSDVFEEEEEQDDNESDD 420

Query: 421 XXMSPGLPPGRIINSATQTPERSVEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476
             MSPGLPPGRIINSATQTPERSVEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ
Sbjct: 421 SEMSPGLPPGRIINSATQTPERSVEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  399 bits (1026), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/366 (48%), Positives = 260/366 (71%), Gaps = 1/366 (0%)

Query: 35  VKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTP 94
           +K  ++ P MGESY  Y +S+MN+ELL+RGE+++ K+Q+SING +    Y+LIRT+SLTP
Sbjct: 43  IKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTP 102

Query: 95  ETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLM 153
           ETLAS + KW K +AE +Y+FL RRYY +N G++ D  + DKIVCEP+ +FD+IM  HLM
Sbjct: 103 ETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM 162

Query: 154 NDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLE 213
           N+H   + I+  L+  YSNITRD    A+++CS CNP+     LEK++H+NI+  L+PLE
Sbjct: 163 NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLE 222

Query: 214 RVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYV 273
           RVHIEIFE F NE I  K++++LYCRDYH+R++W+ PLKNTKFKHLV  + +L L     
Sbjct: 223 RVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQ 282

Query: 274 PIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCIS 333
           PIF+E+++LD QD+FDICE++  +Y++++GLG +  + FH  GI++MK  L   + +C+ 
Sbjct: 283 PIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLL 342

Query: 334 DWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN 393
            WN+CL+YG Y  N RHN  AGG+P DLL          F+ K   I++   +++V+ V+
Sbjct: 343 SWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVD 402

Query: 394 KGLLYL 399
            GL++L
Sbjct: 403 NGLIFL 408

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  367 bits (942), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 256/366 (69%), Gaps = 5/366 (1%)

Query: 37  SQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPET 96
            +F+ P M + +       MN+ LLE+G ++ L++Q ++ GQ+   IYELIR+++L+   
Sbjct: 36  GEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIAN 95

Query: 97  LASNSDKWDKDSAESKYMFLMRRYYA--ENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMN 154
           L     KW  +S+E +Y +L  RY+   ENG+V DR++ D+IVCEP  +F L+MC+HL N
Sbjct: 96  L-ERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQN 154

Query: 155 DHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLER 214
           +H+T   I+  L K Y+NITRD++  A+ YCS CNPD   +P +K RHKN++  LLPLER
Sbjct: 155 NHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLER 214

Query: 215 VHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVP 274
           VHIE+FE FD E I  +F+++LY RDY +R+VW+ PL+N K KH++ A+ + LLG+  +P
Sbjct: 215 VHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIP 274

Query: 275 IFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISD 334
           IF+ES+T+D++ LFD+C Q+   Y++KLGLG  +S +FH NGIK MK+LL + K +C+ D
Sbjct: 275 IFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQD 334

Query: 335 WNMCLRYGPYHLNRRHNTLAGGIPNDLLYHS-DHTNRKHFRPKQEMIIDELPAQNVVHVN 393
           WN+CL+YGP+H+N+  N  + G P DLL+ S    NRK  + + ++I+D  P+Q VVH+ 
Sbjct: 335 WNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILD-TPSQQVVHLG 393

Query: 394 KGLLYL 399
           +G+L+L
Sbjct: 394 EGVLFL 399

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  355 bits (911), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 178/365 (48%), Positives = 250/365 (68%), Gaps = 5/365 (1%)

Query: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98
           ++ P +GES   Y+   +N+ELLERG +D +KY ES+ GQ+    YELI+T++LT ETL 
Sbjct: 26  YVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84

Query: 99  SNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
           + +D     +AE+KY+FL RRYY + + IVRD ++ D IVCEP  +++LI+  HL+N+H+
Sbjct: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217
            +R ++  L   YSNITRDFVQM  RYCS CNP    +P  K++H N ++GLLPLER+H+
Sbjct: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204

Query: 218 EIFEVFD-NESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIF 276
           EIF+ F  +E I  K+++VLYCRDYH+RFVWL+PL    F+ LV  +   LL +  +PIF
Sbjct: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264

Query: 277 MESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWN 336
           +E++TLD+QD+FD+CE +  KY + +GLG N+SS F+ NGI+RMK LL T K  C  DW 
Sbjct: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324

Query: 337 MCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NK 394
           MCL+YG YH N  +N    G  NDLL +   +  K F+ K+E II EL A NVV +    
Sbjct: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384

Query: 395 GLLYL 399
           G++Y+
Sbjct: 385 GMVYV 389

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  354 bits (909), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 169/362 (46%), Positives = 247/362 (68%), Gaps = 4/362 (1%)

Query: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98
           +L P++GESY +Y +  ++++LL+RGE   L +Q SI+GQ+   +YELIRT SLT ETLA
Sbjct: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150

Query: 99  SNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
           +N   +    A ++     RRY A+N G VRD+ +G++IVC+P+ +++++M  HLMNDH 
Sbjct: 151 ANFPHF---HAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217
            YR  +  L+ IY+NITRDF+  AV++CS CNP     PL K++H N +KG+LPLERVHI
Sbjct: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHI 267

Query: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277
           EIFE F+ + I  K+++V+YCRDY +R++ L PLKNTKFK+LVSA+  LL  +  +PIF+
Sbjct: 268 EIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFI 327

Query: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337
           E+ +L+ QD FDI E +  KY + +GLG  ++ +FH  G+K+MK LL   + +C++DW M
Sbjct: 328 ETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTM 387

Query: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLL 397
           CL+YGP++ N +HN  A G+P DLL  +          K E II  LP  N+V +  G +
Sbjct: 388 CLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGSI 447

Query: 398 YL 399
           YL
Sbjct: 448 YL 449

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  340 bits (873), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/362 (43%), Positives = 237/362 (65%), Gaps = 1/362 (0%)

Query: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98
           +L P++GE YK+Y +  M++  ++RGE++  ++Q++INGQ+    YELI+TNSLT ETL+
Sbjct: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141

Query: 99  SNSDKWDKDSAESKYMFLMRRY-YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
           + + K DK  A S+ +FL RRY   E G VRD+ + +++VCEP+ I+D+IM  HL+NDH 
Sbjct: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217
             R  +  L  +YSNITR FV+   ++CS CNP     P +KY+H N FKGLLPLERV +
Sbjct: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261

Query: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277
           E+FE F  E +  K+  +LY RDY +RF+W+ PL+N+KF HLV  +  ++  M  +PIF 
Sbjct: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321

Query: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337
           E++T++ QD FDI E++  KY + +GLG     +   NG+ +++KLL   K +C++DW M
Sbjct: 322 ETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIM 381

Query: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLL 397
           CL+YGP+  N + N  A G+P DLL             K E I+ +LP +N+V + +G +
Sbjct: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGCI 441

Query: 398 YL 399
           YL
Sbjct: 442 YL 443

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  340 bits (871), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/393 (43%), Positives = 251/393 (63%), Gaps = 13/393 (3%)

Query: 10  QRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLL 69
           QRR         ++ +D++L          + PSMGESY EY +SY+N+ELLERGE++  
Sbjct: 27  QRRKATSPGESRESSKDRLL----------ILPSMGESYTEYVDSYLNLELLERGERETP 76

Query: 70  KYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVR 128
            + ES+  Q+   IYELI+T SLT +TL   SDK+D   AE+K +FL R+YY ++ G VR
Sbjct: 77  IFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVR 136

Query: 129 DRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSC 188
           D R  DKI CEP  ++D++M  HLMN H+  + +++ L   ++NI+   +    ++CS C
Sbjct: 137 DGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC 196

Query: 189 NPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWL 248
           N  G  +PL++Y+  +++  LLP+ER+HIE+FE F+ E+I  K++ VL CRDY + F+WL
Sbjct: 197 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWL 256

Query: 249 APLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANS 308
            PLK+TKFKHL+  V +L L    VPIF+ SSTLDK DL+DICE++  KY +++GLG  S
Sbjct: 257 LPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 316

Query: 309 SSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHT 368
           S++FH  GI  ++  LN+ K +C++DW  CLRYGPY  NRR N      P  +L      
Sbjct: 317 SARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPG 376

Query: 369 NRKHFRPKQEMIIDELPAQNVVHV--NKGLLYL 399
           +   F  K+E +I+   ++N+  +   KGL+YL
Sbjct: 377 HNAKFETKRERVIENTYSRNMFKMAGGKGLIYL 409

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 436 ATQTPERS-------VEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476
            T+ PE+           +  S EI+ P TS+YQ L SPS KR +L Q
Sbjct: 503 GTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLESPSTKRQKLDQ 550

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  342 bits (876), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 171/401 (42%), Positives = 254/401 (63%), Gaps = 13/401 (3%)

Query: 2   ASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELL 61
           ++K  ++ QRR         ++ +D++L          + P MGESY EY +SY+N+ELL
Sbjct: 72  SAKSKSSPQRRKTTSPRESRESLKDRLL----------ILPLMGESYTEYVDSYLNLELL 121

Query: 62  ERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYY 121
           ERGE++   + ES+  Q+   IYELI+T SLT ETL   SDK+D  +AE+K +FL R+YY
Sbjct: 122 ERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYY 181

Query: 122 AEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM 180
            +N G VRDRR  DKI CEP  I+D++M  HLMN H+  + +++ L   ++N +   +  
Sbjct: 182 VDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDW 241

Query: 181 AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRD 240
             ++CS CN  G  +PL++Y+  +++  LLP+ER+HIE+FE +  ++I  K+  VL CRD
Sbjct: 242 VQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRD 301

Query: 241 YHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNM 300
           Y + F+WL PLK+TKFKHL+  V +L L    +PIF+ SSTLDK DL+DICE++  KY +
Sbjct: 302 YRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGL 361

Query: 301 KLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPND 360
           ++GLG  SS++FH  GI  ++  LN+ K +C++DW  CLRYGPY  NRR N      P  
Sbjct: 362 RIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPTQ 421

Query: 361 LLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NKGLLYL 399
           +L      +   F  K+E +I+   A+N+  +   KGL+YL
Sbjct: 422 VLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYL 462

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  338 bits (867), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 171/401 (42%), Positives = 254/401 (63%), Gaps = 14/401 (3%)

Query: 2   ASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELL 61
           A++K  +  R+     E+  D+ +D++L          + PSMGESY EY +SY+N+ELL
Sbjct: 22  ATRKAPSQGRKATSSRESR-DSSKDRLL----------ILPSMGESYTEYVDSYLNLELL 70

Query: 62  ERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYY 121
           ERGE++   + ES+  Q+   IYELI+T SLT +TL   SDK+D   AE+K +FL R+YY
Sbjct: 71  ERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYY 130

Query: 122 AEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM 180
            ++ G VRD R  DKI CEP  I+D++M  HL+N H+  + +++ L   ++NI+   +  
Sbjct: 131 VDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDW 190

Query: 181 AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRD 240
             ++CS CN  G  +PL++Y+  +++  LLP+ER+HIE+FE F  E+I  K++ VL CRD
Sbjct: 191 VQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRD 250

Query: 241 YHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNM 300
           Y + F+WL PLK+TKFKHL+  + +L L    VPIF+ SSTLDK DL+DICE++  KY +
Sbjct: 251 YRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGL 310

Query: 301 KLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPND 360
           ++GLG  SS++FH  GI  +   LN+ K +C++DW  CLRYGPY  NRR N      P  
Sbjct: 311 RIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQ 370

Query: 361 LLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NKGLLYL 399
           +L      +   F  K+E +I+   ++N+      KGL+YL
Sbjct: 371 VLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYL 411

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 436 ATQTPERSVEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476
           A  TP+   E +  S EI++P TS++Q + SPS KR +L Q
Sbjct: 521 ADATPQTEPE-VDQSLEIAKPETSYFQTMESPSTKRQKLDQ 560

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  329 bits (844), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/370 (42%), Positives = 245/370 (66%), Gaps = 8/370 (2%)

Query: 36  KSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPE 95
           K +F  P++GE  ++Y N  +N+ELLERG  D +KYQES+ GQ+    ++L+R+ SLT +
Sbjct: 16  KVEFDMPAVGEPIEKYHNG-LNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTED 74

Query: 96  TLASNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLMN 154
            L + SDK    + E+K++ L RRYY + +GIVRD +  D +VCEP  +FDLIMC HL N
Sbjct: 75  NLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKN 134

Query: 155 DHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLER 214
            H+ +R +++ L   Y+N TR F Q+ V+YCS CNP+   RP +K+RH NI+ GLLPLER
Sbjct: 135 GHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLER 194

Query: 215 VHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVP 274
           VH+EI   F +E+I   +++VL+ RDY++RFVW+ PLK    + +   +   LL +  +P
Sbjct: 195 VHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIP 253

Query: 275 IFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISD 334
           IF+E+ST+D+QDLF+ CE + G+Y++ +GLG + SS F  NG++R++ LL   +  C+  
Sbjct: 254 IFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRS 313

Query: 335 WNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN- 393
           W MCL+YG  + N  +N    G+P +LL+ +     + F  K+E +I++L A+NVV +  
Sbjct: 314 WYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKV 373

Query: 394 ----KGLLYL 399
               +G++YL
Sbjct: 374 SGRRRGIIYL 383

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  331 bits (849), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 163/364 (44%), Positives = 235/364 (64%), Gaps = 3/364 (0%)

Query: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98
            + PSMGESY  Y +SY+N+ELLERGE++   + ES+  Q+   IYELI+T SLT +TL 
Sbjct: 49  LILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQ 108

Query: 99  SNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
             SDK+D   AE+K +FL R+YY +N G VRD R  DKI CEP  I+D++M  HLMN H+
Sbjct: 109 QISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHL 168

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217
             + +++ L   ++N +   +    ++CS CN  G  +PL++Y+  +++  LLP+ER+HI
Sbjct: 169 RGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHI 228

Query: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277
           E+FE F   +I  K+  VL CRDY + F+WL PLK+TKFKHL+  + +L L    VPIF+
Sbjct: 229 EVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 288

Query: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337
            SSTLDK DL+DICE++  KY + +GLG  SS++FH  GI  ++  LN+ K +C++DW  
Sbjct: 289 TSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGK 348

Query: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NKG 395
           CLRYGPY  NRR N      P  +L      +   F  K+E +I+   ++N+  +   KG
Sbjct: 349 CLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKG 408

Query: 396 LLYL 399
           L+YL
Sbjct: 409 LIYL 412

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 447 MHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476
           +  S EI+ P+TS+YQ   SPS KR +L Q
Sbjct: 535 VDQSVEITRPDTSYYQTAASPSIKRQKLNQ 564

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/373 (42%), Positives = 241/373 (64%), Gaps = 10/373 (2%)

Query: 33  NGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSL 92
           +GVK  F  P +GE+ ++Y N  +N ELL RG  D +KYQES+ GQ+    ++L+R+++L
Sbjct: 15  DGVK--FRMPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSAL 71

Query: 93  TPETLASNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAH 151
           T E L S SDK    + E+K++ L RR+Y + +G VRD +  D +VCEP  +FDLIMC H
Sbjct: 72  TAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGH 131

Query: 152 LMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLP 211
           L N H+ +R ++  L + Y+N TR F Q+ VRYCS CNP+   RP  K+RH NI+ GLLP
Sbjct: 132 LKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLP 191

Query: 212 LERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMT 271
           LERVH+EI   F  + I   +++VLY RDY++RFVW+ PL + +   +  A  T LL + 
Sbjct: 192 LERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250

Query: 272 YVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDC 331
            VPIF+E+STL +QDLF++CE +  +Y + +GLG + S+ F  NG++R++ LL   +  C
Sbjct: 251 RVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPC 310

Query: 332 ISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVH 391
           +  W+MCL++G  + N  +N    G+P +LL+ +     + F  K+E +I++L A NVV 
Sbjct: 311 LKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVE 370

Query: 392 V-----NKGLLYL 399
           +      +G++YL
Sbjct: 371 LRNEGRRRGMIYL 383

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  308 bits (789), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 227/346 (65%), Gaps = 5/346 (1%)

Query: 59  ELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMR 118
           E ++RG  +L K  +++ GQ+   IY+LI +++L+ + L    DK   ++ E+KY+ L R
Sbjct: 48  EWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKR 107

Query: 119 RYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFV 178
           RY A+ GIV DR++ D  V EP  +FD+IM AHL+NDHM +R +Y  +  +Y+N+TR+  
Sbjct: 108 RYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELT 167

Query: 179 QMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNES---ISNKFTNV 235
            M   YCS CN D   R   +Y+H N+ + L+PLER H+E+F  FD+E    I  K+++ 
Sbjct: 168 NMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHF 227

Query: 236 LYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLC 295
           LYCRDYH+RF+WL PL+   F++L+ A+  LL  M  VPIF+E++TLD+QD+FDICE + 
Sbjct: 228 LYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIA 287

Query: 296 GKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAG 355
            +Y  K+GLG NS ++F  NGIKR+K+LL+  K +C  DWNMCLR     +N+ +     
Sbjct: 288 RRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVR 347

Query: 356 GIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNK--GLLYL 399
           GIP+DLL +        F+ KQ+ IID+L A +VVH  +  G++YL
Sbjct: 348 GIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYL 393

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  307 bits (787), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 221/349 (63%), Gaps = 5/349 (1%)

Query: 56  MNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMF 115
           ++ + L+ G  +L+K   ++ GQ+   IYELI +N+L+ +TL    DK    + E+K++ 
Sbjct: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110

Query: 116 LMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITR 175
           L RRY    G V D ++ D  V EP  +FD+IM AHL+N H+ +R I+  L  +Y+N+TR
Sbjct: 111 LKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTR 170

Query: 176 DFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFD---NESISNKF 232
           DF  +   YCS CN D + +   +Y+H N++  ++PLER H+EIF  FD   NE I +K+
Sbjct: 171 DFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKY 230

Query: 233 TNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICE 292
           ++VLYCRDYH+RFVW+ PL+   F+ LV A+  LL  M  +PIF+E++TLD+QD+FD+CE
Sbjct: 231 SHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCE 290

Query: 293 QLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNT 352
            +  KY +K+GLG NS + F  NG+ R+K L    K  CI +WNMCLR     +N+ ++ 
Sbjct: 291 YIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSD 350

Query: 353 LAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNK--GLLYL 399
              GIP+DLL +        F+ KQ  IIDEL A +VV   +  G++YL
Sbjct: 351 RVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYL 399

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  300 bits (767), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 153/389 (39%), Positives = 240/389 (61%), Gaps = 6/389 (1%)

Query: 13  NVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQ 72
           N + D+  +   E K ++ Y  V   F  P +G +  EY +S  ++  LE G     +Y 
Sbjct: 19  NQVIDDTLAPISEFKEVNRYGKV--VFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYL 76

Query: 73  ESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRY-YAENGIVRDRR 131
           +SI G +   +YELIR + L  +TL+  + +W + +A +K ++L RRY   + G V D  
Sbjct: 77  DSIIGTLSQTVYELIRDDLLDVDTLSEKT-RWSRINANAKCLYLKRRYKLTKKGTVIDLT 135

Query: 132 KGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPD 191
           + +KIV EP   +D I+  H++N H+ Y+ I+  L  IYSN++RD+++M + +CS CNPD
Sbjct: 136 RENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPD 195

Query: 192 GHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPL 251
                LEK  H NI++  LPLERV ++IFE F+NE I N++++++Y RDY +RFVW+ PL
Sbjct: 196 KVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPL 255

Query: 252 KNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQ 311
           KNTKFK L S +G LLL +  +PI+++++T++++D+  IC+++  KY + LG+G    S 
Sbjct: 256 KNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSS 315

Query: 312 FHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRK 371
           F+  G+ R+K LLN  K  C+ DWNMCL+ G Y+ N++  T A G+P++L       +  
Sbjct: 316 FYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSAT 375

Query: 372 HFRPKQEMIIDELPAQNV--VHVNKGLLY 398
            F  K+  II+ LP QN      NKGL+Y
Sbjct: 376 TFESKRTEIINSLPIQNSYKTSTNKGLVY 404

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  290 bits (742), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 148/372 (39%), Positives = 227/372 (61%), Gaps = 19/372 (5%)

Query: 37  SQFLAPSMGESYKEY---ANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLT 93
           ++F+ P++ E+Y++Y    +S ++++ L+RGE+D+ ++ E + G++    Y L+  N+LT
Sbjct: 58  NKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLT 117

Query: 94  PETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHL 152
            ET+    + W  ++AE+KY  L++R+Y +  G +RD +  + IV EP  +F+LI+ AHL
Sbjct: 118 METVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177

Query: 153 MNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPL 212
            N H+    ++ CL ++Y+N TRDFVQ A+ YC+ CNPD + +P+EK RH+NI + LLPL
Sbjct: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237

Query: 213 ERVHIEIFEVFDNES--------------ISNKFTNVLYCRDYHTRFVWLAPLKNTKFKH 258
           ERVHIE+F  F+ E               I  K+++V YCRD+ TR+VW  PLKN KFK 
Sbjct: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297

Query: 259 LVSAVGTLLLGMTY-VPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGI 317
           LV  + T  + + Y  PIF+ESST+D+ DL +I E L  KY +KLGLG  + ++FH  GI
Sbjct: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357

Query: 318 KRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQ 377
           KR K  L+  K +C  DW MCL+ G Y  NR      G   N L         +  R K+
Sbjct: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKK 417

Query: 378 EMIIDELPAQNV 389
              I++  ++N+
Sbjct: 418 LKYIEQSFSENI 429

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  286 bits (731), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 221/348 (63%), Gaps = 5/348 (1%)

Query: 52  ANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAES 111
           + S +N EL  RG QDL K+Q +ING +   IY+LI T+ LTP+ ++    KW   S E 
Sbjct: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE- 131

Query: 112 KYMFLMRRYYAEN--GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKI 169
           KY FL  RYY  +    VRDRR  DKI+C P  + ++++C HL+N+H  ++ ++  L+K 
Sbjct: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191

Query: 170 YSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNES-I 228
           Y+NI+R   ++++ YCS CNP  H +PL+K +   +++GLLP ER+HIEIF+ F +E  I
Sbjct: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251

Query: 229 SNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLF 288
              ++++LY RDY++R+VWL PLK T FK L   + T    +T  PI++ESST+++ DL 
Sbjct: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311

Query: 289 DICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNR 348
            + +++  KY++++G+G  +SS FH NG++ MK+LL   + +C+ DW MCL+YG    N 
Sbjct: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371

Query: 349 RHNTLAGGIPNDLLYHSDHTN-RKHFRPKQEMIIDELPAQNVVHVNKG 395
             N    G+P +LL +S  +     ++ K+  +IDE    N++ ++ G
Sbjct: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNG 419

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  282 bits (722), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 140/374 (37%), Positives = 218/374 (58%), Gaps = 13/374 (3%)

Query: 38  QFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETL 97
           +F+ P  G     +    ++ ++L  G   L K   ++ GQ+  PIY+L+ +++LT E L
Sbjct: 56  KFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENL 114

Query: 98  ASNSDKWDKDSAESKYMFLMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
              SDK    + E+K++ L RRYY +  ++ D ++ D +V EP  +FDLIM  H++N H+
Sbjct: 115 LRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217
           + + IY  L+  Y+N+T+ F ++   +CS CN  G+    +K++H+NI   L+PL R H+
Sbjct: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234

Query: 218 EIFEVFDNE----------SISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLL 267
           EIF  FD+            I  K+  VLYCRDY++R+VWL PLK+     L+  +  LL
Sbjct: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294

Query: 268 LGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTR 327
             M  +PIF+++ TLD+QD+FD+CE +   Y +K+GLG NSS+ F   GIKRMK L    
Sbjct: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354

Query: 328 KVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQ 387
           K +C+ DWNMCL+     LN+ ++    G+P+DLL  +     K FR  Q  +I  L   
Sbjct: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414

Query: 388 NVVHVNK--GLLYL 399
           +VV   +  G++YL
Sbjct: 415 HVVQFEEAGGMIYL 428

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  249 bits (635), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 214/377 (56%), Gaps = 7/377 (1%)

Query: 26  DKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYE 85
           D+I   ++   +  L P +G+ +  YA+  +++E  +RGE+D+  Y  +  G++   +Y 
Sbjct: 21  DRIESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYA 80

Query: 86  LIRTNSLTPETLASNSDKWDKDSAES-KYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCI 143
           L + + +T E +A      D+   ES K M++ RRYY + NG++RD    ++IV +P+  
Sbjct: 81  LFKNDDVTKENIARLYPT-DRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHT 139

Query: 144 FDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHK 203
           FD+IM  HLMN H+    +Y CL + Y+N     ++  + YCS CNP     P  K + K
Sbjct: 140 FDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP--KVQPK 197

Query: 204 N-IFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSA 262
             +F+  LPLER+ IEI E F NE +  K++N++  +D+  RF WL PLKNTKFK++V  
Sbjct: 198 PYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPV 257

Query: 263 VGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKK 322
           V  ++L    VPI++ES+TLD  DLFDI E +  KY +K+GLG  + S        R+ +
Sbjct: 258 VAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSS-AAQATARINR 316

Query: 323 LLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIID 382
            LN    +C+ D+N CL+YGP   N+         P D++ HS+   +  FR K+  I+ 
Sbjct: 317 DLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILK 376

Query: 383 ELPAQNVVHVNKGLLYL 399
             P+  V++   G LYL
Sbjct: 377 HSPSSCVMNRGMGTLYL 393

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  219 bits (557), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 207/366 (56%), Gaps = 20/366 (5%)

Query: 44  MGESYKEY---ANSYMNMELLERGEQDLLKYQESINGQVLHPIY-ELIRTNSLTPETLAS 99
           +G SY +Y    NS +N+ELLE+G +D+ +Y  SI   VL   Y +++ T +L+PE +  
Sbjct: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYH-SIKAAVLTQEYCDMLNTGTLSPENIIK 93

Query: 100 NSDKWDKDS-AESKYMFLMRRYYA-ENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157
              K    S A  KY F  RRYY  E+  + D+RK  +I+CEP  ++D+++  HL   H 
Sbjct: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHS 152

Query: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDG--HFR------PLEKYRHKNIFKGL 209
           +Y  +   L K +SN+ R ++    +YCS C PD   H +        +  R+  I + L
Sbjct: 153 SY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211

Query: 210 LPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLG 269
            P+ER+HIEIF  FD+  I NK+  +LY RDY TR++W   LK  K KH+ + +    L 
Sbjct: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271

Query: 270 M-TYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSS-SQFHINGIKRMKKLLNTR 327
           + T VPIF++SST+D  DLFDICE++  +Y++ LGLG N+    FH++GI+  K+L+N  
Sbjct: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331

Query: 328 KVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSD-HTNRKHFRPKQEMIIDELPA 386
           K  C+  W+  L +G    N + N+     P D++  ++    +K FR ++  II +   
Sbjct: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391

Query: 387 QNVVHV 392
            N V +
Sbjct: 392 DNYVKL 397

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  191 bits (484), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 204/396 (51%), Gaps = 21/396 (5%)

Query: 8   TLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQD 67
           TL+R++ + D    D+  D+I+        +   P +   YK    S +++E +  G  D
Sbjct: 3   TLKRKHDMID----DSNNDRII--------KVDIPELDILYKIELGSDIDIERINHGRND 50

Query: 68  LLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDS------AESKYMFLMRRY- 120
            L+ +   +  +   +Y LIR  +   ET          DS      A  K+M +  RY 
Sbjct: 51  HLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQ 110

Query: 121 YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQM 180
             E G + D+R   K++  P  I+DLIM  H +NDH+    I+  L + YSNI+R  V++
Sbjct: 111 LNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRL 170

Query: 181 AVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVF-DNESISNKFTNVLYCR 239
           +++ CS CNP   ++ +E  RH +  K     E++H+EIF+ F D ++ +NKF++V+Y R
Sbjct: 171 SLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFEDVDTFANKFSHVIYIR 229

Query: 240 DYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYN 299
           DY TR+VWL PL+    K L + + T LL    +PI++ES TLD+ +L  I +++    N
Sbjct: 230 DYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTN 289

Query: 300 MKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPN 359
           + LG+G     +F  +GI  MK+L    +  C ++WN  +     H N  +N    GIP 
Sbjct: 290 LILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPL 349

Query: 360 DLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKG 395
           +L+      + K ++ K++  I    ++N + +  G
Sbjct: 350 NLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNG 385

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  178 bits (452), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 101/362 (27%), Positives = 199/362 (54%), Gaps = 12/362 (3%)

Query: 38  QFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETL 97
           +++ P +G+ Y       ++ +LL++GE   +    S    +   +Y+L++ + LT + +
Sbjct: 30  KYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNV 86

Query: 98  ASNSDKWDKDSAESKYMFLMRRYYAENGI-VRDRRKGDKIVCEPLCIFDLIMCAHLMNDH 156
           A  +   D+ +A ++ + L  RYY ++ + V DR K +KIV +P   F ++M  HL+NDH
Sbjct: 87  AV-ALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDH 145

Query: 157 MTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVH 216
           +T   IY  L+K ++N++  F++ ++ YCS CN +      +K    +    +L  ER+ 
Sbjct: 146 LTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLI 205

Query: 217 IEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIF 276
           +++   F  + I  ++T++L   D+HT+F+W  PLKN K + ++S V   ++ +   P+F
Sbjct: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265

Query: 277 MESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWN 336
           + S TL   D+F++C  L  +YN+ +GLG  +  + +      + ++LN+ K +C+  W 
Sbjct: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKSWF 324

Query: 337 MCLRYGPYHLNRRHNTLAGGIP---NDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN 393
           MCL++     +R+ N+     P   N  L+       K +  + +MII  LP++N ++++
Sbjct: 325 MCLKWLA---DRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINID 381

Query: 394 KG 395
           +G
Sbjct: 382 EG 383

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 191/367 (52%), Gaps = 22/367 (5%)

Query: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSL------ 92
           F  P +G+  + Y +SY++ ++L+RGE++ ++++ ++   +   +Y  +R  SL      
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 93  TPETLASNSDKWDKDSAESKYMFLMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHL 152
            P +L   +         SK M+L  RY   +       K +K++CEP  I+ L M AH 
Sbjct: 88  IPASLKIKT---------SKKMYLQIRYSKNSDGDLIETKTNKLLCEPKYIYKLTMKAHF 138

Query: 153 MNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEK-YRHKNIFKGLLP 211
           MN+HM    +Y  L+  Y NI    V + ++YCS CN  G  R +   Y  +N +   LP
Sbjct: 139 MNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLP 198

Query: 212 LERVHIEIFEVFDNESI--SNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLG 269
           LER+ I+I + F++  I  +NK++++L  RDYH+R+ W+ PLK+   K++ + +G  L+ 
Sbjct: 199 LERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258

Query: 270 MTYVPIFMESSTLDKQDLFDICEQLCGKY--NMKLGLGANSSSQFHINGIKRMKKLLNTR 327
           +   PIF+ S  + +  L  I  ++  +Y   +++G+G      F   GI R+  LLN +
Sbjct: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLK 318

Query: 328 --KVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELP 385
             K  C SDW  C+R   +  NRR +   G   N L+        K F  K++ ++ +L 
Sbjct: 319 ENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378

Query: 386 AQNVVHV 392
            +NV+ +
Sbjct: 379 EENVLKI 385

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 50/133 (37%), Gaps = 23/133 (17%)

Query: 136 IVCEPLCIFDLIMCAH--------LMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSS 187
           I C P  +  +I C H         +  H     I + L   Y NI++  +   V  C  
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 188 CNPDGHFRPLEKYRHKNIFKGLLPL-----ERVHIEIFEVFDNESISNK----FTNVLYC 238
           C      +PL   +       +LPL     +R+ ++I    D   +  K       +LY 
Sbjct: 214 C------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYI 267

Query: 239 RDYHTRFVWLAPL 251
            DYH+  VWL  L
Sbjct: 268 GDYHSGAVWLFAL 280

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 67/177 (37%), Gaps = 23/177 (12%)

Query: 107 DSAESKYMFLMRRYYAENGIVRDRRKGD---KIVCEPLCIFDLIMCAHLMND-------- 155
           D   ++Y+ +  + YA     R   KGD   K+ C P  +   I+  H   D        
Sbjct: 109 DYITARYVVIDEKIYA-----RKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKA 163

Query: 156 -HMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLER 214
            H      +  + +  S ITR  +Q     C  CN       +  Y   +  K  +P E 
Sbjct: 164 RHRGVAATHDAIGEKMSGITRQLIQDVTYDCLKCNVTKGVPII--YVPDDNPKAEVPFEN 221

Query: 215 VHIEIFEVFDNE----SISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLL 267
           + I+I ++ D        + K + +L+  D +T + WL  L +T    +      LL
Sbjct: 222 LLIDIIDLKDRSCRCPKDNKKKSQILHIMDQYTEYTWLYILDDTHHDAIAMIFEVLL 278

>SAKL0H00550g Chr8 (67033..68688) [1656 bp, 551 aa] {ON} similar to
           uniprot|P22146 Saccharomyces cerevisiae YMR307W GAS1
           Beta-1.3-glucanosyltransferase required for cell wall
           assembly localizes to the cell surface via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 551

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 9/112 (8%)

Query: 259 LVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIK 318
           + S +  L+L   +V  F  ++  DK       E +  K+       +N+ SQF++ GI 
Sbjct: 1   MTSCLNLLILLFAHVLTFATAADSDKDSSTPAIEIVGNKF-----FYSNNGSQFYMKGIA 55

Query: 319 RMKKLLNTRKVDCISD----WNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSD 366
                 N+   + I+D    +  C R  PY L+ + NT+     N  L H+D
Sbjct: 56  YQADTANSTSGETINDPLANYETCKRDLPYLLDLQTNTIRIYAVNTSLDHTD 107

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON}
           similar to uniprot|Q12465 Saccharomyces cerevisiae
           YLR084C RAX2 N-glycosylated protein involved in the
           maintenance of bud site selection during bipolar budding
           localization requires Rax1p
          Length = 1214

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 74  SINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYYAENGIVRDRRKG 133
           +I G+  H   +L+ TNS + E+LAS   KWD + + +  +F  R     + +V    + 
Sbjct: 861 AIGGKDQHTDSQLLVTNSSSGESLASY--KWDSEISLNSIIFFARN---NSVLVGGSFRV 915

Query: 134 DKIVCEPLCIFD 145
           +   C  LC+F+
Sbjct: 916 NNTQCSGLCLFN 927

>KLLA0C14113g Chr3 (1220244..1221869) [1626 bp, 541 aa] {ON} similar
           to uniprot|P22146 Saccharomyces cerevisiae YMR307W GAS1
           Beta-1.3-glucanosyltransferase required for cell wall
           assembly localizes to the cell surface via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 541

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 306 ANSSSQFHINGIKRMKKLLNTRKV---DCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLL 362
           +N+ SQF++ GI       N+ +    D ++D++ C R  PY ++   N L     N  L
Sbjct: 45  SNNGSQFYLRGIAYQADTANSTETTINDPLADYDSCKRDLPYLVDLYTNVLRVYAINTSL 104

Query: 363 YHSDHTNRKHFRPKQEMIIDEL--PAQNV 389
            HSD  N   F+     II +L  PA ++
Sbjct: 105 DHSDCLNL--FQENGIYIIADLSEPADSI 131

>TBLA0E02980 Chr5 (741757..743073) [1317 bp, 438 aa] {ON} Anc_5.564
           YDR449C
          Length = 438

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 318 KRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTN-------R 370
           KR+K++   +K + +SDW++  R     + + +N      P+DL   S++ N        
Sbjct: 69  KRVKRIFQAKKTNSVSDWSIIRR-----IQQIYNRGCNKFPSDLRLWSNYLNFMKSSNYS 123

Query: 371 KHFRPKQ 377
           KHF  KQ
Sbjct: 124 KHFSYKQ 130

>NDAI0C05440 Chr3 complement(1260473..1263298) [2826 bp, 941 aa]
           {ON} Anc_8.526 YBR203W
          Length = 941

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 191 DGHFRPLEKYRHKNIFKGLLPLERVH-IEIFEVFDNESISN-------KFTNVLYCRDYH 242
           DG  +  E+Y++ N+    + L +++  EIFE+    ++         K   V++CR Y 
Sbjct: 670 DGQTKLREEYKNNNLINNDIQLRKLNPCEIFEIITTRNVERNNQLKRIKMDGVVWCRQYM 729

Query: 243 TRFVWLAPLKNTKF 256
            ++  L    N +F
Sbjct: 730 IKYFILNTFDNLEF 743

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,301,673
Number of extensions: 2272846
Number of successful extensions: 6201
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6326
Number of HSP's successfully gapped: 35
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)