Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038808.261ON57957928940.0
SAKL0H17050g8.261ON58456818330.0
AGR087C8.261ON57757717990.0
Smik_12.1478.261ON61361317830.0
Skud_12.1568.261ON61261217780.0
YLR088W (GAA1)8.261ON61461417770.0
Kpol_543.378.261ON57857917640.0
ZYRO0C01672g8.261ON56958517500.0
KLLA0F19118g8.261ON57858017490.0
Suva_10.1728.261ON61461417500.0
Ecym_43098.261ON57757717360.0
Kwal_56.238048.261ON57857917200.0
KLTH0G13706g8.261ON58456617080.0
TBLA0F030808.261ON58358216990.0
NCAS0B038608.261ON58358216630.0
CAGL0L12232g8.261ON59159116370.0
NDAI0J013908.261ON58358516250.0
TPHA0A018208.261ON58158416050.0
KNAG0H032508.261ON58558716030.0
KAFR0B055508.261ON55555014500.0
Suva_4.4806.121ON53651733.0
Kpol_1018.1393.428ON33551714.5
NDAI0B018308.171ON68659715.1
KAFR0J005405.276ON62665698.0
Skud_13.1922.596ON54389698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03880
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...  1119   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   710   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   697   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   691   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   689   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   689   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   684   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   678   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   678   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   678   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   673   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   667   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   662   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   659   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   645   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   635   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   630   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   622   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   622   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   563   0.0  
Suva_4.480 Chr4 complement(838938..840548) [1611 bp, 536 aa] {ON...    33   3.0  
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    32   4.5  
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    32   5.1  
KAFR0J00540 Chr10 complement(91766..93646) [1881 bp, 626 aa] {ON...    31   8.0  
Skud_13.192 Chr13 complement(328507..330138) [1632 bp, 543 aa] {...    31   8.5  

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/579 (94%), Positives = 547/579 (94%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
           CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 421 ILISFSALISFLPLLLKKKIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTAFP 480
           ILISFSALISFLPLLLKKKIAEPLAYR                   NFFLAFAMGLTAFP
Sbjct: 421 ILISFSALISFLPLLLKKKIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTAFP 480

Query: 481 MTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWKEL 540
           MTLVRTSSLNNYSLR             PFIASYIFCQCFEPDLPGFTVFTEFATAWKEL
Sbjct: 481 MTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWKEL 540

Query: 541 GCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKKFQ 579
           GCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKKFQ
Sbjct: 541 GCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKKFQ 579

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/568 (60%), Positives = 434/568 (76%), Gaps = 5/568 (0%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59
           M+L+ KLHRR ID+GL+PK +A LP LS+  AVV V WLAL +P +G++RRTYISENAL+
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119
           PSQAYSYFRETEWN LRGYRTQIE    S++ ERNEEV+ WL++FG KTAIY +E++G+T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179
           LYG+LHA RGDGTEA++LAAPW N++   N  G+++ ++L+RFFSRWPVWSKNII+VLSE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239
           +P+ ++RSWVEAYHTSLDLTGGSIEAAVV+D+PG ND+F +VEIH+DGLNGE PNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299
           +A+ ITEHEGMKVSLHG+S +++  NDF+SR+  ++ G+KN ALSG++K +GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           I +VTLKA GT+G  D+TTFGRIPEA+FRS+NNLLEKFHQSFFFY+LLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P AV LS+SFALASL+ ++NN Y  LPL STYN+ +L  + ++L   F  AQ FL    P
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 420 TILISFSALISFLPLLLKK-KIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
            +L+S + L+  +P++  + KI  P +YR                   NF LAF +G  A
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           FPMTLVRT+S N   LR             PFIA ++F  C + +L G  VF    +AWK
Sbjct: 481 FPMTLVRTTSGN---LRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWK 537

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTLNT 566
           +LGCWTWFVICIGWLPSWL+VA S +++
Sbjct: 538 DLGCWTWFVICIGWLPSWLLVAYSGIDS 565

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/577 (55%), Positives = 430/577 (74%), Gaps = 4/577 (0%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59
           M+++ KLHR+V+D+GLVPKI+ +L  +S +  ++SV WL L LP+EG+YRRTYISENAL+
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119
           PSQAYSYFRE+EWN LRGYR++I+ +   T+ ERN  VA W+ E+G K A+Y D++HG+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179
           LY VLHA RGDGTEA++LAAPW   +G  N  GV++ +A+ R+FSRWPVWSKNII+VLSE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239
           +P  S+RSWV+AYHT LDLTGGSIEAA+VLDYPG NDYF HVEI Y+GLNG  PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299
           +A+ ITEHEGMKV+LHG   +++  + ++SR+ ++L GIK+ ALSG+++ +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           IQ+VTLKA GT G  D+TTFGR+PEAMFRS+NNLLEKFHQSFFFY+LLAPRYFVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P AV LSISFA+ + D+++NN +  LPL S YN+ +L  + ++LL     A++F    AP
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 420 TILISFSALISFLPL-LLKKKIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
            +L++F+ ++SF+P  L+K KI +P ++R                   NF LAF +GL A
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           FPMT VRT+   + S+R             PFI+  +F   FEP+L GF+VF     AW 
Sbjct: 481 FPMTFVRTTV--HASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWN 538

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRK 575
           +LGCWTW+V+C+GW P+W+MVA S++++ P     +K
Sbjct: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/613 (54%), Positives = 438/613 (71%), Gaps = 37/613 (6%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+L+ KLHRR++D+GLVP+I+A+LP++SM+ A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYR+QIE + N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNII+V SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P  ++RSWVEAYHTSLDLTGGSIEAAVV+DY    D+F++VEI YDGLNGE PNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D+++ N++WSRL ++  GI++ AL+G++  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LS++FA++SL+A INN Y  + + S YNL++L +W ISL+  F ++Q+FL   +  
Sbjct: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L++ S +  FLPL+L KK  I+EPL+YR                   NF +A  +G  A
Sbjct: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479

Query: 479 FPMTLVR--------------------------TSSLNNY--------SLRXXXXXXXXX 504
           FPMTLV+                          T  + NY          R         
Sbjct: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLL 539

Query: 505 XXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALSTL 564
               PFI+  IF   F+ +  GF V  +  +AW +L CW+WFV+CIGWLP WL+V  S+ 
Sbjct: 540 VLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599

Query: 565 NTQPAQLDDRKKK 577
            ++   L  ++K+
Sbjct: 600 ESKRVMLKSKEKQ 612

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/612 (54%), Positives = 433/612 (70%), Gaps = 36/612 (5%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+L+ KLHRR++D+GLVP+I+A LP++S L A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYR+QIE + N TS ERN ++  WL+EFG KTAIY+ +++G+TL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D++++NDFWSRL I+  GI++ ALSG++  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV  S++FA++SL+A INN Y  + L S YNL++L +W ISL+  F I+Q+FL   +  
Sbjct: 360 SAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L++ S    FLPL+L +K  I+EPL+YR                   NF +A  +G  A
Sbjct: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479

Query: 479 FPMTLVRT---------------------------------SSLNNYSLRXXXXXXXXXX 505
           FPMT +RT                                 + L     R          
Sbjct: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLLV 539

Query: 506 XXXPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALSTLN 565
              PFI+  +F   F+ +  GF +  +  +AW +L CW WFV+CIGWLP WL++  S+  
Sbjct: 540 LTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFE 599

Query: 566 TQPAQLDDRKKK 577
           ++   +  ++K+
Sbjct: 600 SRSVVVKSKEKQ 611

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/614 (54%), Positives = 438/614 (71%), Gaps = 38/614 (6%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+L+ KLHRR++D+GLVP+I+A LP++SML A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYR+QI+ + N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D++++N+FWSRL I+  GI++ ALSG++K +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LSI+FA++SL+A INN Y  + L S YNL++L +W +SL+  F ++Q FL   +  
Sbjct: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L++ S    FLPL+L +K  I+EPL+YR                   NF +A  +G  A
Sbjct: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 479 FPMTLVRT----SSLNNYSL-------------------------------RXXXXXXXX 503
           FPMT V+T    SS +  +                                +        
Sbjct: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVL 539

Query: 504 XXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALST 563
                PFI+  +F   F+ +  GF +  +  +AW +L CW+WFV+CIGWLP WL++  S+
Sbjct: 540 LILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599

Query: 564 LNTQPAQLDDRKKK 577
             ++   +  ++K+
Sbjct: 600 FESKSVVVRSKEKQ 613

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/579 (57%), Positives = 422/579 (72%), Gaps = 5/579 (0%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           MS++  L RR+ID GL+PK +AALP LSML   VSV  +  LP++G++RRTYISENAL+P
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWN LRGYR +IE L++ +S ERN  ++ WL EFG+KT++Y+++++GD+L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV +A RGDGTE+++LA PW NA+   N+SG ++G++L RF SRWPVWSKNIIVV SEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDYPGV+DYF+++E+HY+G NG  PNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISI EHEG+KVSLHG++ D++ + D+WSRL ++  G KN AL+G+R+V GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           QA+TLKA G +  HDVTTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPRYFVSI SYLP
Sbjct: 301 QALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LSISFA+AS+D+ +NN Y  +  SS YNLLS   W +S++ CF +   F  +  P 
Sbjct: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L+  + +IS +PL   K   I+EPLAYR                   NF LAF MGL A
Sbjct: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           +PMTLV  ++ +N  LR             PFIA ++F    E  L G         AW 
Sbjct: 480 YPMTLVMLNNTDN--LRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577
           +LG WTWF+ CIGW PSW++VA+S L  +  Q +   KK
Sbjct: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/585 (56%), Positives = 427/585 (72%), Gaps = 25/585 (4%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+LI +L RRV+++GLVPKI+A LPL+SM+ A++S  WLA LP+EG++RRTYISENAL+P
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYR+QIE     ++ ERNE++A WL+EFG KT+IY +E++GD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YG+LHA+RGDGTEA++LA PW NA+G +N+ G S+GI+L+RFFSRWPVWSKNII+V SEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P  ++RSWV+AYHTSLDLTGGSIEAA+VLDYPG NDYFD+ EI Y GLNGE PNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           A+SITEHEG+ VSLHG++ + I+D  +WSRL I+L GI   A +GL  + GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QAVTLKAHGTE-GRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           Q+VT+KAHG E G +D+TTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APRYFVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P  V L+  FALASL++++ N Y  L   S YNL +L  W +S+L  F  +QLFL   + 
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 420 TILISFSALISFLPLLLKK--KIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLT 477
            +L++F  ++  LPL   +   I EPL++R                   NF LAF +G+ 
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 478 AFPMTLV---RTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFA 534
           AFPMT V   R+ +   Y+L              P ++ +I         P   +  +  
Sbjct: 481 AFPMTAVGTQRSLTFKKYAL---------LIISNPLVSFFIVK-------PHPQLLQKLI 524

Query: 535 TAWKELGCWTWFVICIGWLPSWLMVAL---STLNTQPAQLDDRKK 576
           +AW++LGCWTWFV+C+GWLPSW ++AL   S+ N  P     +++
Sbjct: 525 SAWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/580 (55%), Positives = 422/580 (72%), Gaps = 6/580 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLA-LLPLEGRYRRTYISENALL 59
           M+L+ KLHRR+I +GL+PK ++ L  LS+L  V+ +GWL  +LP +G++RRTYISENALL
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLAN-STSRERNEEVAGWLREFGVKTAIYQDEKHGD 118
           PSQAYSYFRE+EWN LRGYRTQ++     ST+ + N EV+ WL+EFGVKTAIY DE++G+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLS 178
           TLYG+ HA RGDGTEA+++AAPW N +   N  G ++ I+L RFFSRWPVWSKNII+VLS
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLV 238
           E+PK S+RSWV AYHTSLDLTGGSIE+A+VLDYPG +D FD++EIHYDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGW 298
           N+A+ I EHEG+KVSLHG+   ++  ND+ SRL  ML GIK++ LSG++   GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSY 358
           RIQ++TLKA G +G HD+TTFGR+PEA+ RS+NNLLEKFHQSFFFY+LLAPRYF+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 359 LPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDA 418
           L  AV +S++F  A+L+ ++NN Y +LPL S YN+ S+  +CISL+  F  +QLF+ F  
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 419 PTILISFSALISFLPLLLKK--KIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGL 476
           P +L+  S + S LPLL +   +I EP +YR                   NF LA  MGL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 477 TAFPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATA 536
            AFPMT  RT+++   +LR             PFIA++      EP L GF VF     A
Sbjct: 481 LAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEA 538

Query: 537 WKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKK 576
            ++LGCWTW++IC+GW PSWL+V  ++++    Q   +K+
Sbjct: 539 SQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE 578

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/614 (53%), Positives = 430/614 (70%), Gaps = 38/614 (6%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+L+ KLHRRV+D+GLVP+++A LP++S L A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWN LRGYR+QIE   N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV+HA RGDGTEA++LA PW N++   N+ G S+G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P  ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VE+ YDGLNGE PNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AISI EHEGMKVSLHG+  +++ DNDF+SRL I+  GI++ ALSG++  +GNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LS++FA++SL+A INN+Y  + L S YNL+++ +W I+++  F I+QLFL      
Sbjct: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L++ S  I FLP+ L  K  I+EPL+YR                   NF +A  +G  A
Sbjct: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 479 FPMTLVRT-----------------------------------SSLNNYSLRXXXXXXXX 503
           FPMT ++T                                    +L     R        
Sbjct: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLL 539

Query: 504 XXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALST 563
                PFI+  +F   F+ +  GF +  +  +AW +L CW+WF++C+GWLP WL++  S+
Sbjct: 540 LILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASS 599

Query: 564 LNTQPAQLDDRKKK 577
             ++   +  ++K+
Sbjct: 600 FESKSVVVKSKEKQ 613

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/577 (54%), Positives = 426/577 (73%), Gaps = 4/577 (0%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59
           M+++ KLHRR++D+GLVP+I+A+LP +S+  A++S+ WL L LPLEG+YRRTYISENAL+
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119
           PSQAYSYFRE+EWN LRGYR ++E L +    ERN  VA W+ E+G KT+I  + ++G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179
           LYG++H  RGDGTEA++LAAPWT  DG+ N  G ++ I+L R+F+RWPVWSKNIIVVLS 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239
           +P+ S+R+WV+AYHT LDLTGGSIE+AVVLDYPG NDYF ++EI Y+GLNG  PNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299
            A+ I+EHEGMKVSLHG+   ++S + +  RL  +L+GIK+  L+G++   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           IQ+VTLKAHG +G  DVTTFGR+PEA+FRS+NNLLEKFHQSFFFY+LL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P A+ LS SFA+AS D+++NN Y KLPL S YN+ +L  + ++L+  F  A+ F     P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 420 TILISFSALISFLPL-LLKKKIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           ++L++F+  +SF+   ++K KI +P +YR                   NF LA A+G+ A
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           FPM+L +T++  N +++             PFIAS+I CQ FE  L G ++F     AW 
Sbjct: 481 FPMSLTKTTT--NATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRK 575
           +LGCWTW+V+CIGW PSW++VA S++++ P     +K
Sbjct: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/579 (55%), Positives = 418/579 (72%), Gaps = 6/579 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALL-PLEGRYRRTYISENALL 59
           M+LI +L R+VIDLGL+P+IV  LP LS+L  ++ + W+ LL PLEG+YR TYISENAL+
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119
           PSQAYSYFRETEWN LRGYRTQI+ L N +S ERNE +  WL+EFGVKTA+Y+DE  G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179
           LYGVLHA RGDGTEA++L+APW N DG  N  G ++ +AL R+FSRWPVWSKNIIVV S+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239
           +PK S+RSWV+AYHTSLDLTGGSIE+AVVLDYPGVND+F +VEI+Y GLNGE PNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299
           +AI +TEHEGMKVSL+G+  D++ + D+++R+  M+ GIK  ALSG+++  GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           IQAV L+A G  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFY+LLAPRYFVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P AV  S+SF +A+LD ++             N+ ++  + ++LL  F ++  F RF  P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 420 TILISFSALISFLPLLLKK-KIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
            ILIS+S + +  P+LL + +I    A+R                   NF LAF +GL A
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           FP+ LV+ S+    + R             PFI++ +F   FEP LPG  +  +   AW 
Sbjct: 481 FPLILVKNST----TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWN 536

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577
           E GCWTW V+CIGWLPSWL++A S++ T  + L +  +K
Sbjct: 537 EFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEK 575

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/566 (56%), Positives = 412/566 (72%), Gaps = 6/566 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALL-PLEGRYRRTYISENALL 59
           M+LI KL RR+IDLGL+P+IV  LP LS+L  ++ + WL LL PLEG+YR TYISENAL+
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119
           PSQAYSYFRETEWN LRGYRTQI+ L   +S+ERNE VA W +EFG KTA Y+D+ HG+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179
           +YGVLHA RGDGTEA++LAAPW N DG  N+ G ++  AL+RFFSRWPVWSKNII+V S+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239
           +P+ S+RSWV AYHTSLDLTGGSIE+AVVLDYPG ND+F +VEI+Y GLNGE PNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299
           +A+ ITEHEGMKVSL+GVS +++   +++S++  M+ G+K  ALSG++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359
           IQA+ L+A GT+G  D+TTFGRIPEA FRS+NNLLEKFHQSFFFY+LLAPRYFVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419
           P AV  S+SF +A+LD ++ +     P  S +NL ++  + ++LL  F ++ LF  +   
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 420 TILISFSALISFLPLLL-KKKIAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           ++LIS +A+I+ LP +  ++ I    +Y+                   NF LAF +GL A
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538
           FP+ LV+    +    R             PFI++ +F   FEP L G  +F     AW+
Sbjct: 481 FPLILVKAPMTS----RQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQ 536

Query: 539 ELGCWTWFVICIGWLPSWLMVALSTL 564
           +LGCWTW V+CIGWLPSWL+VA S +
Sbjct: 537 KLGCWTWSVVCIGWLPSWLLVACSGI 562

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/582 (54%), Positives = 421/582 (72%), Gaps = 6/582 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+L+  +HRRVID+GLVPKI+  LPL+S+  A + +    +LP++G+YR TYISENAL+P
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYRT+I+   +  SR+RN  +  WL EFG KT++Y ++++GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YG+ +A RGDGTEA++LA PW NADG  N  G ++GIAL+RFFSRWP+WSKNIIVV SEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P G++RSWV+AYH SLDLTGGSIEAA+V+DYP  +D+FD+VEI+Y G+NGE PNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AI ITEHEGM+VSLHG+  + +  N+++SRL  +L G K+A LSG++  +GNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QAVTLKAHGT--EGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSY 358
           QA+TLKA  T     HD+T+FGRI EA FRS+NNLLEKFHQSFFFY++LAP+YFVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 359 LPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDA 418
           LP AVT S++FA++SL + INN+Y  LP+ S YNLL+  ++ IS+   F +A+L L F  
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 419 PTILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGL 476
           P +L+  S  +S LP LL  +  I EPL+YR                   NF LAF +G+
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 477 TAFPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATA 536
             F MT V+T ++++ S+R             PF +  +F   F+ D+ G  +F EF  +
Sbjct: 481 LGFAMTAVKTITIHS-SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 537 WKELGCWTWFVICIGWLPSWLMVALSTLNTQPA-QLDDRKKK 577
           W  L CWTWF+IC+GWLP W++V++S++ T    Q  D  KK
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKK 581

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 414/582 (71%), Gaps = 3/582 (0%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M L  ++ R+VI  GL+PK+++ LPL+S L  V+ +  + +LP EG+YR TYISENAL+P
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN +RGYR+QI  L N+++ ERN  ++ WL++FG KT IYQ+ + GDTL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV HA RGDGTE+++LA PW NADG  N++G ++G+AL R+FSRWPVWSKNIIVV +EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           PK ++RSWVEAYHTSLDLTGGSIEAA+VLD+ G  D FD++EI+YDGLNGE PNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
            +   EHEGMKVSLHG   DKI ++  +SRL I+++ IKN+ALSG++K  GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTL+A G  G  DVT+FGR+PEAMFRSINNLLEKFHQSFFFY++LAPR+FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
             V +SI FALASL++  NN Y  LP  S Y LLS+  W +SL+  F ++ +F+    PT
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 421 ILISFSALISFLPLLLKKK--IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           IL++ + +I   P +LK    + + L+YR                   NF LAF MGL +
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 479 FPMTLVRTSSLNNYSL-RXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATAW 537
           FPMT V+T + +  ++ R             PFIA+++F    + +  G  VF    +A 
Sbjct: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540

Query: 538 KELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKKFQ 579
           +ELGCWTW V+C+GW   WL+VA+S L+T     D    K Q
Sbjct: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/591 (53%), Positives = 426/591 (72%), Gaps = 14/591 (2%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           MSL+ K++RR+ + G + K++  LP +S L  VV++  LA+LPL+G+YRRTYISENAL+P
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWN LRGYR+QIE L +S+  +RNE VA WL+E G+KTA+Y+ EK G TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGVLHA RGDGTEA++LA PW N D   NL G ++G++L++FF RWPVWSKNIIVV SE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
              ++R+WV+AYHTSLDLT GSIEAAVVLDYP  +D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           A+SITEHEGMKVSLHG+  +++ + D+++RL IM  GIKN ALSG+++++GNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q+VTL+AHG EG+ D+T FGRIPEAMFRS+NNLLEKFHQS+FFY+LLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV +S++FA+ SLD+ INN+Y  +P SS   L+   +   S+   F I+++ +      
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 421 ILISFSALISFLPLLLKKK----IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGL 476
            L+  S  ++FLPL++ KK    I + +AYR                   NF L F +GL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 477 TAFPMT---LVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPG-FTV-FT 531
            AFP+T   ++ T ++ + S +             PFI+ ++F    + D  G F+V + 
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540

Query: 532 EFATAWKELGCWTWFVICIGWLPSWLMVALSTLNTQP-----AQLDDRKKK 577
              T+W  LGCWTWF+IC+GWLP WL+  +S++ +QP     + LDD+K+ 
Sbjct: 541 RMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVERTSILDDKKEN 591

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/585 (53%), Positives = 415/585 (70%), Gaps = 10/585 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M L+ ++ R ++  GL+PKI+A LP +S++F  +S+  +A+LP++G+YR TYISENAL+P
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWN +RGYR ++  + NSTSRERN+ +  WL EFGVKT IY++ +  + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYEN-RDNEVL 119

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV HA RGDGTEA++LA PW N DG  N +G ++G+AL R+FSRWPVWSKNIIVV SEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P  ++RSWVEAY+TSLDLTGGSIEAA+VLD PG NDYFD++E++YDGLNGE PNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
            I I EHEGM+VSLHG   D+I +N++W+RL I++  I+++A SGL K +GNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           Q++TLK  G  G  D+T FGR+PEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LS++F +A +D+ INN    LP  S Y L+   +W ++L+ CF +AQLFL    P+
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 421 ILISFSALISFLPLLLK-KKIAEP-LAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGLTA 478
           +L+  + +IS   ++++ KK+ +P ++ R                   NF L+F +GL A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 479 FPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFE----PDLPGFTVFTEFA 534
           FPMT VR+ + N  + +             PFIA  I+           L G  V     
Sbjct: 480 FPMTKVRSITANT-APQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 535 TAWKELGCWTWFVICIGWLPSWLMVALSTLNT--QPAQLDDRKKK 577
           +AWK++ CWTWFV+C+GWLPSW+MVA+S +    +P   D +K +
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/584 (52%), Positives = 411/584 (70%), Gaps = 12/584 (2%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M+LI  LHRR   LGL+PK++  L ++S +  ++S+G +  LPL+G+YRRTYISENALLP
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRE+EWN LRGYRT IE L +  +R RNE ++ WL +FG+K A+Y +   GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YGV ++QRGDGTEA++LA PW N D  VN+ G ++GI+L+R+FSRWP+WSKNII+V+SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
           P  +M+SWV+AYH SLDLTGGS+EAA+VLD+P  ++YF+ VE++++G+NGE PNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           AIS+ EHEG+KVSL G++  ++  + +++RL  +L G+KN+ALSG RK+ GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           QA+TLKA GTEG HD+TTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR+FVSI SYLP
Sbjct: 301 QALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LSISF +++  + INN Y  +PLS   ++L+L ++  S+   F   Q+   F  P 
Sbjct: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPH 419

Query: 421 ILISFSALISFLPLLLKKKIAEP-------LAYRXXXXXXXXXXXXXXXXXXXNFFLAFA 473
           ++I    LISFLPL     I +P       L+YR                   NF LAF 
Sbjct: 420 LMILAFLLISFLPL---TNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFG 476

Query: 474 MGLTAFPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEF 533
           MGL AFP+T  ++ S    + +             PFIA +IF   FE D+  F VF++ 
Sbjct: 477 MGLLAFPLTFTKSCS-EMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDL 535

Query: 534 ATAWKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577
            +++K +G WTW + CIGW  +W MV ++ L+T  + LD   KK
Sbjct: 536 ISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKK 579

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/587 (55%), Positives = 421/587 (71%), Gaps = 14/587 (2%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M L   L R+ + LGL+PK++AALPLLS L AVVSV  + ++P+ G+YR TYISENAL+P
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANS--TSRERNEEVAGWLREFGVKTAIYQDEKHGD 118
           SQAYSYFRETEWN LRGYRT+IE L +   ++ +R + VAGWL EFG KTA+Y++E+ GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLS 178
           TLYGVLHA RGDGTEA++L APW N++G  N+ G ++ IAL+R+FSRWPVWSKNIIVV S
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLV 238
           +NP  ++RSWVEAYHTSLDLTGGSIEAAV+LDYP  NDYF++ EIH++GLNGE PNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGW 298
           N+A+ IT+HEGMKVSLHG+   ++  N++WSRL ++  G+K++ L+G++K +GNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSY 358
           RIQAVTLKA G EG+ D+TTFGRIPEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSY
Sbjct: 301 RIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359

Query: 359 LPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFL-RFD 417
           LP AV LSI+FA+A++DA +NN Y    L  TY LL+     ISLL  F +A  FL    
Sbjct: 360 LPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYSTT 418

Query: 418 APTILISFSALISFLPLLLKKK---IAEPLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAM 474
           +P  LI  S +++  PL++ +    + EP+ YR                   NF LAF++
Sbjct: 419 SPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSI 478

Query: 475 GLTAFPMTLVRTSSLNNYS---LRXXXXXXXXXXXXXPFIASYIFCQCFE-PDLPGFTVF 530
           GL  +PMTLV+   LN YS   +              PF+A+++ C   E  + P   VF
Sbjct: 479 GLFGYPMTLVK--PLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVF 536

Query: 531 TEFATAWKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577
               +AWK+L CWTWFV+C+GWLP+WL+V  S+  + PA     +KK
Sbjct: 537 AALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKK 583

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/550 (52%), Positives = 381/550 (69%), Gaps = 10/550 (1%)

Query: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60
           M L+ ++ R+V  +GLVPK+   LPL S + A++S+  +A+LP++G+YR TYISENAL+P
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120
           SQAYSYFRETEWN LRGYRTQ+E + +    ERN+ +  WL + G KT    D  +  T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT----DTHNNSTI 116

Query: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180
           YG+ H+ RGDGTEA++LA PW N++G  N  G ++G++L RFF RWP+WSKNIIVV SE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240
              S+RSWVEAYHTSLDLTGGSIEAAV+LDY   +D+FD+VEIHYDGLNGE PNLDLVNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300
           A+SITEHEGMKVSLHG+  +++ +   WSR  ++L  IK+++L+G++K +GNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360
           QA+TLKA G EG  D+TTFGRIPEAMFRSINNLLEKFHQSFF+Y+LLAPR FVSISSYLP
Sbjct: 297 QALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355

Query: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420
            AV LS++FA +SL   +N+N   +P  S+Y L ++ +W +S+   F  A  +L++  P 
Sbjct: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415

Query: 421 ILISFSALISFLPLLLKK-KIAE---PLAYRXXXXXXXXXXXXXXXXXXXNFFLAFAMGL 476
           +L+    L SF+PL+ +   +AE    +A+R                   NF LA  +G+
Sbjct: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 477 TAFPMTLVRTSSLNNYSLRXXXXXXXXXXXXXPFIASYIFCQCFEPDLPGFTVFTEFATA 536
            AFPMTLV+ S+    S +             P+I+   F   F+ +L G         A
Sbjct: 476 LAFPMTLVKISNTLPTSSQ-ALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534

Query: 537 WKELGCWTWF 546
           W ++ CWTWF
Sbjct: 535 WNDMNCWTWF 544

>Suva_4.480 Chr4 complement(838938..840548) [1611 bp, 536 aa] {ON}
           YBR223C (REAL)
          Length = 536

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLI-MLTGIKNAALSGLRKVN 290
           A   TEH   + S  G S  ++ D + W+ L++ + TGI  A + G +KV+
Sbjct: 294 ASDATEHYLCQTSSIGTSLSRVRDENLWTHLMVPLFTGIIPALVEGTKKVH 344

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 194 TSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNIAISI 244
           TS D  G S +     D   VN + D +EI+   +N  E N DL+NI  SI
Sbjct: 16  TSTDFPGFSKDDLNAWD---VNKFKDDLEINISSINSREANFDLINIDTSI 63

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 132 TEAVILAA--PWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSENPKGSMRSW 188
            EAV+  A   W +   +VN     +G+  ++  S WPV  +N + V ++  +G++ SW
Sbjct: 317 NEAVVAEALRKWGSKIKLVNCDDKLVGLVRSKGISNWPVLDRN-MAVKNKGDEGTIESW 374

>KAFR0J00540 Chr10 complement(91766..93646) [1881 bp, 626 aa] {ON}
           Anc_5.276 YHR032W
          Length = 626

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 356 SSYLPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLR 415
           S  + C V+L +SF  +S++  I  N+K+   +   N   + +  +S L    I +LF  
Sbjct: 477 SCIITCKVSLLLSFVCSSINMFIIFNFKRQIAALFSNEEEVKLLVVSALSILAIMELFDA 536

Query: 416 FDAPT 420
           F+A T
Sbjct: 537 FNAST 541

>Skud_13.192 Chr13 complement(328507..330138) [1632 bp, 543 aa] {ON}
           YMR036C (REAL)
          Length = 543

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 197 DLTGGSIEAAV-VLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNIAISITEHEGMKVSLH 255
           + TGG I  +V +     +   F H  +H D  N   P L +++   S   H G  ++ H
Sbjct: 273 EYTGGHIINSVNIHSREDIESEFIHKVLHSDTNNSNLPTLLIIHCEFS--SHRGPSLASH 330

Query: 256 GVSCDKISDND-----FWSRLLIMLTGIK 279
             +CD+I + D     F+  +LI+  G K
Sbjct: 331 LRNCDRIMNQDRYPKLFYPDILILDGGYK 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,187,561
Number of extensions: 2206265
Number of successful extensions: 6980
Number of sequences better than 10.0: 27
Number of HSP's gapped: 7097
Number of HSP's successfully gapped: 31
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)