Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038708.260ON29422942154420.0
ZYRO0C01694g8.260ON3006303079180.0
NCAS0B050108.260ON2952298178780.0
Suva_10.1718.260ON2958298578690.0
Smik_12.1468.260ON2958298278680.0
Skud_12.1558.260ON2959298978660.0
YLR087C (CSF1)8.260ON2958298677920.0
NDAI0B019808.260ON2959298176740.0
KAFR0B027208.260ON2982301073540.0
KNAG0G020308.260ON2998304870020.0
CAGL0L12210g8.260ON2981301269390.0
Kpol_392.78.260ON2995302566470.0
TBLA0E044208.260ON3148257758940.0
TPHA0J007308.260ON3046306358500.0
SAKL0H17072g8.260ON2997304255470.0
KLTH0G13728g8.260ON2966304045760.0
Kwal_YGOB_56.238088.260ON2941302044830.0
Kwal_56.23810singletonOFF2763280941320.0
Ecym_43108.260ON2943304138990.0
KLLA0F19096g8.260ON2923306136230.0
AGR088W8.260ON2887153718940.0
Kwal_56.23808singletonOFF62601583e-12
Kpol_1060.236.278ON1280110860.63
ZYRO0E03014g1.467ON1148114831.2
AGR372W7.392ON242113791.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03870
         (2942 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  5952   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  3054   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3039   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3035   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3035   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3034   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3006   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2960   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2837   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2701   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2677   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2565   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2274   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2258   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2141   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1767   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1731   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1596   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  1506   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...  1400   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   734   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    65   3e-12
Kpol_1060.23 s1060 (57472..61314) [3843 bp, 1280 aa] {ON} (57472...    38   0.63 
ZYRO0E03014g Chr5 (230333..233779) [3447 bp, 1148 aa] {ON} simil...    37   1.2  
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    35   1.9  

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 5952 bits (15442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2882/2942 (97%), Positives = 2882/2942 (97%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
            DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            KQEMSELFHCHSERSDDKG             PNINDRVFDEVHNQKKSIFMRFLPMELQ
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
            LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 301  YNRKKATFKNGKLSRMWATFVKVLHIPFYNKSHNNKGTESEPFMTKWKGLGLYKGLTFDR 360
            YNRKKATFKNGKLSRMWATFVKVLHIPFYNKSHNNKGTESEPFMTKWKGLGLYKGLTFDR
Sbjct: 301  YNRKKATFKNGKLSRMWATFVKVLHIPFYNKSHNNKGTESEPFMTKWKGLGLYKGLTFDR 360

Query: 361  DGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTLEGPEVGNNGAP 420
            DGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTLEGPEVGNNGAP
Sbjct: 361  DGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTLEGPEVGNNGAP 420

Query: 421  PEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTVFKTTF 480
            PEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTVFKTTF
Sbjct: 421  PEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTVFKTTF 480

Query: 481  RVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEG 540
            RVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEG
Sbjct: 481  RVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEG 540

Query: 541  FPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFL 600
            FPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFL
Sbjct: 541  FPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFL 600

Query: 601  LREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNE 660
            LREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNE
Sbjct: 601  LREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNE 660

Query: 661  NCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXXEFMKNKEVG 720
            NCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFR            EFMKNKEVG
Sbjct: 661  NCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTLNEFMKNKEVG 720

Query: 721  RSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHF 780
            RSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHF
Sbjct: 721  RSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHF 780

Query: 781  ITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRADPPVSRSDVKR 840
            ITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRADPPVSRSDVKR
Sbjct: 781  ITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRADPPVSRSDVKR 840

Query: 841  TTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSI 900
            TTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSI
Sbjct: 841  TTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSI 900

Query: 901  KRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGL 960
            KRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGL
Sbjct: 901  KRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGL 960

Query: 961  TINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXXXXXXXXXXSSR 1020
            TINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTS               SSR
Sbjct: 961  TINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRDMNVVVENDSSR 1020

Query: 1021 AVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFI 1080
            AVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFI
Sbjct: 1021 AVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFI 1080

Query: 1081 QKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXXXXXXXXXXXXXXX 1140
            QKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYK                   
Sbjct: 1081 QKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSISPSSSLPPLPMPL 1140

Query: 1141 XAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQL 1200
             AETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQL
Sbjct: 1141 LAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQL 1200

Query: 1201 PKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKR 1260
            PKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKR
Sbjct: 1201 PKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKR 1260

Query: 1261 LGQLWNNTCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKI 1320
            LGQLWNNTCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKI
Sbjct: 1261 LGQLWNNTCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKI 1320

Query: 1321 TLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDE 1380
            TLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDE
Sbjct: 1321 TLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDE 1380

Query: 1381 SQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITK 1440
            SQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITK
Sbjct: 1381 SQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITK 1440

Query: 1441 PAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDASVASHWRR 1500
            PAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDASVASHWRR
Sbjct: 1441 PAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDASVASHWRR 1500

Query: 1501 WEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRAN 1560
            WEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRAN
Sbjct: 1501 WEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRAN 1560

Query: 1561 IVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSK 1620
            IVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSK
Sbjct: 1561 IVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSK 1620

Query: 1621 TSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFF 1680
            TSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFF
Sbjct: 1621 TSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFF 1680

Query: 1681 AKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVN 1740
            AKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVN
Sbjct: 1681 AKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVN 1740

Query: 1741 SIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVV 1800
            SIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVV
Sbjct: 1741 SIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVV 1800

Query: 1801 RHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAI 1860
            RHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAI
Sbjct: 1801 RHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAI 1860

Query: 1861 LNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSALRW 1920
            LNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSALRW
Sbjct: 1861 LNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSALRW 1920

Query: 1921 SLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKE 1980
            SLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKE
Sbjct: 1921 SLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKE 1980

Query: 1981 PSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLL 2040
            PSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLL
Sbjct: 1981 PSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLL 2040

Query: 2041 EYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIG 2100
            EYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIG
Sbjct: 2041 EYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIG 2100

Query: 2101 FDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEI 2160
            FDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEI
Sbjct: 2101 FDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEI 2160

Query: 2161 DSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLEN 2220
            DSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLEN
Sbjct: 2161 DSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLEN 2220

Query: 2221 TSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEA 2280
            TSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEA
Sbjct: 2221 TSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEA 2280

Query: 2281 ERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLESSQSIDYKSL 2340
            ERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLESSQSIDYKSL
Sbjct: 2281 ERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLESSQSIDYKSL 2340

Query: 2341 LDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKI 2400
            LDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKI
Sbjct: 2341 LDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKI 2400

Query: 2401 QSSVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIW 2460
            QSSVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIW
Sbjct: 2401 QSSVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIW 2460

Query: 2461 QLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVL 2520
            QLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVL
Sbjct: 2461 QLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVL 2520

Query: 2521 SLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIK 2580
            SLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIK
Sbjct: 2521 SLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIK 2580

Query: 2581 GSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEM 2640
            GSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEM
Sbjct: 2581 GSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEM 2640

Query: 2641 DFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRT 2700
            DFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRT
Sbjct: 2641 DFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRT 2700

Query: 2701 DLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLST 2760
            DLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLST
Sbjct: 2701 DLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLST 2760

Query: 2761 SKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFF 2820
            SKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFF
Sbjct: 2761 SKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFF 2820

Query: 2821 DRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIKAKLQYVP 2880
            DRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIKAKLQYVP
Sbjct: 2821 DRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIKAKLQYVP 2880

Query: 2881 LDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            LDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR
Sbjct: 2881 LDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

Query: 2941 FQ 2942
            FQ
Sbjct: 2941 FQ 2942

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 3054 bits (7918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1532/3030 (50%), Positives = 2103/3030 (69%), Gaps = 115/3030 (3%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+G+S F++VSL   RNFSWVFLVDWVL C+VTLTVIFYLGR+F + +T +LEW +WK  
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEA-SSQ 119
            KVKI++ESLRIAPL G+I+FRNLCII +D TIS L+G++ WRY L  +R+SQY+E   ++
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 120  KDGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFM 179
            ++ L  G+E   S      PCRF+L CEG EIF+YN+T +YENII MFS+EER QFEKF+
Sbjct: 121  EERLENGQEP-KSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFV 179

Query: 180  SKQEMSELFHCHSER------------------SDDKGXXXXXXXXXXX-------XXPN 214
              Q M+ELF+   +                   S+D+                     PN
Sbjct: 180  DDQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPN 239

Query: 215  I--NDRVFDEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQ 272
               ND +F++  + +KS++MRFLP+++   R S+VLGN+FTPS+L+ S  + +G++DLC 
Sbjct: 240  NLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCP 299

Query: 273  PKEKLDLYKMHFQVDFIDIDISIRQNIEYNRKKAT-FK--NGKLSRMWATFVKVLHIPFY 329
            PKEKLDL+K+  + +  D+D S++QNI ++   +T FK   G+LS++W  F ++  +P  
Sbjct: 300  PKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTL 359

Query: 330  NKSHNNKGTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRT 389
               H  +  E   F   WKGL LY+    + + ++ + V FDFANHEYA+V +I+KS + 
Sbjct: 360  GPKHL-QTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKSAKI 415

Query: 390  VLTYSYDIPGVVPHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLR 449
            V TY YDIPG+VP     TL+GPEVGN+GAPPEFG+D+Q YG  ICYGPWA+R++ +L  
Sbjct: 416  VFTYEYDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRA 475

Query: 450  MISPTVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATS 509
            ++SP V+R+  PIKTL+PGS+RIYT+FKT+  +++ S+WRIPTRE+SKDQEFL+ +  T 
Sbjct: 476  LLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETK 535

Query: 510  EEYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCF 569
            EE+RPFGW+DLKF  DSYG + TV+CP EEG PN +  HF+ ME  +SVNH+++L+   F
Sbjct: 536  EEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSF 595

Query: 570  DVAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPF 629
            D   D+GYPLGWN  A W INL STQLE F+LREH+TL++D+F DFSSG+PTPYELFRPF
Sbjct: 596  DFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPF 655

Query: 630  IYQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDV 689
            IY+INW +DGYSIYLNVNDHNIVNNPLDFNENCYLSLHG+ L+ DV  P  ++     ++
Sbjct: 656  IYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEI 715

Query: 690  PYKISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVEC 749
             Y ISTPMFR            EFMKNKEVGRSY+F V GLYTV+SELDIDNVDT+SVEC
Sbjct: 716  TYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVEC 775

Query: 750  TSTGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDN 809
            +S GTTLHCYGFV+RYLMNVKMNYFGDF HF+T+EEYT     +E ++    +E S  + 
Sbjct: 776  SSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNI 835

Query: 810  ST--NLSTDSGGLSDPYVRL--RADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIY 865
            S+  ++ TD    ++P  R   +  P   RS++KRT NE DIWF FSVWEGAL+LPETIY
Sbjct: 836  SSTEDVETDR---TNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIY 892

Query: 866  NCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKE 925
            N DPC+ALHF EL VDLRS NYYMDLLATM++T +KRYVSR  H+LFE +R+DNGR EK 
Sbjct: 893  NSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKS 952

Query: 926  HGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTN 985
            HG L++LTIHGHRMYGLPP EPTYFCQWG+D+D L INSD EFAKGF T F+ IGFG+ N
Sbjct: 953  HGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKN 1012

Query: 986  LENTLLYDVETPDDMTSXXXXXXXXXXXX--XXXSSRAVVDVPNLTFTSIDFENERYSQR 1043
            LEN LLY+  T  DMTS                 SSR+V+    +TFT+IDFENE YSQR
Sbjct: 1013 LENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQR 1072

Query: 1044 IDLKVPSLSILLLTSEDDSEPIR-LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSP 1102
            +D K P ++ L+   +++ +  R L+ L T++  TDFIQ + FA HR +QR+YITL+DS 
Sbjct: 1073 VDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSA 1132

Query: 1103 FYRCSFLLPCYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLK- 1161
            +YRCSFLLPC+ QES LYK                    AETID+IIED LGE+A  +K 
Sbjct: 1133 YYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPTVKP 1192

Query: 1162 CDYDTQRTVDDPDSPSESFDTS-QEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVK 1220
             D  +  T +   +P  + DT  Q + G        F+       PN  ++Y+N ++DV+
Sbjct: 1193 DDSSSSDTSEGQRTPLTNEDTRFQANSG-------FFSPHMPHNPPNNRDRYNNYVLDVE 1245

Query: 1221 FLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQL-WNNTCVLNLKLYVVD 1279
            ++ +++ P +   +   L +F+  +T DIID+ E++IVK+LG L +  + V   +L+V D
Sbjct: 1246 YVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKD 1305

Query: 1280 INFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITE 1339
            ++F +  +    V+L  +  DFDL ++T + + E ++ EK   S + ++R ++ + +   
Sbjct: 1306 LHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLE-AHPS 1364

Query: 1340 GVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKN 1399
             +  +P AL L++E  E +S   ++ V SV++ S   T+DESQLE +S Y+  Q  ++++
Sbjct: 1365 SISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRD 1424

Query: 1400 MLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWR 1459
             +TS  +L    + T++DL+ D+T+ASE+YQISH+PYVITKPAFIMRLS GHVREN SWR
Sbjct: 1425 TITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWR 1484

Query: 1460 IITRLRHILTYLPNEWRNNSAIQV-----SPTVDSTD----ASVASHWRRWEISDITRSY 1510
            IITRLRHILTYLPN+WR    +       +P V   D     SV S+WR W++SDITRSY
Sbjct: 1485 IITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSY 1544

Query: 1511 IYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAE 1570
            IY+ IFL     +  + L+ +LK++F SFFFT+   GY VA + + TR NI+ + +P + 
Sbjct: 1545 IYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSV 1604

Query: 1571 LSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSK-------------------- 1610
             +  +     + V+ LT ++GAIKGE  +++ KL+ +FSK                    
Sbjct: 1605 NTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSAS 1664

Query: 1611 -----AQTPALKRSKTSI--NISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALL 1663
                 +Q   L+ S+ S   +  ++ K+   + F+R +L FV+G TRLTNRI+NGK ++L
Sbjct: 1665 ISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSML 1724

Query: 1664 LEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQ 1723
            LE  K +  PALS VFFA+R E WLKH+  VLAE L ++L +  TA+L   +P +S+N Q
Sbjct: 1725 LENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVSLNCQ 1783

Query: 1724 CSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQNTALTV 1783
             +NS IRAM ST +L NS+++I   +  L   F   +   +   T     IP++   +  
Sbjct: 1784 ATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIK-FDIRF 1842

Query: 1784 SFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFA 1843
            +F+D+++E+M L+PF +  ++KQL +Y +  ++ E+++   + ++ LKS  ++EQ+F F+
Sbjct: 1843 NFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFS 1902

Query: 1844 LGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQ 1903
              DLQ KC +  E   ++ V +STSLMKLTL EPRR L + LQDE+ + ES+ +I+ L  
Sbjct: 1903 STDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWN 1962

Query: 1904 LFSPLA--RNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEG 1961
                 +   +++ S   RW+LDANL YFG+LVP++S  ++FE+H L A++ NA++  +E 
Sbjct: 1963 FLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEY 2022

Query: 1962 DHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCL 2021
            D H +GQ+ +E+C LL+KE SLPA+LSK+LDFSIR ++SQKVPNS QSYQIESS+FR+CL
Sbjct: 2023 DRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCL 2082

Query: 2022 SPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNL 2081
             P  LV +LW  H LQSLL +F+KH        P+S    + S +  +DFRSIHILSYN 
Sbjct: 2083 FPELLVDILWSVHYLQSLLNHFKKHHT---PWLPYSSNKTAKSGESTLDFRSIHILSYNF 2139

Query: 2082 CIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQ 2141
            C+GW+F++GD+ + GLI+G+DRLFSAYEKH+GKLTLIDGY SVANG ++DTFYSQ SEK 
Sbjct: 2140 CVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKD 2199

Query: 2142 RYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLK 2201
             Y R++LSN+QI YWLK  + +KDLF+R +GE ++V  LS SF ++E TL SI++F  +K
Sbjct: 2200 SYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMK 2259

Query: 2202 KERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPS 2261
            K ++ +  S  ++KLN+E  SN ++PFL+HIRTI+ Q  + GGV K+YS  +L+    P 
Sbjct: 2260 KAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPL 2319

Query: 2262 LEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQK 2321
            LEIKSPGV +A+ Y  NE   + H IR   +I+PTHN+L+++C P+L+D     + M++ 
Sbjct: 2320 LEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRN 2379

Query: 2322 HSPDETPLES---SQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTF 2378
             S ++    S   + SIDYKSLL+ +DIAF++ SG+Q+LS SCEP+AKVQ D GF+SF F
Sbjct: 2380 LSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLF 2439

Query: 2379 GVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALV 2438
             VTT+ +    P  VS S++KI+SSVRHIFSR++SA+F +D++D   +FT+P+V+GVALV
Sbjct: 2440 RVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALV 2499

Query: 2439 SDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS--------MTLSKRT 2490
            SD+N++ NMKQ QNLN+FLDIW    +L+N+GR K  + K + KS               
Sbjct: 2500 SDMNIYCNMKQRQNLNIFLDIW----RLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSN 2555

Query: 2491 STPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSI 2550
             +     WSFT+IFTN+ G VDLGPSLGVL+L L + W  T H G Q+R  H FA  +++
Sbjct: 2556 DSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITV 2615

Query: 2551 KSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTI 2610
             SEGRLSG+F+L  A+ +SE+++P    ++    +S+S+++ R++IK+AFDYHMFLIG++
Sbjct: 2616 NSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSM 2675

Query: 2611 DEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISY 2670
              +K HL +ESD Y ILPDLL V+L  + +  CATALTAAN LDIYNTI RM+QDNRISY
Sbjct: 2676 KSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISY 2735

Query: 2671 IETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDN 2730
            IETL+ESN + +  ++ Y+++L SLNLLRTD+S  +   K  ISP+SLFD EVLV+++ +
Sbjct: 2736 IETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRD 2795

Query: 2731 VSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTI 2790
            V+ARSETQSGEKLKTEL LQ+S+   SLS+SKEELDEE V+KI+++DYMLYASK SGGTI
Sbjct: 2796 VNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTI 2855

Query: 2791 VKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQ 2850
            +K+P+LLVSMTTWQ+  S ++EYLFTC+FFD++++KWNLGP+NFIKEMW+TH++SLAVR+
Sbjct: 2856 IKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRR 2915

Query: 2851 TQSNKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKR 2910
            TQ   +  E +   + D E+ +K+K  YVPLDEPYIEMPQIKDLGDATPP+EWFGVHRK 
Sbjct: 2916 TQLGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKN 2975

Query: 2911 LPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            LPAATHQ A++LIQKLVH AEKEYAK+Q R
Sbjct: 2976 LPAATHQTAVLLIQKLVHTAEKEYAKLQQR 3005

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3039 bits (7878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1518/2981 (50%), Positives = 2047/2981 (68%), Gaps = 73/2981 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+  SQF+ V L+ +RNFSW+FLV W+L  +++L+ IFYLGR  AY IT +LEW LWKH 
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KVK++++SLRI+ L G I F+N+ II KD TISIL+G++ WRY L  TR+ +++EAS  +
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
                  +    S+KN  LPCRFV+  EG EIF+YN+TVAY+NIIQMFS+EER QFEKF++
Sbjct: 121  -----TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLN 175

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            +Q +S+     S   D +                 NDRVF E      S F+RFLP++  
Sbjct: 176  EQILSDSATVKS-MDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSS-FLRFLPIQFL 233

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
            ++RGS++LGNKFTPSLLI S  S   ++D  QPKEKLDLYK     + I+ + +++QNI 
Sbjct: 234  VTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIG 293

Query: 301  YNRK---KATFKNGKLSRMWATFVKVLHIPF----YNKSHNNKGTESEPFMTKWKGLGLY 353
            ++     K     GK+S +W  F ++L I +    +   H  K    + F  KW+GL LY
Sbjct: 294  FDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALY 353

Query: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPT---LE 410
            KG        D D++ FDFANHEYAK S+I+KSP+   T  +D+PG+VPHGAHPT   L+
Sbjct: 354  KGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLD 413

Query: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470
            GP+VGN+GAPP++ +D+Q +G ++C+GPWAQR+  HL +++SP V+R++ P+K L+PG R
Sbjct: 414  GPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCR 473

Query: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530
            RIYT  +    ++D ++WRIPTRE SKD EFL+ ++ T+ EYRPFGW+DLKF+ ++  + 
Sbjct: 474  RIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNT 533

Query: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590
            T  LCP  +GF N + IH  E E  SSVNHD++LKC  FD   D  +PLGWN  ATWTIN
Sbjct: 534  TFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTIN 593

Query: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650
            L+S+Q+E F+LREH+TL+AD  TDFSSGEPTPYELFRPFIY INW IDGYS+YLNVNDHN
Sbjct: 594  LNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHN 653

Query: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXX 710
            IVNNPLDFNENCYLS HG+EL +D   P  SIT  + D+ Y I TPMFR           
Sbjct: 654  IVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTL 713

Query: 711  XEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770
             EFMK+KEVGRSY F V G Y +YS+LDIDNVDT+ ++CTS GTTL CYGFV+RYL+NVK
Sbjct: 714  NEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVK 773

Query: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRAD 830
            MNYFGDFFHF+TSEEYTG IRA E +    +E +  R + ++  T  G  +D   R R  
Sbjct: 774  MNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQG--NDAPGRRRLH 831

Query: 831  PPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMD 890
              + RSD+KRTTNETD+WFTF+VWEGAL+LPETIYNCDPCV LHFGEL++DLRSCNYYMD
Sbjct: 832  TELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMD 891

Query: 891  LLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYF 950
            LLA M+  SIKRYVS+  HE+FE+I ++NG     HGSL++LTIHGHRMYGLPP+EPTYF
Sbjct: 892  LLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYF 951

Query: 951  CQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXXX 1010
            CQW  DL  L I SD EF +GFF+ F  IGFGY +LEN LLY+ ET DDMTS        
Sbjct: 952  CQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKL 1011

Query: 1011 XXXXX--XXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLM 1068
                     +  A  D+ NL FT IDFENE+YS R+DL +P+L   L   E+D    +L 
Sbjct: 1012 SVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLF 1071

Query: 1069 DLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXXX 1128
             L TKV +T+F+Q +DF +HR  QR+YI L+D+P++RCSF+LP   Q++  Y+       
Sbjct: 1072 TLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIA 1131

Query: 1129 XXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEG 1188
                           T DFIIEDLLGEF   L+     +    D D  ++  D   E E 
Sbjct: 1132 PSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETE-ED 1190

Query: 1189 PDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVD 1248
             D + ++     P     N   + D+ IIDV F+++++ P I   +   L  F   N V 
Sbjct: 1191 IDPLEFNT----PSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQ 1246

Query: 1249 IIDEIEMSIVKRLGQLWNNTCVL-NLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRT 1307
            IID+IE++ V RL  L      L N+K+ ++ ++ FWG +    V +Y D++DF + ++T
Sbjct: 1247 IIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKT 1306

Query: 1308 RDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVG 1367
             + + E  + E   L+K+RSVR TV   +     EERPPALSL +EGWE +S   E  V 
Sbjct: 1307 VEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVN 1366

Query: 1368 SVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASE 1427
            S+++LSTDITVDE+QLEWL  Y   Q   I++M+ +   + +    +R++L+  +T ASE
Sbjct: 1367 SLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASE 1426

Query: 1428 HYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWR---NNSAIQVS 1484
            +YQISH+PYVITKPAFI RLS GHVREN SW+IITRLRHILTYLP +W    N S  Q  
Sbjct: 1427 YYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSK 1486

Query: 1485 PTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSF 1539
                + DA     SV S+WR WE SDI RSYIYR +FL+  S  +  + KK + +   SF
Sbjct: 1487 TAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASF 1546

Query: 1540 FFTIYSEGYRVAHNFVITRANIVGE-EIPAAELSKVQQALDYDNVMNLTVSLGAIKGELN 1598
            F T+YS GY V HNF+ITR N++ E   P ++      +L  + + N+T +LG  KG+L+
Sbjct: 1547 FVTVYSAGYEVEHNFIITRTNLLLETNSPTSD-----SSLSRETIFNITGTLGTAKGKLS 1601

Query: 1599 DQLLKLRNIFSKAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNG 1658
            D+++ ++N+    +     +SK + +  KS+K+N L+  +R ELQ  +G TRL +R+   
Sbjct: 1602 DKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGA 1661

Query: 1659 KAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSL 1718
            + ++L E  K+  + A+S   + +R+E  LKH +  LAE   R+ SL +T E WSY P++
Sbjct: 1662 RLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTI 1721

Query: 1719 SINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQN 1778
             +N QCS+ H+ AMT+T++LV SIK+IME+I  +++          +    ++   P  N
Sbjct: 1722 LVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVN 1781

Query: 1779 TALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQ 1838
            T LT  F++++ ELMP++PF +RHE KQL +Y NR  SNEIL+S+WDA+I L SH T +Q
Sbjct: 1782 TILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQ 1841

Query: 1839 YFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESL-GY 1897
            YF F+ GDLQ+K N+  +   I N+ LS S++KLT+S+ ++++ SFLQDEK++ ES+  +
Sbjct: 1842 YFRFSFGDLQLKGNMVNDPYHI-NLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDF 1900

Query: 1898 IKGLLQLFSPLARNKTQ-----SSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMN 1952
            I   L LF  L++N+       ++   WS+D N+NYFG+L P+ S +F+FE+ MLLA++ 
Sbjct: 1901 IT--LDLFG-LSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLT 1957

Query: 1953 N-ASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQ 2011
               SD  ++ D  ++GQ S+EN L  IKE +LP  LSKLLDFSI+V + QK  N+  +YQ
Sbjct: 1958 KMGSDIPNQSD--ISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQ 2015

Query: 2012 IESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDF 2071
            IESSHFRVCLSP SLV++LW T+Q+ + ++Y++ H   +K      L +   + D  ++ 
Sbjct: 2016 IESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNV 2075

Query: 2072 RSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTD 2131
             S HILSYN C+GW+F +    + GLI+G++RLFSAYEK+ GKLTL+D +FS+ANG S+D
Sbjct: 2076 PSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSD 2135

Query: 2132 TFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTL 2191
             F+S+G EK +YNRS+L N+QI+YW K+  +M+DLF+R +GEAL+V+ LS+  D+IES L
Sbjct: 2136 NFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESAL 2195

Query: 2192 ASIQKFQTLKKERMHKRDSGPRNKLNLENT--SNNISPFLSHIRTIDCQFKYVGGVLKIY 2249
             S+Q FQ LKK+ +       + K+N + T   N +SPFL++IR+I CQFKY GGV KI+
Sbjct: 2196 TSVQTFQELKKDLIPGLPK--KQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIF 2253

Query: 2250 SLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILN 2309
            SL+D      PS E+ SP VVI L Y H E   + H IR L+ I+ THNILY++C P+L+
Sbjct: 2254 SLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLS 2313

Query: 2310 DIVEASQRMVQKHSPDETPL---ESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAK 2366
            D  E  Q MV+KHS  E       SSQ++DYK LLDSFDIA K+TS +QQLSLSCEP+AK
Sbjct: 2314 DFFERIQGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAK 2373

Query: 2367 VQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSI 2426
            VQAD+GF SF F VTTNDL    P   SLSVEK ++S++HIFSRETS S  VDFVD T +
Sbjct: 2374 VQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLM 2433

Query: 2427 FTHPDVF---GVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS 2483
            FTHPDV    G AL+S+IN+FFN+KQLQNL LFLDIW+L+  L +K  A D  + K   S
Sbjct: 2434 FTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP-ANDIVKAKTDSS 2492

Query: 2484 MTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHA 2543
            +++++ +   + I W FTLIFTNVKGDVDLGPSLGV+S++L RTWFATDHY   R+VLHA
Sbjct: 2493 LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHA 2552

Query: 2544 FADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYH 2603
            F D  S+ S+GRLSG+F+LK A+WISEVN+P   +I     +S+++++  ++ K AFDYH
Sbjct: 2553 FTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYH 2612

Query: 2604 MFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMR 2663
            MFLIG I+  + HL SE D+ G++PDLL V   C+ +  C+TAL AANILDIYNT  RMR
Sbjct: 2613 MFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMR 2672

Query: 2664 QDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEV 2723
            QDN+ISYIETLRESN  E++  + Y DIL+SLNLL+TD+S DI T   QISPI+LFDVEV
Sbjct: 2673 QDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEV 2732

Query: 2724 LVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYAS 2783
            LV+ I+++SARSET SG+KL TEL +QV +A VSLSTSKEE+DE  V+KIS+++Y+ YAS
Sbjct: 2733 LVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYAS 2792

Query: 2784 KISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHI 2843
            KI GGTI+++P+LLVSMTT+Q+ KSD++EYL+TC F D+++V+WNLGPINFIKEMW+THI
Sbjct: 2793 KIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHI 2852

Query: 2844 KSLAVRQTQSNKTMSEKDKQADLDPEEEIK-----AKLQYVPLDEPYIEMPQIKDLGDAT 2898
            +++AVR++Q    +   D Q++ D E+ IK     ++ +YV L+ P I+MPQI+DLGDAT
Sbjct: 2853 RAIAVRRSQVVGVL---DGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDAT 2909

Query: 2899 PPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939
            PPMEWFGV+RKR PA THQ A+ L+QKLV++AE+EYA + G
Sbjct: 2910 PPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3035 bits (7869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1483/2985 (49%), Positives = 2059/2985 (68%), Gaps = 80/2985 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            ME  SQ   V L+++++FSWVFLVDW+L  +  LT IFY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            K+KI+VE+LRI+ L G I F++L +I KD TISIL+GSL W+Y LL  R+++  E     
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
             G           KNI LPC+F+L CEG E FIYNRT+AY+N+I + S++ER +FEK+++
Sbjct: 121  SG-----------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLN 169

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            +    E F   S                      INDR + E +  K    + F P+EL+
Sbjct: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELK 229

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
            L+RGS++LGNKFTPS++I S  +G G++D+  PKE+LDLY+    ++  + +ISI+QNI 
Sbjct: 230  LNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIG 289

Query: 301  YNRK---KATFKNGKLSRMWATFVKVLHI---PFYNKSHNNKGTESEPFMTKWKGLGLYK 354
            Y+     K     GK+S++W TFV+VL +   P   +     G   + F  KWKGL LYK
Sbjct: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYK 349

Query: 355  GLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---EG 411
                D    D D++ FDF +HEYAK ++I+K P+  L+Y  D+PGVVPHGAHPT+   +G
Sbjct: 350  ASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDG 409

Query: 412  PEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRR 471
            P+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSRR
Sbjct: 410  PDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR 469

Query: 472  IYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVT 531
            +YT+F+    +++ ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y +  
Sbjct: 470  VYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFN 529

Query: 532  TVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINL 591
              +CP  EGF N  ++HF E E  SSVNHD++LK   FD+ GD+GYPLGWNS+  W IN+
Sbjct: 530  ISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINM 589

Query: 592  HSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNI 651
             S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW +DGYSIYLNVNDHNI
Sbjct: 590  KSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNI 649

Query: 652  VNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXX 711
            VNNPLDFNENCYLSLHG++L ID+T P +SI G Y D+ Y+ISTPMFR            
Sbjct: 650  VNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLN 709

Query: 712  EFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKM 771
            EFMK+KEVGRSY F + G Y +YSELDIDNVD+L++ CTS  T LHCYGFVMRYL+NVKM
Sbjct: 710  EFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKM 769

Query: 772  NYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTD--SGGLSDPYVRLRA 829
            NYFG+FF+F+TSEEYTGV+ A+E   V    + S+ D ++ L ++  +G + +       
Sbjct: 770  NYFGEFFNFVTSEEYTGVLGAREVGEV--VTKSSVVDLASTLDSEYQNGSMKN---DAED 824

Query: 830  DPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889
            + P+ RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYYM
Sbjct: 825  NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYM 884

Query: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949
            D++A ++ TSIKR+VS+Q +E+F+ IRR+NG  E+EHG L+ LTIHGHRMYGLPP EPTY
Sbjct: 885  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTY 944

Query: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXX 1009
            FCQW I+L  L INSD EF KGFFT F  +GFGY +LEN LLYD ET +DMTS       
Sbjct: 945  FCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAER 1004

Query: 1010 XXXXXX--XXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067
                       S+++V V +L FT IDFENERYSQRID+KVP L++ L     D      
Sbjct: 1005 INISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSF 1064

Query: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXX 1127
            ++  TK+  T+F Q +D  K RS+QR YI +NDSP++RC FLLP + Q+S  Y+      
Sbjct: 1065 LNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAI 1124

Query: 1128 XXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE----SFDTS 1183
                           +TID+IIED++GE+A  L+     +    +  S  E    SF   
Sbjct: 1125 APSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTED 1184

Query: 1184 QEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWK 1243
             + E  D + +      P   +     + DN +IDV ++ +D+DPL+  +   LL +F+ 
Sbjct: 1185 DDEEAADPLEFK-----PVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYS 1239

Query: 1244 VNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFD 1302
             + V ++D+IE+ IVKRL  L      + N+ ++V  +N  W +   +  +LY D++++ 
Sbjct: 1240 EDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQ 1299

Query: 1303 LGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMR 1362
            + +++ + +  +   E   L+K+++VRATV  +   E  E+RPPALSL +EG+E +S   
Sbjct: 1300 MSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTE 1359

Query: 1363 EKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDI 1422
            ++ V S++L S+DIT+DESQ+EWL  Y ++Q +LI+ + TS   +      T+ +L+  +
Sbjct: 1360 DRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKL 1419

Query: 1423 TTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SA 1480
            T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W+ N    
Sbjct: 1420 TAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKV 1479

Query: 1481 IQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVD 1535
            ++      + DA     SV S WR WE SD+ RSYIY  +FL+D +K +  S+KK+LK  
Sbjct: 1480 LKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCT 1539

Query: 1536 FHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKG 1595
              SF+ T+Y EGY V HNFV+  AN+V +  P         + + +  + +T  +G++KG
Sbjct: 1540 MGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLSSNREETIEITGKVGSVKG 1595

Query: 1596 ELNDQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNR 1654
            + +D+LLKL+++           +S     +SK +K+N +L  D+SE+Q V+ +T++ +R
Sbjct: 1596 KFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSR 1655

Query: 1655 ILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSY 1714
             + G+ +LL E LK+S + A S V F+++SE WLKH   +L EA   + S+  T E WS+
Sbjct: 1656 TVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSH 1715

Query: 1715 MPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPN-VQGTSTNLS 1773
             P++ +N QC++ H RAM++TE +VN+I +I ES+ ++K     +  + N  Q   + + 
Sbjct: 1716 KPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRI- 1774

Query: 1774 IPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSH 1833
                NT L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEIL+SIWD +  + SH
Sbjct: 1775 ----NTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSH 1830

Query: 1834 QTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGE 1893
            QT EQY  F+ GD+++K     E+ +++NV +S S++KLT SEPRRI++SFLQDEKL  +
Sbjct: 1831 QTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1890

Query: 1894 SLGYIKGLLQLF---SPL-ARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLA 1949
             +  +  L  LF    P+ A+ +T +  + W+LD N++YFGILVP+AST+FVFE+HMLL 
Sbjct: 1891 GINLLSSLNSLFLTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMLLL 1950

Query: 1950 AMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQS 2009
            ++ N ++G       +TGQ+SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++ QS
Sbjct: 1951 SLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQS 2010

Query: 2010 YQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQ- 2068
            +Q+ESSHFRVCLSP SL++++WG ++L  +++Y+ K    +  I    +F G +   ++ 
Sbjct: 2011 FQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPN--IWNIRMFTGKSDKPKEI 2068

Query: 2069 -IDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANG 2127
             I+FRSIHILSY  CIGW+FQ G     GL+ G++RLFSAYEK +GK T++D +FSV+NG
Sbjct: 2069 PINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNG 2128

Query: 2128 QSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDII 2187
             ++ TF+S+G+EK++YNRSFL N+QI+YW K    +KD F R +GEAL+V+ L +  D+I
Sbjct: 2129 NTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVI 2188

Query: 2188 ESTLASIQKFQTLKKERM------HKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKY 2241
            +STL SI+ FQ LKK  +      +  +S P    N EN SN+++PFL +IR+++C FKY
Sbjct: 2189 DSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKY 2248

Query: 2242 VGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILY 2301
             GGV ++Y+ DD+     PS E+KSP V I   Y H+E++ +PHRIR L+++DPTHN LY
Sbjct: 2249 DGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLY 2308

Query: 2302 SQCVPILNDIVEASQRMVQKHSPDETPLE----SSQSIDYKSLLDSFDIAFKVTSGRQQL 2357
            + C P+L +  E+ Q M++KHS  E        S+Q++DYK LLD FD+A K+TS +QQL
Sbjct: 2309 AGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQL 2368

Query: 2358 SLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFS 2417
            SLSCEP+AKVQADVGF+SF F +TTN+     P G SL++E+ ++S++HIFSRE S SF 
Sbjct: 2369 SLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFE 2428

Query: 2418 VDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKD 2474
            V F+D T +FTHPDV   +G +LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +   + 
Sbjct: 2429 VGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRP 2488

Query: 2475 DDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHY 2534
            ++++    +++ +      T I W FTLIFTN+ GDVDLGPSLGV+SLR  RTW ATDHY
Sbjct: 2489 NNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHY 2548

Query: 2535 GAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRV 2594
              +R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +P   S      +S SL++  V
Sbjct: 2549 DEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDV 2608

Query: 2595 AIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILD 2654
            A+K AFDYHMFLIGTI+ ++FHL +E D  GILPDLL V+ S  E+   +TAL AANILD
Sbjct: 2609 AVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILD 2668

Query: 2655 IYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQIS 2714
            IYNTI RMRQDN+ISY+ETLR+SN +E++  +LY DIL+SL LLRTDLS +I++ K QIS
Sbjct: 2669 IYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQIS 2728

Query: 2715 PISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKIS 2774
            PISLFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+
Sbjct: 2729 PISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIA 2788

Query: 2775 IEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINF 2834
            I+DYM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGPINF
Sbjct: 2789 IDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINF 2848

Query: 2835 IKEMWSTHIKSLAVRQTQ-SNKTMSEKDKQADLD-PEEEIKAKLQYVPLDEPYIEMPQIK 2892
            IKEMW+TH+K+LAVR++Q +N +  + +++ +     EE  +K  Y+ L+EP IE+PQI+
Sbjct: 2849 IKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREENASKFNYIALEEPQIEVPQIR 2908

Query: 2893 DLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937
            DLG+ATPPMEWFGV+RKRLP  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2909 DLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3035 bits (7868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1490/2982 (49%), Positives = 2053/2982 (68%), Gaps = 74/2982 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            ME  SQ   V L+++++FSWVFLVDW+L  V  LT++FY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KVKI+VE+LR++ L G I F++L +I KD TISIL+GS+ W+Y LL  R+++        
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL------- 113

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
                +      S  N+ LPC+F L CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 114  ----IDNNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            +    E F   S                      INDR + E    K   F++FLP+EL 
Sbjct: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELN 229

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
             SRGS++LGNKFTPS++I S  SG G+VD+  PKE++DLY+   Q++F + +ISI+QNI 
Sbjct: 230  FSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIG 289

Query: 301  YNRK---KATFKNGKLSRMWATFVKVLHI---PFYNK-SHNNKGTESEPFMTKWKGLGLY 353
            Y+     K     GK+S++W  F++VL +   P  +K +  N  + ++ F  KWKGL LY
Sbjct: 290  YDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLY 349

Query: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410
            K  + +    D D++ FD  NHEYAK ++I+K P+  ++Y  D+PGVVPHGAHPT+   +
Sbjct: 350  KATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDID 409

Query: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSR
Sbjct: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 469

Query: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530
            R+YT+F+    + + ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y + 
Sbjct: 470  RVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANF 529

Query: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590
               +CP  EGF N  ++HF E E  SSVNHD++LK   F++ GD+GYPLGWNS A W IN
Sbjct: 530  NISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIIN 589

Query: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650
            + S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 590  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649

Query: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXX 710
            IVNNPLDFNENCYLSLHG++L IDVT P +SI G Y D+ Y+ISTPMFR           
Sbjct: 650  IVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTL 709

Query: 711  XEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770
             EFMK+KEVGR+Y F + G Y +YSELDIDNVDTL +ECTS  T LHCYGFVMRYL NVK
Sbjct: 710  NEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVK 769

Query: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVR--LR 828
            MNYFG+FF+F+TSEEYTGV+ A++   V  T + S+ D +   ST   G  +  V+    
Sbjct: 770  MNYFGEFFNFVTSEEYTGVLGARDVGDV--TTKSSVVDLA---STVDSGYQNSSVKNNSE 824

Query: 829  ADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYY 888
            A  P+ RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYY
Sbjct: 825  AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYY 884

Query: 889  MDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPT 948
            MD++A +  TSIKR+VS+Q +E+F+ IRR+NG  E+EHGSL+ LTIHGHRMYGLPP EPT
Sbjct: 885  MDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPT 944

Query: 949  YFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXX 1008
            YFCQW I+L  L+I+SD EF KGFF+ F  IGFGY +LEN LLYD ET DDMTS      
Sbjct: 945  YFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAE 1004

Query: 1009 XXXXXXX--XXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIR 1066
                        S++V+   ++ FT IDFENE YSQRID+KVP L I L     D   + 
Sbjct: 1005 RIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMS 1064

Query: 1067 LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXX 1126
             +   TK+  T+F Q +D  K RS+QR YIT +DSP++RCSFLLP + Q+S  Y+     
Sbjct: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGA 1124

Query: 1127 XXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRT-VDDPDSPSESFDTSQE 1185
                            +TIDFIIED++GE+A  L+     + +  + P +   S  +  E
Sbjct: 1125 IAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTE 1184

Query: 1186 HEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVN 1245
             +  ++     F   P   + +  ++ DN ++DV ++ +D+DPL+  +   LL + +  N
Sbjct: 1185 DDNDEEASSSGFK--PGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSEN 1242

Query: 1246 TVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLG 1304
             V ++D+IE+ IVKRL  L    T + N+ +++  +N  W +   +  +LY D++D+ + 
Sbjct: 1243 MVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMR 1302

Query: 1305 QRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREK 1364
            +++ + +  T + E   L+++++VR TV  +   +  E+RPPALSL +EG+E +S    +
Sbjct: 1303 EKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGR 1362

Query: 1365 IVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITT 1424
             V S++L S+DIT+DESQ+EWL  Y ++Q +L++ + TSF  + +    ++ +L+ ++T 
Sbjct: 1363 QVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTA 1422

Query: 1425 ASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SAIQ 1482
            ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W+NN    ++
Sbjct: 1423 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLK 1482

Query: 1483 VSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFH 1537
                  + DA     SV S WR WE SD+ RSYIY  +F +D  K +   +KK+LK    
Sbjct: 1483 ERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMG 1542

Query: 1538 SFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGEL 1597
            SF+ T+Y EGY V HNFV+  AN+V +  P         +L+ +  + +T  +G++KG+ 
Sbjct: 1543 SFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLSLNREETIEITGRIGSVKGKF 1598

Query: 1598 NDQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRIL 1656
            +D+LLKL+++    A      +S     +SK +++N +L  D+SELQ V+ +T+L +R +
Sbjct: 1599 SDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTV 1658

Query: 1657 NGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMP 1716
             G+ +LL E LK+S + A S V F+++SE WLKHA ++L EA  R+ S+  T E WS+ P
Sbjct: 1659 GGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKP 1718

Query: 1717 SLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELK-RHFAMEKTTPNVQGTSTNLSIP 1775
            ++ IN QC++ H RAM+STE  V +I +I ES  ++K R     K+    Q     +   
Sbjct: 1719 TILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQFVGQKI--- 1775

Query: 1776 LQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQT 1835
              NT LT  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEILISIWD +  + SHQT
Sbjct: 1776 --NTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQT 1833

Query: 1836 TEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESL 1895
             EQY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL  + +
Sbjct: 1834 KEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893

Query: 1896 GYIKGLLQLF--SPLARNKTQSSAL--RWSLDANLNYFGILVPMASTFFVFEIHMLLAAM 1951
              +  L  LF  S + + + Q  AL   W+LD +++YFGIL+P+AST+FVFE+HMLL ++
Sbjct: 1894 NLLCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSL 1953

Query: 1952 NNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQ 2011
             N ++G    +  VTGQ SIEN L LIKE SLP  LSK+LDFSI+V + Q+  ++ QS+Q
Sbjct: 1954 TNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQ 2013

Query: 2012 IESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQI-- 2069
            +ESSHFRVCLSP SL++++WG H+L  L  Y+ KH   +  I    +F G +   ++I  
Sbjct: 2014 VESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPN--IWNIKMFTGKSDKPKEIPL 2071

Query: 2070 DFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQS 2129
            +FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYE+ +GK T++D +FSVANG +
Sbjct: 2072 NFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNT 2131

Query: 2130 TDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIES 2189
            + TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D+I+S
Sbjct: 2132 SSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDS 2191

Query: 2190 TLASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVG 2243
            TL S++ FQ LK+      E  H  DS      ++EN  ++++PFL++IR+++  FKY G
Sbjct: 2192 TLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDG 2251

Query: 2244 GVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQ 2303
            GV ++Y+ +D+     PS EIKSP V I   Y H+E + RPH+IR L+++DPTHN LY+ 
Sbjct: 2252 GVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAG 2311

Query: 2304 CVPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQLSLS 2360
            C P+L +  E+ Q+M++KHS DE P     S Q++DYK LLD FD+A K+TS +QQLSLS
Sbjct: 2312 CAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLS 2371

Query: 2361 CEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDF 2420
            CEP+AKVQADVGF+SF F VTTN+    +P   SL++E  ++S++HIFSRE S SF V F
Sbjct: 2372 CEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGF 2431

Query: 2421 VDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDR 2477
            +D T +FTHPDV   +G+ LVSD+NVFFN+KQLQNL LFLDIW+ +  L+ +   +  ++
Sbjct: 2432 MDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNK 2491

Query: 2478 KKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQ 2537
                 S+T +      T I W FTLIFTNV GDVDLGPSLGV+SLR  RTW ATDHY  +
Sbjct: 2492 GIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEK 2551

Query: 2538 RRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIK 2597
            R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +           +S SL++  +AIK
Sbjct: 2552 RQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIK 2611

Query: 2598 TAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYN 2657
             AFDYHMFLIGTI+ + F L +E D  G+LPDLL V+ S  E+   +TAL AANILDIYN
Sbjct: 2612 AAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYN 2671

Query: 2658 TITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPIS 2717
            TI RMRQDN+ISY+ETLR+SN  E+R  +LY DIL+SL LLRTDLS  I++ K QISPIS
Sbjct: 2672 TIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPIS 2731

Query: 2718 LFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIED 2777
            LFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+I+D
Sbjct: 2732 LFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDD 2791

Query: 2778 YMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKE 2837
            YM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGP+NFIKE
Sbjct: 2792 YMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKE 2851

Query: 2838 MWSTHIKSLAVRQTQ-SNKTMSEKDKQADLD-PEEEIKAKLQYVPLDEPYIEMPQIKDLG 2895
            MW+TH+K+LAVR++Q +N +  + +++ +    +EE  +K  Y+ L+EP IE+PQI+DLG
Sbjct: 2852 MWTTHVKALAVRRSQIANISFGQTEEELEESINKEETASKFNYIALEEPQIEVPQIRDLG 2911

Query: 2896 DATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937
            DATPPMEWFGV+RKR P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2912 DATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3034 bits (7866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1507/2989 (50%), Positives = 2044/2989 (68%), Gaps = 87/2989 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            ME  SQ   V L+++++FSWVFLVDW+L  V+ LT+IFY+GR++AY +T +LEW LWK  
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
             +KI+VE+LR++ L G I F++L +I KD TIS+L+GSL W+Y LL  R+++  E  + K
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIE--NNK 118

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
            D L          KN+ LPC+F L CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 119  DSLS---------KNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            +    E F   S                      INDR + E    K   F++FLP+EL+
Sbjct: 170  EHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELK 229

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
             +RGS++LGNKFTPS++I S  +G GV+D+  PKE+LDLY+   Q++F + +ISI+QNI 
Sbjct: 230  FNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIG 289

Query: 301  YNRK---KATFKNGKLSRMWATFVKVLHI---PFYNKSHNNK-GTESEPFMTKWKGLGLY 353
            Y+     K     GK+S++W TFV+VL I   P  +K +  K G   + F  KWKGL LY
Sbjct: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLY 349

Query: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410
            K    D    D D++ FDF NHEYAK ++I+K P+  + Y  D+ G VPHGAHPT+   +
Sbjct: 350  KAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDID 409

Query: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R+S P+K L PGSR
Sbjct: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSR 469

Query: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530
            RIYT+F+    +++ ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y + 
Sbjct: 470  RIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANF 529

Query: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590
              VLCP  EGF N  ++HF E E  SSVNHD++LK   F++ GD+GYPLGWNS A W IN
Sbjct: 530  NVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIIN 589

Query: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650
            + S QLE FLLREH+TLVAD  +DFS+GEPTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 590  MKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649

Query: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXX 710
            IVNNPLDFNENCYLSLHG+ L ID+T P +SI G Y D+ Y+ISTPMFR           
Sbjct: 650  IVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTL 709

Query: 711  XEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770
             EFMK+KEVGR+Y F V G Y +YSELDIDNVDTL +ECTS  T LHCYGFVMRYL NVK
Sbjct: 710  NEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVK 769

Query: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGK-TEEESLRDNSTNLSTDSGGLSDPYVRLRA 829
            MNYFG+FF+F+TSEEYTGV+ A+E   VG+   + S+ D ++ L  DSG  +        
Sbjct: 770  MNYFGEFFNFVTSEEYTGVLGARE---VGEIITKSSVLDLASTL--DSGYQNSSLKNESE 824

Query: 830  DP-PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYY 888
            D  PV RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYY
Sbjct: 825  DKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYY 884

Query: 889  MDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPT 948
            MD++A ++ TSIKR+VS+  +E+F+ IRR+NG  E+EHG+L+ LTIHGHRM+GLPP EPT
Sbjct: 885  MDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPT 944

Query: 949  YFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXX 1008
            YFCQW I+L  LTI+SD EF KGFF  F  IGFGY +LEN LLYD ET DDMTS      
Sbjct: 945  YFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAE 1004

Query: 1009 XXXXXXX--XXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIR 1066
                        S++VV   +L FT IDFENERYSQRID+K+P L I L     D     
Sbjct: 1005 RIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTS 1064

Query: 1067 LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXX 1126
             +   TK+  T+F Q +D  K RS+QR YIT +DSP++RC FLLP + Q+S  Y+     
Sbjct: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGA 1124

Query: 1127 XXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEH 1186
                            +TIDFIIED++GE+A  L+     +    +  S  E    S   
Sbjct: 1125 IAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASST- 1183

Query: 1187 EGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNT 1246
            E  +D R D     P   +     Q  N +IDV ++ +D+DPL+  +   LL EF+  + 
Sbjct: 1184 EDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDM 1243

Query: 1247 VDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQ 1305
            V ++D+IE+ IVK+L  L    T + N+ +++  +N  W +   +  +LY D++D+ + +
Sbjct: 1244 VQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSE 1303

Query: 1306 RTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKI 1365
            ++ + +  + + E  TL+++++VR TV  +   +  E+RPPALSL +EG+E +S   ++ 
Sbjct: 1304 KSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQ 1363

Query: 1366 VGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTA 1425
            V S++L S+DIT+DESQ+EWL  Y ++Q +LI+  L SF  +      ++ +L+  +T A
Sbjct: 1364 VNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAA 1423

Query: 1426 SEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SAIQV 1483
            SE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W++N    ++ 
Sbjct: 1424 SEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKE 1483

Query: 1484 SPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHS 1538
                 + DA     SV S WR WE SD+ RSYIY  +F  D ++ +   +KK+LK    S
Sbjct: 1484 RKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGS 1543

Query: 1539 FFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELN 1598
            F+ T+Y EGY V HNFVI  AN+V +  P         +L+ +  + +T  +G++KG+ +
Sbjct: 1544 FYLTVYGEGYEVEHNFVIADANLVVDLTPPV----TSLSLNREETIEITGRVGSVKGKFS 1599

Query: 1599 DQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILN 1657
            D+LLKL+++    A      +S     +SK +K+N +L  D+SE+Q V+ QT+L +R + 
Sbjct: 1600 DRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVG 1659

Query: 1658 GKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPS 1717
            G+ +LL E LK+S + A S V F+++SE WLKHA ++L EA  R+ S+  T E WS+ P+
Sbjct: 1660 GRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPT 1719

Query: 1718 LSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQ 1777
            + IN QC++ H RAM++TE  V  I +I ES+ ++K      K  P  +  S  +  P  
Sbjct: 1720 ILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRI---KFKPKSKKRSQFVG-PKI 1775

Query: 1778 NTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTE 1837
            N  L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNE+L+SIWD +  + SHQT E
Sbjct: 1776 NIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKE 1835

Query: 1838 QYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLG- 1896
            QY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL  + +  
Sbjct: 1836 QYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINL 1895

Query: 1897 --------YIKGLLQLFSPLARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLL 1948
                    +  GL +     A     +  + W+LD ++ YFGILVP+AST+FVFE+HMLL
Sbjct: 1896 LSSLKSLLFTSGLPKKKKKKA----PARMINWTLDTSITYFGILVPVASTYFVFELHMLL 1951

Query: 1949 AAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQ 2008
             ++ N ++G    +  VTGQ SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++ Q
Sbjct: 1952 LSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQ 2011

Query: 2009 SYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQ 2068
            S+Q+ESSHFRVCLSP SL++++WG H+L  L  Y+   R+    I    +F G +   ++
Sbjct: 2012 SFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYS--RRHAPNIWDIKMFTGKSDKPKE 2069

Query: 2069 --IDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVAN 2126
              I+FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYEK +GK T++D +FSVAN
Sbjct: 2070 IPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVAN 2129

Query: 2127 GQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDI 2186
            G  + TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D+
Sbjct: 2130 GNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDV 2189

Query: 2187 IESTLASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFK 2240
            I+STL S++ FQ LKK      E  H  D  P    ++E+ SN+++PFL +IR+++  FK
Sbjct: 2190 IDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFK 2249

Query: 2241 YVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNIL 2300
            Y GGV ++Y+ DD+     PS EIKSP V I   Y HNE E +PHRIR L+++DPT N L
Sbjct: 2250 YDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTL 2309

Query: 2301 YSQCVPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQL 2357
            Y+ C P+L +  E+ Q+M++KHS D+ P     SSQ++DYK LLD FD+A K+TS +QQL
Sbjct: 2310 YAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQL 2369

Query: 2358 SLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFS 2417
            SLSCEP+AKVQADVGF+SF F +TTN+     P   SL++++ ++S+RHIFSRE S SF 
Sbjct: 2370 SLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFE 2429

Query: 2418 VDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKD 2474
            V F+D T +FTHPDV   +G +LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +     
Sbjct: 2430 VGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGS 2489

Query: 2475 DDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHY 2534
              ++    S+T +        I W FTLIFTNV GDVDLGPSLGV+SLR  RTW ATDHY
Sbjct: 2490 ISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHY 2549

Query: 2535 GAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRV 2594
              +R++LHAF D +S+ SEGRLSG+F++ NA+WISEV +    S      +S SL++  V
Sbjct: 2550 SEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDV 2609

Query: 2595 AIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILD 2654
            A+K AFDYHMFLIGTI+ ++F L +E D  GILPDLL V+ S  E+   +TAL AANILD
Sbjct: 2610 AVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILD 2669

Query: 2655 IYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQIS 2714
            IYNTI RMRQDN+ISY+ETLR+SN  E++  +LY DIL+SL LLRTDLS +I++ K QIS
Sbjct: 2670 IYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQIS 2729

Query: 2715 PISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKIS 2774
            PISLFDVEVLV+ I NVS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+
Sbjct: 2730 PISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIA 2789

Query: 2775 IEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINF 2834
            I+DY+ YASKI GGTI+ +P+L V MTT Q+ K++ IEYLF C F D+++VKWNLGP+NF
Sbjct: 2790 IDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNF 2849

Query: 2835 IKEMWSTHIKSLAVRQTQ-SNKTMSEKDKQADLDPEEEIK-----AKLQYVPLDEPYIEM 2888
            IKEMW+TH+K+LAVRQ+Q +N +  + +++     EE IK     +K  Y+ L+EP I++
Sbjct: 2850 IKEMWTTHVKALAVRQSQIANVSFGQTEEEL----EESIKTKETTSKFNYIALEEPQIQV 2905

Query: 2889 PQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937
            PQI+DLGDATPPMEWFGV+RKR P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2906 PQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3006 bits (7792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1481/2986 (49%), Positives = 2040/2986 (68%), Gaps = 82/2986 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            ME  SQ   V L+++++FSWVFLVDW+L  VV LT+IFY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            K+KI+VE+LR++ L G I F+NL +I KD TIS+L+GSL W+Y LL  R+++  E +   
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
             G           K   LPC+  + CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 121  SG-----------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            +    E F   S                      +NDR + E    K    + FLP+EL+
Sbjct: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELK 229

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
             SRGS++LGNKFTPS++I S  SG+G++D+  PKE+LDLY+   Q++F + +ISI+QNI 
Sbjct: 230  FSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIG 289

Query: 301  YNRK---KATFKNGKLSRMWATFVKVLHIPFYNKSHN----NKGTESEPFMTKWKGLGLY 353
            Y+     K     GK+S++W TFV+V  I            + GT  + F  KWKGL LY
Sbjct: 290  YDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLY 349

Query: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410
            K    D    D D+V FD  NHEYAK ++I+K P+  + Y  D+PGVVPHGAHPT+   +
Sbjct: 350  KASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDID 409

Query: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSR
Sbjct: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 469

Query: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530
            RIYT+F+    +++ ++WRIPTRE SKD EFLK +K T+EEYRPFGW+DL+F  D+Y + 
Sbjct: 470  RIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANF 529

Query: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590
               +CP  +GF N  ++HF E E  SSVNHD++LK   FD+ GD+GYPLGWNS A W IN
Sbjct: 530  NISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIIN 589

Query: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650
            + S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 590  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649

Query: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXX 710
            IVNNPLDFNENCYLSLHG++L IDVT P +SI G Y D+ Y+ISTPMFR           
Sbjct: 650  IVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTL 709

Query: 711  XEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770
             EFMK+KEVGR+Y F + G Y +YSELDIDNVDTL +EC S  T LHCYGFVMRYL NVK
Sbjct: 710  NEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVK 769

Query: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRAD 830
            MNYFG+FF+F+TSEEYTGV+ A+E   V  T + S+ D ++  + DSG  +        D
Sbjct: 770  MNYFGEFFNFVTSEEYTGVLGAREVGDV--TTKSSVADLAS--TVDSGYQNSSLKNESED 825

Query: 831  P-PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889
              P+ RSD+KRTTNETDIWFTFSVW+GAL+LPETIY+ DPC+ALHF EL+VD RSCNYYM
Sbjct: 826  KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYM 885

Query: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949
            D++A ++ TSIKR+VS+Q +E+F+ IRR+NG  E+EHG L+ LTIHGHRMYGLPP EPTY
Sbjct: 886  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTY 945

Query: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXX 1009
            FCQW I+L  L I+SD EF KGFF  F  IGFGY +LEN LLYD ET +DMTS       
Sbjct: 946  FCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEK 1005

Query: 1010 XXXXXX--XXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067
                       S++V+   ++ FT IDFENE+YSQRID+K+P L+I L     D      
Sbjct: 1006 IRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSF 1065

Query: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXX 1127
            +   TK+  T+F Q +D  K RS+QR YIT++DSP++RC FLLP + Q+S  Y+      
Sbjct: 1066 LKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAI 1125

Query: 1128 XXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGL------KCDYDTQRTVDDPDSPSESFD 1181
                           +TID+IIED++GE+A  L      K  +    +  +P   S S D
Sbjct: 1126 APSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSED 1185

Query: 1182 TSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEF 1241
             + E   P   +       P   + +   + DN ++DV ++ +D+DPL+  +   LL + 
Sbjct: 1186 DNDEEADPSSFK-------PVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQL 1238

Query: 1242 WKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLD 1300
            +  N V ++D+IE+ IVKRL  L    T + N+ +++  +N  W +   +  +LY D++D
Sbjct: 1239 YSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRID 1298

Query: 1301 FDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSW 1360
            + + +++ + +    + E   L+K+++VR TV  +   +  E+RPPALSL +EG+E +S 
Sbjct: 1299 YQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSS 1358

Query: 1361 MREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLR 1420
              ++ V S++L S+DIT+DESQ+EWL  Y ++Q +LI+ + TSF  +      ++ +L+ 
Sbjct: 1359 TEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELIS 1418

Query: 1421 DITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN-- 1478
             +T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W++N  
Sbjct: 1419 KLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNID 1478

Query: 1479 SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLK 1533
              ++      + DA     SV S WR WE SD+ RSYIY  +F ++  K +   +KK+LK
Sbjct: 1479 EVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLK 1538

Query: 1534 VDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAI 1593
                SF+ T+Y EGY V HNFV+  AN+V +  P           + +  + +T  +G++
Sbjct: 1539 CTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLPSNREETIEITGRVGSV 1594

Query: 1594 KGELNDQLLKLRNIFSK-AQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLT 1652
            KG+ +D+LLKL+++    A      +S     +SK +K+N +L  D+SELQ V+ QT+L 
Sbjct: 1595 KGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLM 1654

Query: 1653 NRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELW 1712
            +R + G+ +LL E LK+S + A S V F+++SE WLKH  ++L EA  R+ S+  T E W
Sbjct: 1655 SRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAW 1714

Query: 1713 SYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELK-RHFAMEKTTPNVQGTSTN 1771
            S+ P++ IN QC++ H RAM+STE LV +I +I ES+  +K R     K+    Q     
Sbjct: 1715 SHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQFVDQK 1774

Query: 1772 LSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILK 1831
            +     NT L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEIL+SIWD +  + 
Sbjct: 1775 I-----NTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMT 1829

Query: 1832 SHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLI 1891
            SHQT EQY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL 
Sbjct: 1830 SHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLA 1889

Query: 1892 GESLGYIKGLLQLF--SPLARNKTQSSA--LRWSLDANLNYFGILVPMASTFFVFEIHML 1947
             + +  +  L  LF  S L + + Q+ +  + W+LD ++ YFG+LVP+AST+FVFE+HML
Sbjct: 1890 SQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHML 1949

Query: 1948 LAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSP 2007
            L ++ N ++G    +  VTGQ SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++ 
Sbjct: 1950 LLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTE 2009

Query: 2008 QSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADR 2067
            QS+Q+ESSHFRVCLSP SL++++WG H+L  L  Y+   R+    I    +F G +   +
Sbjct: 2010 QSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYS--RRHAPNIWNTKMFTGKSDKSK 2067

Query: 2068 Q--IDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVA 2125
            +  I+FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYEK +GK T++D +FSVA
Sbjct: 2068 EMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVA 2127

Query: 2126 NGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFD 2185
            NG ++ TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D
Sbjct: 2128 NGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMD 2187

Query: 2186 IIESTLASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQF 2239
            +IESTL S++ FQ LKK      E +   +       ++E+ S++++PFL +IR+++  F
Sbjct: 2188 VIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNF 2247

Query: 2240 KYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNI 2299
            KY GGV ++Y+ +D+     PS EIKSP V I   Y H+E + +PH+ R L+++DPTHN 
Sbjct: 2248 KYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNT 2307

Query: 2300 LYSQCVPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQ 2356
            LY+ C P+L +  E+ Q+M++KHS DE P     SSQ++DYK LLD FD+A K+TS +QQ
Sbjct: 2308 LYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQ 2367

Query: 2357 LSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASF 2416
            LSLSCEP+AKVQADVGF+SF F + TN+     P   SL++E  ++S++HIFSRE S SF
Sbjct: 2368 LSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSF 2427

Query: 2417 SVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAK 2473
             V F+D T +FTHPDV   +G  LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +   +
Sbjct: 2428 EVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQR 2487

Query: 2474 DDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDH 2533
              +++ +  S+T +      T I W FTLIFTNV GDVDLGPSLG++SLR  RTW ATDH
Sbjct: 2488 TVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDH 2547

Query: 2534 YGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGR 2593
            Y  +R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +P   S      +S SL++  
Sbjct: 2548 YNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDD 2607

Query: 2594 VAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANIL 2653
            +A+K AFDYHMFLIGTI  + FHL +E D  G+LPDLL V+ S  E+   +TAL  ANIL
Sbjct: 2608 IAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANIL 2667

Query: 2654 DIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQI 2713
            DIYNTI RMRQDN+ISY+ETLR+SN  E+R  +LY DIL+SL LLRTDLS +I++ K QI
Sbjct: 2668 DIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQI 2727

Query: 2714 SPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKI 2773
            SPISLFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I
Sbjct: 2728 SPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASI 2787

Query: 2774 SIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPIN 2833
            +I+DYM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGP++
Sbjct: 2788 AIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVD 2847

Query: 2834 FIKEMWSTHIKSLAVRQTQ-SNKTMSEKDKQADLD-PEEEIKAKLQYVPLDEPYIEMPQI 2891
            FIKEMW+TH+K+LAVR++Q +N +  + +++ +    +EE  +K  Y+ L+EP IE+PQI
Sbjct: 2848 FIKEMWTTHVKALAVRRSQVANISFGQTEEELEESIKKEEAASKFNYIALEEPQIEVPQI 2907

Query: 2892 KDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937
            +DLGDATPPMEWFGV+RK+ P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2908 RDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2960 bits (7674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1461/2981 (49%), Positives = 2044/2981 (68%), Gaps = 66/2981 (2%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+  SQF+R+ L+ +++FSWVFLVDW+L+ +VTL VIFYL R  AY I+ +LEWFLWK  
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
             VKI++ES+RI+PL G + F+N+ II +D TIS L+ ++ WRY LL  R+S Y+      
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPEL-- 118

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
                    D  S  ++ LPCRF L  EG EIF+YNR VAY+NII  FS+EER QFEKF++
Sbjct: 119  -------PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLN 171

Query: 181  KQEMSE-LFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMEL 239
            +Q  ++      +  S+ +                 NDRVF E  +++   F+ FLP++ 
Sbjct: 172  EQVFTDSKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQ-FLDFLPIDF 230

Query: 240  QLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNI 299
            ++S GS+++GNKFTPSL+I SC+S  G++D+CQP EKLDLYK+ F +DF    I I+QNI
Sbjct: 231  KVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNI 290

Query: 300  EYNRK---KATFKNGKLSRMWATFVKVLHIPFYNK--SH--NNKGTESEPFMTKWKGLGL 352
             +N +   K      ++S+MW  F KVL   + +   SH  +NK +E +PF  KW+GL L
Sbjct: 291  GFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSL 350

Query: 353  YKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL--- 409
            Y+G  F +  +D +++ FDFANHEYAK S+I+++P+ + T+  DIPG+VPHGAHPTL   
Sbjct: 351  YRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTAT 410

Query: 410  EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGS 469
            +GP+VGN+GAPPEF +++Q  G +IC+GPWAQR++  L+R++SP  +R++ P K L+PG 
Sbjct: 411  DGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGC 470

Query: 470  RRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGS 529
             RIYT FKTT    + ++WRIPTRE SKD EFL+ ++ T+EEYRPFGW+DLKF+ D+Y  
Sbjct: 471  TRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYIC 530

Query: 530  VTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTI 589
             T   CP +EGF N + IH  + E  SSVNHD++LKC  F+   D+G+PLGWN  ATWTI
Sbjct: 531  STVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTI 590

Query: 590  NLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDH 649
            +L STQLE F+LREH+TL+AD  TDFSSGEPTPYELFRPF+Y+INW I+GYS+YLNVNDH
Sbjct: 591  DLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDH 650

Query: 650  NIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXX 709
            NIVNNPLDFNENCYLS HG+ L ID+  P   ++  + +V Y I TPMFR          
Sbjct: 651  NIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNT 710

Query: 710  XXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNV 769
              EFMKNKEVGRS+ F + G Y +YSELDIDNVDT+ +EC+S  T L CYGFV+RYL NV
Sbjct: 711  LNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNV 770

Query: 770  KMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRA 829
            KMNYFGDFFHF+TSEEYTG IRA E ++   T+ +   D ++  S +S   S        
Sbjct: 771  KMNYFGDFFHFVTSEEYTGEIRANEVQN-QFTDRQLYEDKASLSSYESIETSSVRKEQTG 829

Query: 830  DPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889
            D  + RSD+KR TNETD+WFTF+VWEGA++LPETIYNCDPC+ LHFGEL++D RSCNYYM
Sbjct: 830  DSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYM 889

Query: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949
            DLLA+M+  S++RY+ +Q +E++ES+R+DNG   K++GSL+ + IH HRMYGLPP+EPTY
Sbjct: 890  DLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTY 949

Query: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXX--XXX 1007
            FCQW   L  L +N D  F +GF T F  I FG  +LEN LLY+ E  DDMTS       
Sbjct: 950  FCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKK 1009

Query: 1008 XXXXXXXXXXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067
                       +  +     L F++I+FENE+Y  R+DL++P  ++ + T  + ++  +L
Sbjct: 1010 ISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTM-NGAKKEKL 1068

Query: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXX 1127
             +  TKV L++F +  D A H+SKQ++YITL+D+P++RC+F+LP  LQ+S +Y+      
Sbjct: 1069 FEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSI 1128

Query: 1128 XXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHE 1187
                            TID+I++DLLG F   L    +++     P SP+ S       E
Sbjct: 1129 APSSSLPPLPIPLLPATIDYIVDDLLGCFPEIL----ESENPFRIPFSPATSPKLGNPFE 1184

Query: 1188 GPDDVRYDRFAQLP-KILSPNPLEQY--DNVIIDVKFLAVDLDPLICSYVDGLLGEFWKV 1244
            G D    +    L  K  +    E +  DN +ID+ + ++ ++P + SY+D     F   
Sbjct: 1185 GSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQ 1244

Query: 1245 NTVDIIDEIEMSIVKRLGQLWNNT-CVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDL 1303
            + V I+D+IE+ IV  L  L        N+KL ++ ++ FWGD+    + LY D++D ++
Sbjct: 1245 DIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEM 1304

Query: 1304 GQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMRE 1363
             Q+  + + ET ++E   L+K+RSVRAT+ + S     +ERPPALSL +EG E +S +  
Sbjct: 1305 CQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITN 1364

Query: 1364 KIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDIT 1423
              V S+++LS DIT+DE+Q++WL  YI +Q  L + + ++   + E    TR+ L+  + 
Sbjct: 1365 AQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLA 1424

Query: 1424 TASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEW-------R 1476
             ASE+YQISH+PYVITKPAFI RLS GHVREN SW+IITRLRHILTYLP +W       R
Sbjct: 1425 VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMR 1484

Query: 1477 NNSAIQVSPTVDSTDASVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDF 1536
            N       P   +   SV S+WR WE SDI RSYIYR +F    SK Q  S++  +K+  
Sbjct: 1485 NQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKL 1544

Query: 1537 HSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGE 1596
             S FFT+YS GY V HNF++TR N+V E +PA   S + Q    + ++N+T SLG IKG+
Sbjct: 1545 ASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQ----EKIINVTGSLGTIKGK 1600

Query: 1597 LNDQLLKLRNIFSKAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRIL 1656
             + +L+ L+ +  +      K  K S    + +K+N+LL F+RSELQFVLG +++ +R+ 
Sbjct: 1601 TSHKLINLKKLLPELSMK--KNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVF 1658

Query: 1657 NGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMP 1716
             GK ++L E  K+ A+ A+S   +A+RSE W+KH +++LAE+  RE S+ +TAE WSY P
Sbjct: 1659 GGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKP 1718

Query: 1717 SLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPL 1776
            ++ +N+QC++ H RAMT+T++L  S+ +I+E+I EL++ F  +  +   Q +   +    
Sbjct: 1719 TVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQK 1778

Query: 1777 QNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTT 1836
             N  LT  F++V  E+MPL+PF  RH  KQL +Y NR+ SN++++S+WD ++ L SH T 
Sbjct: 1779 INMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTK 1838

Query: 1837 EQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLG 1896
            E+YF F+ G++Q+K N+    +  +N+ +S S++KLTL + RR++ SFLQDEK++ ESL 
Sbjct: 1839 EEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLE 1898

Query: 1897 YIKG--LLQLFSPLARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNA 1954
                  L Q   P    +     + WSL++N+NYFG+LVP++ST+F+ E+HMLL ++N  
Sbjct: 1899 QFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKI 1958

Query: 1955 SDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIES 2014
              G     + ++GQ SI+N   L+KE SLPADLSK+LDFSI+V + QK+  +P+S+QIES
Sbjct: 1959 Q-GISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIES 2017

Query: 2015 SHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRK--QDKAISPFSLFDGSASADRQIDFR 2072
             HFRVCLSPGSL  +LW  +Q  + + Y+++H     +K I   +  + + SA+ Q DF 
Sbjct: 2018 PHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVI---NFKNTNNSAEVQADFP 2074

Query: 2073 SIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDT 2132
            S H+LSYN C+GW+F    D + GLIIG+ RLFSAYEK++GKLTLID YFSVANG+++DT
Sbjct: 2075 SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDT 2134

Query: 2133 FYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLA 2192
            F+S+G EK RYNRS+L N+QI+YWLK    ++D+++R +GEAL+V+ L++  D+IES+L 
Sbjct: 2135 FFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLE 2194

Query: 2193 SIQKFQTLKKERMHKRDS-GPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSL 2251
            SIQKFQ LK++ +    +   + +   +    +ISPF + IR+I+CQF+Y GGV K++S 
Sbjct: 2195 SIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSS 2254

Query: 2252 DDLNRAEGPSLEIKSPGVVIALKYNHNEAE-RRPHRIRCLVSIDPTHNILYSQCVPILND 2310
             + +    PS EIKSP V+I + Y +NE + + P  IR L++I+ THN L+++C P++ +
Sbjct: 2255 AEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAE 2314

Query: 2311 IVEASQRMVQKHSPDETPLE---SSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKV 2367
              E  Q+MV++HS D  P     S Q+IDYK +LDSFD+A +V S +Q LSL CEPRAKV
Sbjct: 2315 FSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKV 2374

Query: 2368 QADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIF 2427
            QAD+GF SFTF VTTND     P   +LSVEK ++S++HIFSRE S SF VDF+D T +F
Sbjct: 2375 QADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMF 2434

Query: 2428 THP---DVFGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKSM 2484
            THP   ++ G  L+SD++VFFN+KQLQNL LFLDIW+L+  LN+K   +    +   KS+
Sbjct: 2435 THPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSL 2494

Query: 2485 TLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAF 2544
            +  +   T ++I W FTLIF+N+ GDVDLGP+LGVLSL   RTWFATDHY + R+VLHA+
Sbjct: 2495 SSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAY 2554

Query: 2545 ADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHM 2604
               +++ S+GRLSG+ +L  A+WISEVN+P   +I     +S+SL++ RV  K AFDYHM
Sbjct: 2555 TKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHM 2614

Query: 2605 FLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQ 2664
            FL+G I+ +  H+ SE D+ GI PDLL V + C+ +  C+TAL AANILDIYNT+ R+RQ
Sbjct: 2615 FLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQ 2674

Query: 2665 DNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVL 2724
            DN+ISYIETL+ESN++E R  L Y DIL+SLNL++TD+S DI T   QISPISLFD E+L
Sbjct: 2675 DNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEIL 2734

Query: 2725 VLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASK 2784
            V+NI+N+SARSET +G KLKTEL +QV +A V+LSTSKEELDE+ +A IS+EDYM YA +
Sbjct: 2735 VVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGR 2794

Query: 2785 ISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIK 2844
            ISGG I++ PRLL++MTT+QK KSD++EYL+TC F D+++V+WNLGP+NFIKEMW+TH++
Sbjct: 2795 ISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVR 2854

Query: 2845 SLAVRQTQSNKT---MSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPM 2901
            ++AVR++Q + T   +SE+D    +  EEE  ++ QYVPL+EP I+MPQI+DLGDATPP+
Sbjct: 2855 AMAVRRSQIDVTFGPVSEEDVGKRIKKEEEF-SRFQYVPLEEPRIDMPQIRDLGDATPPL 2913

Query: 2902 EWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGRFQ 2942
            EWFG++RKR PA THQ A++L+QKLVH AEKEY  + G  Q
Sbjct: 2914 EWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2837 bits (7354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1419/3010 (47%), Positives = 1999/3010 (66%), Gaps = 106/3010 (3%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M   S+F+ V +S  +NFSWVFL+DW+LL V+ L+VIFY+GR  AY  +L+LEW LWK  
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
             +K+++ESLRI+ L G I F+N+ II KD TIS+L+G+L WRY LL TR+  Y   S   
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
            +G       V   KN  LPCRFVL CEG EIF+YNRT +Y+NII +FS+EER++F+KF+ 
Sbjct: 121  NG-------VTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLD 173

Query: 181  KQEMSELFHCHSERS--------------------DDKGXXXXXXXXXXXXXPNINDRVF 220
            +Q    +F+ HS  S                    +D+               N NDR+F
Sbjct: 174  EQ----IFNDHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQN-NDRIF 228

Query: 221  DEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLY 280
            D+  + K S+F++  P+E+++ R S+  GNKFTPSL+I S   G G++D CQPKEKLDLY
Sbjct: 229  DQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLY 288

Query: 281  KMHFQVDFIDIDISIRQNIEYNRK---KATFKNGKLSRMWATFVKVLHI---PFYNKSHN 334
            KM   ++  +  ++++ NI Y  +   K     GKLSR+W  F  +  I   P       
Sbjct: 289  KMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRK 348

Query: 335  NKGTE-SEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTY 393
             K  E  + F+ KW+GL LYKG  F+   +D D++ FDF NHEYAK S+++K P+ + TY
Sbjct: 349  KKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTY 408

Query: 394  SYDIPGVVPHGAHPT---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRM 450
             YDIPG VPHGAHPT   ++GP+VGNNGAPP   +D+Q +G +ICYGPW QR++  +  M
Sbjct: 409  EYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSM 468

Query: 451  ISPTVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSE 510
            ++P V+R+  P+K   PGS RIYT  K +  ++D ++WRI TRE SKD  FLK +K T++
Sbjct: 469  LAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETND 528

Query: 511  EYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFD 570
            +YRPFGW+DL+F+ +SY   T  L P  EGF N + IH A+ E  SSVNHD+++KC  FD
Sbjct: 529  DYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFD 588

Query: 571  VAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFI 630
               DV YPL WN  ATWTI+++S QLETFLLREH+TL+AD  TDF+SGEPTPYELFRP  
Sbjct: 589  FDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSE 648

Query: 631  YQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVP 690
              INW +D Y IYLNVNDHNIVNNPLDFNENCYLSLHG++LLI+VT P++ IT  + ++ 
Sbjct: 649  TFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEIT 708

Query: 691  YKISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECT 750
            Y I+TPMFR            EFMK KEVGRSY F+  G Y +YSELD+DNVDT+S+ C 
Sbjct: 709  YNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICE 768

Query: 751  STGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNS 810
            S GTTL CYGFV+RYL NVKMNYFGDFF+FITSEEYTG+ R  ++E   +    +L DN 
Sbjct: 769  SRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITR--DEELEEELISSNLSDNE 826

Query: 811  TNLSTDSGGLSDPYVRLRADPP----VSRSDVKRTTNETDIWFTFSVWEGALVLPETIYN 866
             N    S G S     +  + P    + RSD++RT NETD++ TFSVW+GA++LPETIYN
Sbjct: 827  DNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYN 886

Query: 867  CDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEH 926
            CD C AL FGELI+DLRS NYYMDLLA++  T ++RY  +   ++F+S+  DN  + +  
Sbjct: 887  CDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQ 946

Query: 927  GSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNL 986
            G L+ L+IHGHRM+GLPP EPTYFC+W  D+  L +NS+ +F KGF T F+ IGFG+ +L
Sbjct: 947  GFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDL 1006

Query: 987  ENTLLYDVETPDDMTSXXXXXXXXXXXXXXXSS--RAVVDVPNLTFTSIDFENERYSQRI 1044
            EN LLY  E  +DMTS                S     +   ++ FTSIDFE+  YS R+
Sbjct: 1007 ENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRL 1066

Query: 1045 DLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFY 1104
            DL +PSL + +   + D +  RL + TTKV+LTDF QK++F +HRS QR+YITLND+ F+
Sbjct: 1067 DLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFH 1126

Query: 1105 RCSFLLPCYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDY 1164
            R SFLLP   Q+  LY                      +T+DFI+ED LGE+ + L    
Sbjct: 1127 RTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRT 1186

Query: 1165 DTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAV 1224
              +      ++P+++   S  HE  +D+    F+     +S     Q DN++ID+++++V
Sbjct: 1187 IFRMPFGSTNTPNQA---STHHE--EDMDPLEFSN--STVSTEKNYQCDNLVIDIEYISV 1239

Query: 1225 DLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNT-CVLNLKLYVVDINFF 1283
            +++P I +Y++ L    ++ N V +ID+IE+  +K L      T  + N+KL V+  + +
Sbjct: 1240 EINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIY 1299

Query: 1284 WGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEE 1343
            WG+++   ++LY DKLDF++ QR  + D E  + E   L+K RS+RA++ +   T+  +E
Sbjct: 1300 WGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKE 1359

Query: 1344 RPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTS 1403
            RPPALSL VEG E +S   EK V S+  +STDIT+DESQLEWL +++ EQ   ++N++T+
Sbjct: 1360 RPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITT 1419

Query: 1404 FTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITR 1463
               +      +RR L+  +T A++ YQISH+PYVITKPAFI RLS GHVREN SW+IITR
Sbjct: 1420 LNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITR 1479

Query: 1464 LRHILTYLPNEWRNN--SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIF 1516
            LRHILTY+P++W +   + ++     D  +A     SV S+WR WE SD+ RSYIY  +F
Sbjct: 1480 LRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLF 1539

Query: 1517 LSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQ 1576
            L++Q++   QS+++++KV+  SFF T Y+ GY +  NFV+T ANIV E+ P    + V +
Sbjct: 1540 LTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSR 1599

Query: 1577 ALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFS--KAQTPALKRSKT--SINISKSYKVN 1632
                + ++NLT S+G++KG  +D+LL+L+ +      +   ++RS +    NI KS+K+N
Sbjct: 1600 ----EKLINLTGSIGSVKGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLN 1655

Query: 1633 VLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHAD 1692
             LL F+++E+Q V+G+++LTNRILNGK +LLL+  K + +PA S + +AKRSE+ + H +
Sbjct: 1656 ALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRN 1715

Query: 1693 LVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISEL 1752
              L E   R+ SL+ T E WS  P++ ++ QC++ HI++M  T  LVNS+K++++++  +
Sbjct: 1716 TTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNI 1775

Query: 1753 KRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLN 1812
             +  ++       +  S    +      +    S+V+ E+MP++PF +RHE K+  L   
Sbjct: 1776 DKQLSISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFK 1835

Query: 1813 RVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKL 1872
            +  S  ++I +WD +  L+S  T +QYF  + GD Q+  NL      I++  +S S++KL
Sbjct: 1836 QFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKL 1895

Query: 1873 TLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSA---LRWSLDANLNYF 1929
            T SEP RILSSFLQDE+   ES   +K L     P    + Q +    +RW LD ++ YF
Sbjct: 1896 TFSEPNRILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYF 1955

Query: 1930 GILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSK 1989
            GILVP+++T+FVFE H L+ +M++    +         QVSIEN + LIK+  +P+ LS+
Sbjct: 1956 GILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSR 2015

Query: 1990 LLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQ 2049
            +LDFSI   + QK+     S+Q+ES+HFR+ LSP SLV+++WG  Q   L  Y+++ R  
Sbjct: 2016 MLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGT 2075

Query: 2050 D----KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLF 2105
            D    KA        GS+S    ++  S H+LSYN CIGWMF   +    G+++GF RLF
Sbjct: 2076 DLWDIKASKLKKEKKGSSSIG--MNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLF 2133

Query: 2106 SAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKD 2165
            SAYE  YGKLTL+D +FSVA G ++ TFY + SE +  NRS+L N+QI YW+K+   MKD
Sbjct: 2134 SAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKD 2193

Query: 2166 LFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNI 2225
            +FIR +GEAL+VS L+    +IES L S Q FQ LK   +    S   N  N E    ++
Sbjct: 2194 VFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPNTSTTEN--NTEPKIKSL 2251

Query: 2226 SPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPH 2285
            +PFLS+I++++CQFKY GGV K++S +D+     PS E+K+PGV+I   Y HN    +PH
Sbjct: 2252 APFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPH 2311

Query: 2286 RIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLES---------SQSID 2336
             IR LV+I  THN L++ C P++ + +E    MV+KHS + T  ES         SQ+ID
Sbjct: 2312 WIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSN-TKHESIATNLSKAPSQNID 2370

Query: 2337 YKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLS 2396
            YK LLD FDIAFK+TS  Q+LSLSCEP+AKVQADVGFDSF  G+ TN+L +  P   SLS
Sbjct: 2371 YKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLS 2430

Query: 2397 VEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNL 2453
            ++K ++S++HIFS+ETS SF +D +D   +FTHPD+   +G  L+S+++++FN+KQLQNL
Sbjct: 2431 IKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNL 2490

Query: 2454 NLFLDIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDL 2513
             LF+DIW+L+  +    + K ++ K++ K +TL + ++    I WSFTLIFTN+ G  DL
Sbjct: 2491 YLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADL 2550

Query: 2514 GPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNY 2573
            GPSLGVLSL+L RTW A+DHY  +R+V+ AF D LS  S+GRLSG+F+L  A+W+SEV++
Sbjct: 2551 GPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSW 2610

Query: 2574 PAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVV 2633
            P          +++S+++  +++K AFDYHMFLIGTI   KF L SE D+ G +PDLL V
Sbjct: 2611 PKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKV 2670

Query: 2634 ALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTL-LYDDIL 2692
              +C+ ++ C+TAL AANILD+YNT+ RMRQDN+I Y+ETLRES++ E R     Y DIL
Sbjct: 2671 NFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDIL 2730

Query: 2693 QSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVS 2752
            +SLNLL+TD+S +I   K Q+SPI+LFD+EVLV+NI+N+SAR+ T +GEKLKT L L+V 
Sbjct: 2731 RSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVY 2790

Query: 2753 NAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIE 2812
            +  V+LSTSK E+DE+ V+ IS+ DYM YASKISGGTI++VP+L ++MT+WQ+  SD++E
Sbjct: 2791 DGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILE 2850

Query: 2813 YLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEI 2872
            YL+ C F D++AVKWNLGP+NFIKEMW+TH+K+LAVR++Q+   + + D Q D + ++ I
Sbjct: 2851 YLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQN---VLDTDMQTDEEVQKRI 2907

Query: 2873 K-----AKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLV 2927
            K     +KL+YVP++EP I+MPQI+DLGDATPP+EWFGV+RKRLPA THQ  +V +QKLV
Sbjct: 2908 KEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLV 2967

Query: 2928 HAAEKEYAKV 2937
            HAAEK+YA +
Sbjct: 2968 HAAEKQYASL 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2701 bits (7002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1383/3048 (45%), Positives = 1967/3048 (64%), Gaps = 165/3048 (5%)

Query: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64
            SQF  +SL   ++FSWVFLVDW+L  ++++TV+FY+GR  A+ I+ + EW LWK +++K+
Sbjct: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65

Query: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124
            ++ESLR++ L G I F+NL II KD TIS L G + WRY L   R  Q+    + +D  G
Sbjct: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125

Query: 125  VGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQEM 184
               +     +N  L CR +L CEG E+F+YNRTVAY+N I+MFS+EER +FE+F+++   
Sbjct: 126  ASLQ-----RNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF 180

Query: 185  SEL---------------------FHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEV 223
            ++                         ++E S D+                 NDR+F + 
Sbjct: 181  TDRASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMA----------NDRIFHD- 229

Query: 224  HNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMH 283
                K++F+ +LP+++++S  S V+GNKFTPSLLI S  S  GV+D CQPKEKLD+YK  
Sbjct: 230  EETGKNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTK 289

Query: 284  FQVDFIDIDISIRQNIEYNRK---KATFKNGKLSRMWATFVKV---LHIPF-YNKSHNNK 336
              +D  ++ +S++QNI YN +   K     GKLS++W  FVK    +  P   ++   N+
Sbjct: 290  LTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNR 349

Query: 337  GTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYD 396
             + +  F  KW+GL LYK   F+    D D++ FD A HEYAK ++IIK PR +LTY +D
Sbjct: 350  PSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFD 409

Query: 397  IPGVVPHGAHPTL---EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISP 453
            IPG VPHGAHPTL   +GP++GNNGAPP FG+++Q +G ++CYGPWAQR++  +  +++P
Sbjct: 410  IPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAP 469

Query: 454  TVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYR 513
             ++R   P+K L PG RR+YT+FK    V +  +WRIPTRE SKD EFL+ +K T+E+YR
Sbjct: 470  QISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYR 529

Query: 514  PFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAG 573
            PFGWLDLKF+ DSY S    LC   +G  N M IH  + E  SSVNHD+ +K    D   
Sbjct: 530  PFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDL 589

Query: 574  DVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQI 633
            ++G+PLGWN  A WTIN+ S+QLETFLLREH+TL+AD  +DFS+GEPTPYELFRPF+Y I
Sbjct: 590  NLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTI 649

Query: 634  NWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKI 693
            NW +DGYSIYLNVNDHNIVNNPLDFNENCYLS HG+ L +D+T P D I     D+ Y I
Sbjct: 650  NWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNI 709

Query: 694  STPMFRXXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTG 753
             TPMFR            EFMK+KEVGR+Y F   G Y +Y+ELD+DNVD +++ C+S  
Sbjct: 710  YTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKS 769

Query: 754  TTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNL 813
            T LHCYGFV+RYLMN+KMNYFGDFFHF+TSEEYT  I +K     G   E+   D ST +
Sbjct: 770  TVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSK-GYGEGSLFEKYSDDASTFV 828

Query: 814  ST-DSGGLSDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVA 872
            S  D     D  V++   P    +DV+R TNETD+W TF++WEGAL+LPETIYNCDPC+A
Sbjct: 829  SDFDKNNEEDDKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIA 884

Query: 873  LHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAAL 932
            LHFGEL +D+RS NYYMDLLA++    +++Y + Q +E+FE++R+ NGR  K H  ++ +
Sbjct: 885  LHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNI 944

Query: 933  TIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLY 992
             IHGHRMYGLPP EPTYFC+W  DL  + + S+ +F KG  T F  IGFG+ +LEN LLY
Sbjct: 945  NIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLY 1004

Query: 993  DVETPDDMTSXXXXXX--XXXXXXXXXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPS 1050
            + E  DDMT+                  SRA + + N+ F +IDFENE+YS R+D+++P 
Sbjct: 1005 EKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPL 1064

Query: 1051 LSILLLT-SEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFL 1109
            L + L   + + S+ +   +  TK+  T+F   ++  +HR+ QRDYIT+ND+PF+RC F+
Sbjct: 1065 LKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFI 1124

Query: 1110 LPCYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRT 1169
            LP   Q S +Y+                     ET +FII+D L E+     C       
Sbjct: 1125 LPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPY 1184

Query: 1170 VDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPL 1229
             D  +  S+SF++      PD   +     + +  SP P ++ DN +ID +++++ +DP 
Sbjct: 1185 PDSTNLNSDSFNSY-----PDTAPHTLSDTIIR-KSPLPEDERDNYVIDFRYISISIDPE 1238

Query: 1230 ICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKN 1288
            +  Y++ LL  F+  +   +ID IE+ +VKRL       + + N K+ ++  + FWG ++
Sbjct: 1239 LFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRD 1298

Query: 1289 AKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATV---FDRSITEGVEERP 1345
               ++LY D LDF++ +++ + + E  ++E  TL KL S+RA+V   + R  TEG   +P
Sbjct: 1299 TGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEG---QP 1355

Query: 1346 PALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFT 1405
            PALSL VEG + +S   +K++ S+ L S D T+DE+Q+ WL  +  +Q++LI +++ +F 
Sbjct: 1356 PALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFE 1415

Query: 1406 KLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLR 1465
            K+ +    +R++L+  +T ASE+YQISH+PYVITKPAFI RLS GHVREN SW+IITRLR
Sbjct: 1416 KVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLR 1475

Query: 1466 HILTYLPNEWRNNSAIQV-------SPTVDSTDASVASHWRRWEISDITRSYIYRTIFLS 1518
            HI+TYLP++W    A Q+       S    S   SV S WR WE SD+ RSYIY  +FL+
Sbjct: 1476 HIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLA 1535

Query: 1519 DQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQAL 1578
            +Q++ Q +++ K  K  F S + T+Y+ G  V H+F++T++N+V EE P    S   Q  
Sbjct: 1536 NQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQ-- 1593

Query: 1579 DYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQT---PALKRSKTSINISKSYKVNVLL 1635
              + V+N+T +LG+IKG+++D++ KL N+ +  Q    PALK   +    S+S+K+N+ L
Sbjct: 1594 --EKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQEDPALKSISS---FSRSFKLNIAL 1648

Query: 1636 AFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVL 1695
             FD S+L FV G+T LTN I +GKA+ L E  K       S V +AKR E+ +KH + +L
Sbjct: 1649 LFDSSDLLFVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSML 1708

Query: 1696 AEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRH 1755
             E     ++L+  A+     PS+  N QC + ++R M  TE++V  +++ +   + +K  
Sbjct: 1709 FENQITGIALSAAADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKES 1768

Query: 1756 FA---MEKTTP---NVQGTSTNLS-IPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLG 1808
            F    + K TP   + + T T ++   L +   T  FS+V+ ++MP+ PF  R E K++ 
Sbjct: 1769 FETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKME 1828

Query: 1809 LYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTS 1868
               +  ++     +IWD+++ L SH T +QYF  +LG++ V        + I N+ +S S
Sbjct: 1829 FKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSAS 1888

Query: 1869 LMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFS--PLARNKTQSSALRWSLDANL 1926
            ++KLT SEP R+L SFLQDE+ +  S+  ++ L  LFS  P        + + W L+A++
Sbjct: 1889 IVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADI 1948

Query: 1927 NYFGILVPMASTFFVFEIHMLLAAMNNASDGQ--DEGDHHVTGQVSIENCLLLIKEPSLP 1984
             Y GIL+P+++TFFVFE+H LLA++ +   G+   E D   +GQVS++N L LIK+ ++P
Sbjct: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREAD-EASGQVSVDNILFLIKDRTIP 2007

Query: 1985 ADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFR 2044
            + LS+++D S ++ + QK+  S  SYQIES H R C SP SLV++LWG HQL +L  ++R
Sbjct: 2008 STLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYR 2067

Query: 2045 KHRKQD-----KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLII 2099
            +H  ++              D + S    + F S HILSYN C+GW+FQ   D   GLI+
Sbjct: 2068 RHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLIL 2127

Query: 2100 GFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKE 2159
            G++RLFSAYEK  GKLTL+D +FSV+NG+++DTFYS G+E+ +YNRSFL N+QI YWLK 
Sbjct: 2128 GYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKA 2187

Query: 2160 IDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMH------------- 2206
               MKD+FIR++GE L+V+ LS+   IIE+TL SIQ FQ LKK  ++             
Sbjct: 2188 AAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEE 2247

Query: 2207 ----------------KRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYS 2250
                            K++  PR          +I+PFLS IR ++CQFKY GG+ K+YS
Sbjct: 2248 EESEEHNRRETVPGKEKKEDAPR---------KDIAPFLSDIRKVNCQFKYDGGIFKVYS 2298

Query: 2251 LDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILND 2310
             +D+     PS EI+SPGV I L Y +N  + +PH IR L++++ THN+L+++C P+L  
Sbjct: 2299 FEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMA 2358

Query: 2311 IVEASQRMVQKHSPDETP------LESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPR 2364
            + +  Q MV+KHS  + P         SQ+IDYK LL+SFDI FK+ S  Q+LSLSCEP+
Sbjct: 2359 LSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPK 2418

Query: 2365 AKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFT 2424
            AKVQA+VGFDSF F + TNDL    P   +L V+  +S++RHIFSRE SASF +D +D T
Sbjct: 2419 AKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVT 2478

Query: 2425 SIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQT 2481
             +FTHP++   FG  L+SD+ V+FN+KQLQNL LFLDIW+L+  L  K   K +D     
Sbjct: 2479 FMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHH--- 2535

Query: 2482 KSMTLSKRTSTPTS----ICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQ 2537
              + +    S+P      I W FTLIF N+ G VDLGPSLG+LSL + + WFA+DHY ++
Sbjct: 2536 --VAIDAPPSSPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESK 2593

Query: 2538 RRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIK 2597
            R++LHA+ D++ + ++GRLSG+ +L  A W +EVN+P          ++LS  +  +++K
Sbjct: 2594 RQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDD--PYPLVALSFVISNISLK 2651

Query: 2598 TAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYN 2657
             AFDYHMFLIGT+    FHL SE D  G +PDLL V L+C+++D C+TAL AAN+LD+YN
Sbjct: 2652 VAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYN 2711

Query: 2658 TITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPIS 2717
            TI RMRQD  +SY+ETLRESN+T+ + T+ Y DIL+ LNL++TD+  DI T   QISPIS
Sbjct: 2712 TIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPIS 2771

Query: 2718 LFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIED 2777
            LFDVEVLV+NI NV A  +T +GEKL+T LHLQ+ NA  SLS+SK E+DE+ V+KIS+ED
Sbjct: 2772 LFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVED 2831

Query: 2778 YMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKE 2837
            YM+YASKI GGTI  +P+L +SM T+QK  SD++EY +   F D++AV+WNLGP+NFIKE
Sbjct: 2832 YMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKE 2891

Query: 2838 MWSTHIKSLAVRQTQSNKTMSEKDKQADLDP---EEEIKAKLQYVPLDEPYIEMPQIKDL 2894
            MW+THIK+LAVR++QS    +  D++ D++    +EE  +KL Y+ ++EP I+ PQIKDL
Sbjct: 2892 MWTTHIKALAVRRSQS-LVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDL 2950

Query: 2895 GDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGRFQ 2942
            GDATP +EWFG++RK+ P  THQ  IV +QKL+H+AEKEYA + G  Q
Sbjct: 2951 GDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2677 bits (6939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1369/3012 (45%), Positives = 1972/3012 (65%), Gaps = 110/3012 (3%)

Query: 2    EGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWK 61
            +  + F   SL  +RNFSWVFLVDW+L  ++TL  +FYL R FAY +T +LEW LWK  K
Sbjct: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64

Query: 62   VKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQY---EEASS 118
            VK+S+ +LRI+ L+G + F+NL II KD+TI+IL+GS+ WRY L+ TR+S+Y   + A +
Sbjct: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124

Query: 119  QKDGLGVGEED-----VNSM-KNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREER 172
                 G  E+D      N M K + LPCRF+  CEGFE+FIYNRT AY+NI+ + S+ ER
Sbjct: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184

Query: 173  VQFEKFMSKQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFM 232
             +FEKFM++ +   L       SDDK                 NDR F     +    ++
Sbjct: 185  EKFEKFMAENDF--LDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPRYL 242

Query: 233  RFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDID 292
              LP+E  L++GSI++GNKFTP +LI S  S   + D+ +   KLDLY+M ++V   +++
Sbjct: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302

Query: 293  ISIRQNIEYNRKKA---TFKNGKLSRMWATFVKVLH-IPFYNKSHNNKGTESEPFMTKWK 348
            I ++QNI+Y+ +K+    F  GKLSR+W  F ++   +PF  KS+  K    + FM KWK
Sbjct: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDNFMQKWK 362

Query: 349  GLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPT 408
            GL +Y+   F  + +++D++ FD ++HEYAK ++++KSPR  + + YD+PG VPHGAHP 
Sbjct: 363  GLSMYRNDMFG-EFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPP 421

Query: 409  ---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTL 465
                +GP+VGNN APP++  ++  +G T+CYGPWAQR+  HL  ++SP+V+R++ PIK L
Sbjct: 422  SSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKL 481

Query: 466  SPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMD 525
             PGS+RIYTV K T   ++  +WRIPTRE SKD EFL  +K T+++YRPFGW+D+K + D
Sbjct: 482  KPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRD 541

Query: 526  SYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSA 585
            S G     +CP  +GF N + +   + E  SSVNHD+ LK   F    D+GYPLGWN+ A
Sbjct: 542  SCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEA 601

Query: 586  TWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLN 645
             WTI + S QLE FLLREHVTL+AD  TDFSSGEP PYELFRPF+Y I W + GYS YLN
Sbjct: 602  NWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLN 661

Query: 646  VNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXX 705
            VNDHNIVNNPLDFNENCYLS+HG++L ++V  P  +IT  + ++ Y I TPMFR      
Sbjct: 662  VNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLNTP 721

Query: 706  XXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRY 765
                  EFM+NKEVGRS+ F + G Y +YSELDIDNVDTL+VEC+S GT LH YGFV+RY
Sbjct: 722  PWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRY 781

Query: 766  LMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYV 825
            L+NVKMNYFG+FFHF+TSEEYTG  R  + E++     E  RD+  + S+          
Sbjct: 782  LINVKMNYFGEFFHFVTSEEYTGNTRPTDLENII---SEDRRDD--DFSSYESVSRISSN 836

Query: 826  RLRADP------PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELI 879
                +P       + +SD+KRT+NETDIWFTFSVW+GAL+LPETIYN DPC+ALHF ELI
Sbjct: 837  SSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELI 896

Query: 880  VDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRM 939
            VDLRSCNYYMD+LAT    ++KRYV +++ E++E +  +NG+  + HG+L+ + IHGHRM
Sbjct: 897  VDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRM 956

Query: 940  YGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDD 999
            YGLPP EPTYFCQW +D   L I+S+  F +G F  F  IGFGY +LEN LLY+ E  DD
Sbjct: 957  YGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDD 1016

Query: 1000 MTSXXXXXXXXXXXXXXXSSRAVVDVP--NLTFTSIDFENERYSQRIDLKVPSLSILLLT 1057
            MTS                + A  D+      FT IDFENERYS+R+D+K+PSL   + +
Sbjct: 1017 MTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFS 1076

Query: 1058 SEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQES 1117
            +ED+   + L++    +  T+F+Q +DF KHR  QRDYI LND+P++RC+FLLP   Q+S
Sbjct: 1077 NEDND--LSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKS 1134

Query: 1118 PLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPS 1177
             +Y                     A+TI++++EDLL ++    + +YD +      +S  
Sbjct: 1135 RIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIK------ESSV 1188

Query: 1178 ESFDTS--QEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVD 1235
            E+ + S  +       +  +R    P  LS   +E  DN ++ V+ + +D++P + + ++
Sbjct: 1189 ENLELSAIEATRAITGIGAERTHSNPITLSDYAVES-DNYVVKVESIVIDINPALYTTIE 1247

Query: 1236 GLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDL 1294
             LL   +  + V IID IE+ IVKRL  + +  T + N+K+ +   N FWG+K +  V +
Sbjct: 1248 KLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSM 1307

Query: 1295 YFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEG 1354
            +FDK+DF L ++T + + E  + E   L+K+++VR TV  +      +ERPPA+++ VEG
Sbjct: 1308 FFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEG 1367

Query: 1355 WEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGT 1414
            +E +S   EK V S+S+ S DITVD++Q+EW   YI  Q+    +ML S+ ++      +
Sbjct: 1368 FEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIES 1427

Query: 1415 RRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNE 1474
            +++L+  +T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP +
Sbjct: 1428 QKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKD 1487

Query: 1475 WRNNSAI-----QVSPTVDSTD--ASVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQS 1527
            W  N        +  P+ D+     S+ S+WR WE SD+ RSYIY  +FL+D ++ + QS
Sbjct: 1488 WYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQS 1547

Query: 1528 LKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLT 1587
            L+K+ K++  +FF T+YS  Y V H+ V++ A ++ E  P++   K + +L  + +++++
Sbjct: 1548 LQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPK-ENSLQREELIDIS 1606

Query: 1588 VSLGAIKGELNDQLLKLRNIFSKAQTPALKR--SKTSINISKSYKVNVLLAFDRSELQFV 1645
             ++  IKG+L+ +LLKL+ +       + K+        I K +K+N     +  ++Q V
Sbjct: 1607 GTVDVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLV 1666

Query: 1646 LGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSL 1705
            +  T+L   + +G+ ++L E L++S A A S V F+K +E  LKH + VLAE        
Sbjct: 1667 MDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYA 1726

Query: 1706 TMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEK---TT 1762
            T T + W+  P+  I+ + S+ H R M  TE LV +IK I   I ++     +E+     
Sbjct: 1727 TFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQH 1786

Query: 1763 PNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILIS 1822
            P V   + +      N   +  FS+V+ ++MP++PF +++  KQ+  + N+  S+  LI 
Sbjct: 1787 PTVYDPNKS------NVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIK 1840

Query: 1823 IWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILS 1882
            + D +  L S QT EQY   ++  LQ++ N+ +    ++++ LST+L+KLT SEP+ I+ 
Sbjct: 1841 LKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVY 1900

Query: 1883 SFLQDEKLIGESLGYIKGLLQLFS------PLARNKTQSSALRWSLDANLNYFGILVPMA 1936
            SFL+DE++  ES+  ++ L  LFS         ++  + +   WSLD++++YFGIL+PM 
Sbjct: 1901 SFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMT 1960

Query: 1937 STFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIR 1996
            ST++V E H  +++++NA +G   G+  +TG +S+EN L LIKE SLP  LSK++D ++ 
Sbjct: 1961 STYYVMEFHSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVN 2019

Query: 1997 VMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPF 2056
            V + Q+V ++ +S Q+ESSH R+CLSP SL+++LWG +Q   L E++ K+  +       
Sbjct: 2020 VSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSK------- 2072

Query: 2057 SLFDGSA-SADRQID--------------FRSIHILSYNLCIGWMFQLGDDVKTGLIIGF 2101
            SL+   A S D+Q D                SIH LSYNLC+GW+F+       GLI G+
Sbjct: 2073 SLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGY 2132

Query: 2102 DRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEID 2161
             RLFSAYE   GKLT+ID YF+ A G ++ TFY + + K+ +NR +L N+QI +W K I+
Sbjct: 2133 SRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIE 2192

Query: 2162 SMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERM---HKRDSGPRNKLNL 2218
             MKD+++R  GE L+V  LS+    IESTL SI+ FQ LKKE +    KR+     +   
Sbjct: 2193 GMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKP 2252

Query: 2219 ENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHN 2278
             N+SNNI   L +I++++C FKY GG   ++++ D +    P++EIKSP + + + Y H 
Sbjct: 2253 VNSSNNI---LKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHE 2309

Query: 2279 EAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPD----ETPLESSQS 2334
            +   + H IRCLV+IDPTHN+LY+ C P++ + VE  + +  ++  +    ET   S Q+
Sbjct: 2310 KQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQN 2369

Query: 2335 IDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVS 2394
            IDY+ LL+ +D+A  VTS +QQLSLSCEP+AKVQADVGF++ T  +TTN      P   S
Sbjct: 2370 IDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFS 2429

Query: 2395 LSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHP---DVFGVALVSDINVFFNMKQLQ 2451
             S++  ++S++H+FSRETS SF V ++D T +FTH    + +G +L+SDI+++FN+KQLQ
Sbjct: 2430 FSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQ 2489

Query: 2452 NLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDV 2511
            NL LFLDIWQL+  LN    +++   +K  K  ++ K     + + W FTLIFTNVKGD+
Sbjct: 2490 NLYLFLDIWQLSELLNPVTSSQEQVIRKDKKK-SVDKPIHNESQLPWCFTLIFTNVKGDI 2548

Query: 2512 DLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEV 2571
            DLGPSLG++SLRLSRTW ATDH+  +R++LHAF D+L + SEGRLSGV ++  A+W+SEV
Sbjct: 2549 DLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEV 2608

Query: 2572 NYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLL 2631
             +           ++LSL+  ++ IK AFDYHMFLIGT++ + F L SE D+ G+ PDLL
Sbjct: 2609 IWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLL 2668

Query: 2632 VVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDI 2691
             V+ SC+E+  C+TAL AANILDIYNTI RMRQD +ISYIETL++SN    + TL Y DI
Sbjct: 2669 KVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDI 2728

Query: 2692 LQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQV 2751
            L+SL LLRTDL+  I + + QISPISLFDVEV+V+N+ +VSARSET S  KL T L+++V
Sbjct: 2729 LKSLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEV 2788

Query: 2752 SNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLI 2811
             +A +SLST+K+ELDE+ ++KI++ DYM YASKI GGTI+++PR+ V MTTWQ+ KSD++
Sbjct: 2789 YDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDIL 2848

Query: 2812 EYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQ---SNKTMSEKDKQADLDP 2868
            EYL++C+F D+VAV+WNLGP+NF+KEMW+TH+K++AVR++Q    +  +SEKD +  +  
Sbjct: 2849 EYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKE 2908

Query: 2869 EEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVH 2928
            EE I  KL YVP++EP I+MPQIKDLGDATPP+EWFGV+RKR PA THQ A+V +Q LV+
Sbjct: 2909 EENI-TKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVY 2967

Query: 2929 AAEKEYAKVQGR 2940
             A+K+YAK  GR
Sbjct: 2968 LAQKQYAKTLGR 2979

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2565 bits (6647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1325/3025 (43%), Positives = 1917/3025 (63%), Gaps = 118/3025 (3%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            ME  SQF  +SL  E+ FSWVFL  WVL C+ +LTVIFYL R+F    T +L W +WK +
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KVKI++ES+R++ L G++  +N+ II +D T+S L+  ++WRY LL +R  +Y+  ++  
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 121  DGLGVGEEDVNSM---KNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEK 177
                 G +  NSM   KN  LPC  ++ C+GFE+F+YNR  AYEN++++F++EER +F  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 178  FMSKQEMSELFHCHSE-RSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLP 236
            F+++ ++ ++    +   S DK                INDR + +  +++KSI   FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 237  MELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIR 296
            ++L+L  G++ LGN+FTPSL++AS  +  GV+D+    EK+DLYK    + F D++IS++
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 297  QNIEYNRK---KATFKNGKLSRMWATFVKVLHI---PF---YNKSHNNKGTESEP-FMTK 346
             N+ Y+ +   +     GKLSR+W TF+ ++ +   PF   Y+K    K  + E  F+ K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 347  WKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAH 406
            W+GL LYK    D      DE  +DF N EYAK S+I+K P   L+Y  D PG+VPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 407  PT---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIK 463
             T    +GP++GN+G+PPEF +DLQ    +I YGPW  R++ +L+RM+SP V+++ +PIK
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 464  TLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFA 523
             L PGSRRI+TVFK +  ++D SSWRIPTRE SKD+EF+K+F  T++++RPFGWLD    
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 524  MDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNS 583
              +  +    L P  +G  N   IHF +ME T+SVNHD++LK   FDV  D+GYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 584  SATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIY 643
             A W  ++ + QLETFLL+EH++L +D+F+DF+S +PTPYELFRPF Y +NW I+GYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 644  LNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXX 703
            LNVND NIVNNPLDFNENCYLSLHG+EL ID   PN  I+  Y ++ + I TPMFR    
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 704  XXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVM 763
                    EFMK+KEVGR++ F + G Y +YS+LDIDNVDT+++ECTS  TTL CYG V+
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 764  RYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGK------TEEESLRDNSTN---LS 814
            RYLMNV+ NYFGDF HFITSEEY+ +++   K S  +      +   S++++S++   L 
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDDTVLY 840

Query: 815  TDSGGLSDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALH 874
            T    LS P+VR        R+DV RT NE DIWFTF VW+GAL+LPE +YN + C +L 
Sbjct: 841  TKEQDLSKPHVR--------RADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLL 892

Query: 875  FGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTI 934
            F EL++  R  NYYMD L  +    I R+++    E+F  +R  +      HG+L+ +TI
Sbjct: 893  FSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTI 952

Query: 935  HGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDV 994
            H HRM+GLPP + TYFCQW ID   L I+S+ EF   FF LF  +GFGY+NLEN L+Y V
Sbjct: 953  HAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKV 1012

Query: 995  ETPDDMT--SXXXXXXXXXXXXXXXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLS 1052
            E+ DDMT  +                 +A +++  L   SIDF+NERYS+RI+LK+P  S
Sbjct: 1013 ESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFS 1072

Query: 1053 ILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPC 1112
            I +    + +    L+   TK+  T+F+ K DF    + QR YITL+DSP++RC F+LP 
Sbjct: 1073 ISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPT 1132

Query: 1113 YLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDD 1172
              QES LY                       TIDF++ED L E++  L+  +   R++++
Sbjct: 1133 MYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSINN 1192

Query: 1173 PDSPSESFDTSQEHEGPDDVRYDRF--------AQLPKILSPNPLEQYDNVIIDVKFLAV 1224
             D+ S            ++ R D +        A+    ++ +P  +YDN I++V+++ V
Sbjct: 1193 LDTSSLF----------NEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRV 1242

Query: 1225 DLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQ----LWNNTCVLNLKLYVVDI 1280
            D++PL   ++D +  + +  N VDIIDEIEM IV+RLG     L   T   NLKL +  +
Sbjct: 1243 DINPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRET---NLKLKISYV 1299

Query: 1281 NFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEG 1340
            + FWG +N++ +++Y DKLDF++ QR  D   +  + E+  LSKL+S+R +  +    E 
Sbjct: 1300 DIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEI 1359

Query: 1341 VEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNM 1400
              ERPPALSL VEG E +S        S+++LSTDITVD SQ  WL  Y+ +Q +   N+
Sbjct: 1360 EYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNL 1419

Query: 1401 LTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRI 1460
              S   L +     ++ L+  +TTASE+YQI H+PYVITKPA IMRLSN HVREN SWRI
Sbjct: 1420 KGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRI 1479

Query: 1461 ITRLRHILTYLPNEWRNNSAIQVSPTVDSTDA-------SVASHWRRWEISDITRSYIYR 1513
            +TRLRHIL YLP  W  +S   V      +D+       SV S+WR WE+SD+ RSYIYR
Sbjct: 1480 VTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYR 1539

Query: 1514 TIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSK 1573
             +FL D  K     +    K+   SF+FTIYS+ Y V HN V+TR N++ +++ + E  K
Sbjct: 1540 RVFLPDIEKNL---INNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPK 1596

Query: 1574 VQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSKTSINISKSYKVNV 1633
               A   D + ++T ++G  KGEL DQL++L+ ++S+ +        T  +I K +K+N+
Sbjct: 1597 AATANKNDKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINI 1656

Query: 1634 LLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADL 1693
            +L  ++ EL      T+L +RI NGK +   E  ++ A  + S V++A R+E WLKH +L
Sbjct: 1657 VLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNEL 1716

Query: 1694 VLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELK 1753
            +L +A   +L +++ AEL    P++ +N++ S+   +A+ +T+ LV  +++    IS++ 
Sbjct: 1717 ILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKIT 1776

Query: 1754 RHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNR 1813
                 +        TS   S    + +  ++  D+++E++ L+PF V+H MK+L +  NR
Sbjct: 1777 GRLTDKDNKKRHTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNR 1836

Query: 1814 VQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLT 1873
               N+ + SI DA++ L S+Q   QYF  +  D+ ++  L    S ++ + + TSL+KLT
Sbjct: 1837 EGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLT 1896

Query: 1874 LSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSAL----RWSLDANLNYF 1929
            L++P++I +S LQDEK   +SL  IK L  LFS  +  + ++SA+    ++ ++ +L YF
Sbjct: 1897 LADPKKITNSLLQDEKTFEQSLESIKTLNTLFS--SNREVRTSAVDNPYKFMVNFDLTYF 1954

Query: 1930 GILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSK 1989
            G+L P+ +++F+ E+H LLA  +N      +    +T  ++++N L +IK P +   +SK
Sbjct: 1955 GLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSK 2014

Query: 1990 LLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQ 2049
            +LDFS+ + +  K+ NS +S+++ESSHFRVCL+P SL+++L G  Q  S  +Y+++H + 
Sbjct: 2015 VLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRL 2074

Query: 2050 D--KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSA 2107
               K     S+   +      I++ SIH LSYN CIGW+F+       GLI+G+DRLFSA
Sbjct: 2075 QIFKTKKKASVVSENLIGAPLIEY-SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSA 2133

Query: 2108 YEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLF 2167
            YE  YGKLT++DG+FS+ANG S+DTFYSQG+EK++YNRS+L N+QI YWLKE+D+MK LF
Sbjct: 2134 YEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLF 2193

Query: 2168 IRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNISP 2227
            +R  GE ++V  LSN   II  T+ S+Q FQ +KKE + + +     K+  ++ S   S 
Sbjct: 2194 VRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSL 2253

Query: 2228 FLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRI 2287
            F S ++ I+CQ  Y GGV  +Y +   +     ++EI +P V+I + Y +    ++PH I
Sbjct: 2254 FFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWI 2313

Query: 2288 RCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDE---TPLESSQSIDYKSLLDSF 2344
            R  ++I+PT+N L SQ    L +  E+   MV K SP E    P   S  IDYK +L+ F
Sbjct: 2314 RSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDF 2373

Query: 2345 DIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSV 2404
            D++F +++G+Q++SLSCEP AKV A+VGF+SF F + TND     P   SL+V  I++S+
Sbjct: 2374 DVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSI 2433

Query: 2405 RHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIWQLNG 2464
             H FS E +ASFSVDFVD T++FTHPD++G  L+SD++++FN+KQLQNL +FLDIW L  
Sbjct: 2434 NHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKR 2493

Query: 2465 KLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRL 2524
             +  + +     +K +++  + +K +S  T I WSFT+I T++ GD+ LGPSLG LSL+L
Sbjct: 2494 LIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKL 2553

Query: 2525 SRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSE 2584
             + W +T+H+  +R+ L  F D LS+ S GRL G+ D+ N +WI  V Y     +  S  
Sbjct: 2554 KKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPL 2613

Query: 2585 MSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCA 2644
            + ++L+V  VA+K AFDYHMFLIG +  + F+L SE DL G LPDLL + L C E+D C+
Sbjct: 2614 VDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICS 2673

Query: 2645 TALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSF 2704
            TAL A+NILDI NTI+R RQD+R SYIETL ESN    + ++ Y DIL+SLNLLRTD+  
Sbjct: 2674 TALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGI 2733

Query: 2705 DITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEE 2764
            +I   + QISPISLFDVEV+V  ++NVSARS TQSGEKL T+L +++  A +SLS S EE
Sbjct: 2734 EIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEE 2793

Query: 2765 LDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVA 2824
            LDEE V++IS++DYM+YA K+SGG I+ +P+L V MTTWQ   S +IEYLF C+F D+++
Sbjct: 2794 LDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKIS 2853

Query: 2825 VKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDP-----------EEEIK 2873
            V+WNLGP+NFIKE+W+TH+KSLAVR+ Q      + DK+  L P            EE++
Sbjct: 2854 VRWNLGPVNFIKEVWATHVKSLAVRRAQ-----LKGDKEPQLVPGIIGEPSPLVSSEELE 2908

Query: 2874 A-------------------KLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAA 2914
                                K  YVPL EP IEMP+IKDL DATPP+EWFGV+RK+ P  
Sbjct: 2909 MLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRV 2968

Query: 2915 THQLAIVLIQKLVHAAEKEYAKVQG 2939
            THQ AI+LIQK+VH A+KEYAKV G
Sbjct: 2969 THQTAIILIQKIVHVAQKEYAKVLG 2993

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2274 bits (5894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1167/2577 (45%), Positives = 1645/2577 (63%), Gaps = 73/2577 (2%)

Query: 416  NNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTV 475
            N  APPE  ++ Q +  +I YGPWA R I ++ R+ SP V+R+        PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 476  FKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLC 535
             K +  +++ SSWR+PTRE SKDQ+FLK++  T++  R FGW DL F+ +S  +      
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 536  PKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQ 595
            P   G+ NK+ + F ++E  SSVNHD+  +   + V  D+GYPLGWN   TW+    S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 596  LETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNP 655
            LETF LREH+ L+AD F+DFSSGEPTPYE FRP IY+++W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 656  LDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXXEFMK 715
            LDFNENCY+S+HG++  I V  P   IT  Y D+ ++ISTPMFR            EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 716  NKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFG 775
            NKE+GR Y F   G Y +YS+LDIDNVD+L++EC++   TL  YGFV+ YL+NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 776  DFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRAD----- 830
            +F HFIT+EEYT ++R  + + V    + S+   + ++S  S    +P    +++     
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 831  --PPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYY 888
              PP+ + D+KR  NETDIWFTFSVWEGAL+LPE +YN DPC+AL F ELI+D R+C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 889  MDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPT 948
            +DLLAT++ TS KR + +  +++FE +  +  +  +EHGS++ ++IHGHRMYG PP  P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 949  YFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXX 1008
            YF  W +D++ L+INSD  F +GF +    +GF ++NL+N LLYD    D+MTS      
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1009 XXXXXXXXXSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIR 1066
                     S+ A V  ++  +TF  I+F N+RYS RIDL+VP L      +    +   
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249

Query: 1067 LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXX 1126
            L +  TK+  T+F Q +D   H  KQ+++I LNDS F+RCSFLL  ++QES LY      
Sbjct: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309

Query: 1127 XXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAG---LKCDYDTQRTVDDPDSPSESFDTS 1183
                           AETI FII+D LG F      L     T   +   + P +   +S
Sbjct: 1310 ITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHSSNKPLKPPSSS 1369

Query: 1184 QEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWK 1243
              H             +   L P+    + N IID+ ++ +D++PL  +Y    L EF+ 
Sbjct: 1370 VIHP---------IESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYS 1420

Query: 1244 VNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFD 1302
             N ++ ID IEM+IV RLG        V N+KL +  ++FF+G +N + ++LY D++D +
Sbjct: 1421 ENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLE 1480

Query: 1303 LGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMR 1362
            + Q+T       ++ E   LS+  S+RA++ ++ + E  +ERPPALSLA+EGWE +S   
Sbjct: 1481 VSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTA 1540

Query: 1363 EKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDI 1422
               V S+++ STDITVDESQ+EWL  Y+      +  ++ S   + +   G ++ L+ D+
Sbjct: 1541 SSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDL 1600

Query: 1423 TTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEW------- 1475
            T ASE+YQISH+PYVITKPA++MR+S GHVR+N SWRI+TRLRHI TYLP++W       
Sbjct: 1601 TLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEE 1660

Query: 1476 -RNNSAIQVSPTVDSTDA--SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKML 1532
             R      VS   DS+D   +V S+WR WE+SD+ RSYIY+ IFLS+   T  + L+  +
Sbjct: 1661 MRGKDMNDVS---DSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTV 1717

Query: 1533 KVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGA 1592
            K++ +S FFTIYS GY + HN ++T+A I+ E      +S   +     +++N+T SLG+
Sbjct: 1718 KLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEK----SILNMTGSLGS 1773

Query: 1593 IKGELNDQLLKLRNI---FSKAQTPALKRSKTSINISKS--YKVNVLLAFDRSELQFVLG 1647
            IKGE +D+ L+L  +   FSK +        +SI   KS  + +++ L F+   LQ  +G
Sbjct: 1774 IKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMG 1833

Query: 1648 QTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTM 1707
             T L+N + +GK + LLEK   S   + S  ++ K+SE  LKH   ++AE     L L  
Sbjct: 1834 DTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLIS 1893

Query: 1708 TAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQG 1767
            T       P + IN++ ++ H +++ STE +V +I+ I E    L +H+ + K T     
Sbjct: 1894 TGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTK 1953

Query: 1768 TSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDAN 1827
                      +  +  + S V+AEL  ++PF +R+E KQL LY N+    EIL+S+WD +
Sbjct: 1954 VDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTD 2013

Query: 1828 IILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQD 1887
            I + SH T EQYF F+  D+Q+ CN  +E + +L V LS SL+KLT SEPRRI +SFLQD
Sbjct: 2014 IFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQD 2073

Query: 1888 EKLIGESLGYIKGLLQLFSPLARN--------KTQSSALRWSLDANLNYFGILVPMASTF 1939
            E++  ES   +K L ++F   A+N          + +  +W+L+ N+NYFGIL+P+ASTF
Sbjct: 2074 ERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTF 2133

Query: 1940 FVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMS 1999
            FV E+HMLL ++ N ++   E ++ ++GQ+S+EN L LI + SLP  LSKL+DFSIR+ +
Sbjct: 2134 FVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRIST 2193

Query: 2000 SQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHR-KQDKAISPFSL 2058
             QK  +S +S QIESSHFR+C SP SLV VLWG  QLQ+ LEY++ H+ K+   +S    
Sbjct: 2194 LQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKT 2253

Query: 2059 FDGSASADRQID-FRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTL 2117
               S++++  ++ FRSIHILSYN CIGWM         G + G+DRLFSAYEK+YGKLTL
Sbjct: 2254 GTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTL 2313

Query: 2118 IDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEV 2177
            I+GY SV N  S++ F+SQG EK R+NRSFL ++QI YWLKE +S KDLFIR++G+AL+V
Sbjct: 2314 IEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDV 2373

Query: 2178 SLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNL--ENTSNNISPFLSHIRTI 2235
             +LSN  +IIE    S Q F+  +K ++ +     ++  ++  EN +  +  FLS I +I
Sbjct: 2374 DILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSI 2433

Query: 2236 DCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDP 2295
            +C+FKY GG L+++S+DD+     PSLE+ +P V I L Y H +   +PH +RC++ I  
Sbjct: 2434 NCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHS 2493

Query: 2296 THNILYSQCVPILNDIVEASQRMVQKHSPDETPLESSQSID--------YKSLLDSFDIA 2347
            +HNILYS+C P + + VE+ Q +++       P+E  QS+         YK +L  FDIA
Sbjct: 2494 SHNILYSKCAPFVIEFVESIQEILENR-----PVEPKQSVSKIATPNRTYKRILAPFDIA 2548

Query: 2348 FKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHI 2407
            F++ + +Q LS SCEP AKVQA+VG DSF FG++T      +P  ++L + KI +SV+HI
Sbjct: 2549 FRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHI 2608

Query: 2408 FSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLN 2467
            FS+E SASFS++F+D T IFT P ++ V L+SDI++FFNMKQ QNL LFLDIW L+  + 
Sbjct: 2609 FSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIG 2668

Query: 2468 NKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRT 2527
             +   K    KK      + +       I W+F +IFTNV  D+ LGP+LG++S +L +T
Sbjct: 2669 IRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKT 2728

Query: 2528 WFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSL 2587
            WF +D Y  +R++L  F D + +KS GRLSG+ D+ NA W  EVNY        S  +++
Sbjct: 2729 WFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAI 2788

Query: 2588 SLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATAL 2647
             + +G VA+KTAFDYHMF+I  ++ + F L SE D  G LPDLL+  L C+E+  C+T L
Sbjct: 2789 GIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTL 2848

Query: 2648 TAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDIT 2707
             A+NILDIYNTI R RQD + SY ETL ESN+ + R  + Y DIL+SLNLLRTD+  D++
Sbjct: 2849 VASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVS 2908

Query: 2708 TFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDE 2767
              + QISPISLFD EVLV+NIDN+SARSET S +KLKT L LQV NA V+LST+KEELDE
Sbjct: 2909 KLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDE 2968

Query: 2768 ERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKW 2827
            E V KIS+ DYM YASKI GGTI+ +P+LLV MTTWQK  S+ IEY FTC+F  +V+V+W
Sbjct: 2969 ESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRW 3028

Query: 2828 NLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPE----EEIKAKLQYVPLDE 2883
            NLGP+NFIKEMW+TH+KSLAVRQ +  + +    ++ +  PE    E  + K  YV L E
Sbjct: 3029 NLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVE 3088

Query: 2884 PYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            P IEMPQIKDL DATPPMEWFG++RK+ P+ THQ A++++QKLVHA EKEYAK+ G 
Sbjct: 3089 PSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGH 3145

 Score =  308 bits (789), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 183/489 (37%), Positives = 260/489 (53%), Gaps = 89/489 (18%)

Query: 1   MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
           M  + +F  VSLS E+ FSWVFLV W+L C++ L + FY+ R+FAY++T +L+W LW+ +
Sbjct: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60

Query: 61  KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
           KVKI  ES+R++ LS  I F+NLCII ++ TISIL+G + W+Y LL TR S YE    QK
Sbjct: 61  KVKIHCESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120

Query: 121 DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
           +   +     +  KNI LPC+F+  CEG EIF+YN+T AYENII  FS +E++++++F+ 
Sbjct: 121 EHGYITPG--SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLH 178

Query: 181 KQ----------EMSELF------------------------HCHSERSDDK--GXXXXX 204
           K           E  ++F                        H HS+ +           
Sbjct: 179 KHFRFSKDDTPIERPDIFDSKTMKNTDFNPTTNNNDKNNNDTHMHSQHNHQHHTTGSSTT 238

Query: 205 XXXXXXXXPNINDRVFDEVHN---------------------QKKSIFMR---------- 233
                     IND  FD++ N                     QK SI  R          
Sbjct: 239 TASTSMATSTINDNNFDKLRNEELSSKIDKPPIIKKKEVKRPQKLSIIQRLQVMYEEFQL 298

Query: 234 -FLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVD-LCQPKEKLDLYKMHFQVDFIDI 291
            F P  L+L++GSI+ GNKFTPSLLI S  S  G+VD L     ++DLYKM  ++DF + 
Sbjct: 299 NFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNF 358

Query: 292 DISIRQNIEY---NRKKATFKNGKLSRMWATFVKVLHI---PF-----YNKSHNN----- 335
           +I ++ NI Y   ++ KA + +  LSR+W  F  +  I   P      +++ H N     
Sbjct: 359 EIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLE 418

Query: 336 -KGTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYS 394
               E E F  KWKGL LYK    +R G   + + FDF NHEYA+  +I+K+PR + T  
Sbjct: 419 DNIFEDEDFEKKWKGLSLYKDAALNR-GNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNE 477

Query: 395 YDIPGVVPH 403
           YDIPG+VP+
Sbjct: 478 YDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2258 bits (5850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1209/3063 (39%), Positives = 1823/3063 (59%), Gaps = 154/3063 (5%)

Query: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64
            ++F  VSLS ER FSWVFLV W+L+ V T T +FY+ +L+ + +T   EW LWK   +K+
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124
            ++ES+R++ L+G+I F+N+C+I +D+TISIL+ S+ WRY LL TR+S+YE  +       
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 125  VGEE---------------------------------------------DVNSMKNITLP 139
             G++                                             D +  KN  L 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 140  CRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQEMSELF----------- 188
              F + C GFEIF+YNR  AYE IIQ FS+EE++QF  F+ + ++ ++F           
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 189  -HCHSERSDDKGXXXXXXXXXXXXXPNI--------NDRVFDEVHNQKK-------SIFM 232
             +C+ +  ++                NI        ND     + N+ K        + +
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHL 305

Query: 233  RFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDID 292
              LP+++ +++G+I +GNKFT SLL+ + T   G++D   P  KLD++K     +  DID
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 293  ISIRQNIEYNRKKAT---FKNGKLSRMWATFVKVLH-IP---FYNKSHNNKGTESEPFMT 345
            +SI++NI YN + A+   F+ G L+R+W+    VL+ IP         + +  E   F+ 
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425

Query: 346  KWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGA 405
            KW GL LYK           D+V FDFANHEYAKVSN  K+P+ + +   DIPG+VPHG+
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 406  HPTL---EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPI 462
            HP L    GP++GN+ +PP F IDLQ    +I +G W  R I  L  ++ P +++   P+
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 463  KTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKF 522
              L PG  R++++F  +  VLD SS R+PTRE SKD +FLK++  T +++R FGW+DL F
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 523  AMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWN 582
               S   +   + P   GF N ++  F+E+E T+SVNH+++ K N  ++A ++GYPLGWN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 583  SSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSI 642
                W  N++S QL+ FLLREH+TL++D+  DFS+ EPTPYELFR F Y +N  I GYS 
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 643  YLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXX 702
            Y NVND NI+NNPLDFNENCYLS HG+    ++T P  S+   Y+ + Y+I TPMFR   
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 703  XXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFV 762
                     EFM+NKE+GRS+ F V G Y +YSELDIDNVD+L+++  S  T L+C+GFV
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 763  MRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLS- 821
            ++Y+MN + NYFG F  FIT+EEY+ +IR    +++G          +TN  T   GL  
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSI--------NTNDLTSIEGLQK 897

Query: 822  -DPYVRLRAD---PPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGE 877
             D       D     + RSD+ RT NETDIW  F V +GAL+LPE +YN D CV+L FGE
Sbjct: 898  MDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGE 957

Query: 878  LIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGH 937
            L +++R+CNYYMD+  T+   ++ R+     HELFE I+  N R+    G+++ +TIHGH
Sbjct: 958  LFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGH 1016

Query: 938  RMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETP 997
            RMYGLPP E TYFCQW I++    I+SD  F   F      IGF  +N EN+LLY+ +T 
Sbjct: 1017 RMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTV 1076

Query: 998  DDMT--SXXXXXXXXXXXXXXXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILL 1055
            +DMT  S                +RA +   ++   +IDFENE+Y++R+D+        L
Sbjct: 1077 NDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSL 1136

Query: 1056 LTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQ 1115
             + + DS    ++D+ TK+ +T+F +  +   H   QR +I L+DSP++RC FLLP   Q
Sbjct: 1137 DSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQ 1196

Query: 1116 ESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDS 1175
            ES  YK                      T +FI+E +L +++  L  D+  Q ++   ++
Sbjct: 1197 ESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSI---NA 1253

Query: 1176 PSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVD 1235
               S DT+   +  D     +      IL+     + DN +++VK+L V ++P I   ++
Sbjct: 1254 ELNSVDTTPLKDSFD----MQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIE 1309

Query: 1236 GLLGEF-WKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVD 1293
                EF  K +  + ID IEM+IV RL  L  N +  +N+ L V  I+  WG ++   + 
Sbjct: 1310 KFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIG 1369

Query: 1294 LYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVE 1353
             Y + L F+L Q +   +   +  +   L K RSVR  + + S     ++RPP LSL +E
Sbjct: 1370 TYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLE 1429

Query: 1354 GWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQG 1413
            G+EA+S    K + +++L S DITVDE Q+ WL  Y+  Q  L   +  S   +++    
Sbjct: 1430 GFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQAS 1489

Query: 1414 TRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPN 1473
             ++  +  +  A E YQI H+PYVITKPA ++RLS  H+REN SWRI+T+LRHILTYLP 
Sbjct: 1490 YQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPE 1549

Query: 1474 EWRNNSAIQ-------VSPTVDSTDASVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQ 1526
            +W +    +       +     ST  +V S+WR WE+SDI +SYIYR IF+ + SK   +
Sbjct: 1550 DWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSK---R 1606

Query: 1527 SLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNL 1586
             L+  +KV   +F+FTIYS  Y    NF+IT+ANI+     A ++++V      + ++++
Sbjct: 1607 ILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINN-EADQVNEVDLIRKQEEIVDV 1665

Query: 1587 TVSLGAIKGELNDQLLKL-RNIFSKAQTPALKRSK-TSINISKSYKVNVLLAFDRSELQF 1644
               +G+IK E  + +LKL R+I    +T    +S+   ++I+K +KVN+   FD  +   
Sbjct: 1666 VTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNG 1725

Query: 1645 VLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELS 1704
                + L +R+ N       E    S+ P+ SFV++A R+   LKH + +L +   R L 
Sbjct: 1726 QFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLF 1785

Query: 1705 LTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPN 1764
             + TAEL S + SL IN +CSN H +++  TE+ VN+IK I   +  L    +  + T +
Sbjct: 1786 ASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTD 1845

Query: 1765 VQGTSTNLSI------------PLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLN 1812
               T    S+               N  L+ +F++V++E+  L P  ++HE   + +  N
Sbjct: 1846 NINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYN 1905

Query: 1813 RVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKL 1872
             +  +E+L+ + D ++ L S  T EQY   +   L++   LP  +  ++++ +S+S++KL
Sbjct: 1906 TINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKL 1965

Query: 1873 TLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQS--SALRWSLDANLNYFG 1930
            T S+PRR+L SFLQDEK +  SL +++ L  L        +++  S+  W ++    Y G
Sbjct: 1966 TTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMG 2025

Query: 1931 ILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKL 1990
            +L+P+ +T++VFE+H  L+ ++N  +          G +S ++ + LIK+ S+P   SK+
Sbjct: 2026 VLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKI 2085

Query: 1991 LDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQD 2050
            LDFSI++ + + V N  +S++IESS FRVCL+P SL+Q +WG +QL  LL  +      D
Sbjct: 2086 LDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSY-----YD 2140

Query: 2051 KAISPFSLF-----DGSASADRQIDF--RSIHILSYNLCIGWMFQLGDDVKTGLIIGFDR 2103
            ++   F +F     DG+ +++++  F  RS HILSYN  IGW++Q  D+   GLI+G++R
Sbjct: 2141 QSTVNFFVFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNR 2200

Query: 2104 LFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSM 2163
            LFS YE ++GKLTL+DG+FS+ANG S DTFYS G E  ++NRS+L N+QI YW+KEI+ M
Sbjct: 2201 LFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKM 2260

Query: 2164 KDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHK--RDSGPRNKLNLENT 2221
            K LFI+ +GE L+V+   N  +IIEST+ SI  FQTLK+E+++   +    R++ +    
Sbjct: 2261 KHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSAL 2320

Query: 2222 SNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAE 2281
            +N   P    ++ ++C+F Y GG+ +++S   +     P+L IKSP V I L Y++ E E
Sbjct: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380

Query: 2282 RRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPD-ETPLESS--QSIDYK 2338
             + H I CL+ I+PT N+L S CVP L+D +   + +V+    + E  ++++    I+  
Sbjct: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINIT 2440

Query: 2339 SLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVE 2398
            SLL++FDI FK+ SG Q ++L CEP+AK+  DVGF SF F + T  L   +P  +SL + 
Sbjct: 2441 SLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIN 2500

Query: 2399 KIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLD 2458
             I++SV+H FS E SASF V  +D   IFTHP+VFG  LV D+ + FN+KQ QN+++FLD
Sbjct: 2501 DIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLD 2560

Query: 2459 IWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLG 2518
            IW ++     K   KD +     KS  +++     +++ WSF  I TN+ GD+++G +LG
Sbjct: 2561 IWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLG 2620

Query: 2519 VLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGS 2578
             L+L L RTW +TDH+  +R++LH F D + I SEGRL G  ++ + TW  +VNY     
Sbjct: 2621 NLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYK 2680

Query: 2579 IKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCK 2638
               S  + L   VG+V++K AFDYHMFLI T+ ++KFH+ SE D+  ILPDLL V L+C 
Sbjct: 2681 FVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCD 2740

Query: 2639 EMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLL 2698
            E+  C TAL A+NILDIYNTI R RQDN+ SYIETL ESN+   +   LY+DIL+SLNLL
Sbjct: 2741 EIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLL 2800

Query: 2699 RTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSL 2758
            +T LS +I     QISP SL+D EV+++ + +V + +ET++GEK+KT+L ++V NA +SL
Sbjct: 2801 QTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSL 2860

Query: 2759 STSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCR 2818
            ++  +EL EE +A++S E Y+ YAS ++ G I ++P+L ++MTT+Q   + +++Y ++C 
Sbjct: 2861 TSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCS 2920

Query: 2819 FFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQ--SNKTMSEKDKQADLDPEEEIKAKL 2876
            F  +V V WNLGPINFIKE+W+TH++SL VR  Q   N  +S ++ + D D   ++ + +
Sbjct: 2921 FDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLEN-EGDTDESVKVLSNI 2979

Query: 2877 QYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAK 2936
            +Y+ L+EPYIEMPQIKDL DATPP+EWFG++RK  P+ATHQ  IV IQKLV+ A+KEYAK
Sbjct: 2980 EYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAK 3039

Query: 2937 VQG 2939
            V G
Sbjct: 3040 VLG 3042

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2141 bits (5547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/3042 (39%), Positives = 1779/3042 (58%), Gaps = 150/3042 (4%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+  SQF+ + +S E NFSWVFLVDWVL+ V++L+V+FY GR  AY IT++++W LW+ +
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KVKI+++SL+I+ L G + F+NL +I KDQTIS L+GS  WRY LL +R++  EE     
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKS- 119

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
                 GEE     K+  L CRF L  +GFE+FIYNRTVAY+ I++  +++++  F+KF  
Sbjct: 120  -----GEE--KDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFE 172

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
              E S   H   E+ +D+                 NDR F E     +S+ ++FLP+ L+
Sbjct: 173  GGEDS--LHSSEEKLEDETLASDSSVSNVDST---NDRNFQE--QDSRSMLLQFLPIHLK 225

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
            ++RG+++LGN  TPS++I    S  GVVD+CQ  EKLDLYK+ + +DF ++D+ I+ NI 
Sbjct: 226  VNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNIS 285

Query: 301  Y---NRKKATFKNGKLSRMWATFVKVL-----HIPFYNKSHNNKGTESEPFMTKWKGLGL 352
            +   N  K+   + ++SR+W  F K+      H   ++ +      + + F  KW+GL L
Sbjct: 286  FGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLAL 345

Query: 353  YKGLTFDRDGEDYD----------EVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVP 402
            Y    ++    D+            +  D  NHEYAK + I+KS +  +TY+YDIPG+VP
Sbjct: 346  YS--EYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVP 403

Query: 403  HGAHPTLE---GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSS 459
            HGA  T+E   GP+VGN+GAPPEF +D + YG TICYGPWA R+IQ+L RM+ P V+R +
Sbjct: 404  HGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDA 463

Query: 460  VPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLD 519
            +P+K L+PGSRRIYT F  +  +++ + WRIPTRE SKDQ+FLK+++ +  + RPFGWLD
Sbjct: 464  IPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLD 523

Query: 520  LKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPL 579
            +K   ++   +T  +CP   GF NK+  H  + E  SSVNHD+  K +   ++ D+GYPL
Sbjct: 524  IKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPL 583

Query: 580  GWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDG 639
            GWNS A W    +S Q+ TF LR+H+ L++DIF DF SG PTPYELFRPF+Y+  W ID 
Sbjct: 584  GWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDN 643

Query: 640  YSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFR 699
            YSIYLNVND NI+NNPLDFNENCYLSLHG+ L ID +    +ITG    V Y I TP F 
Sbjct: 644  YSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFH 703

Query: 700  XXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCY 759
                        EFMKNKEVGRSY F + G Y  +S++D+ N+DT+ +EC S  TTL C 
Sbjct: 704  LQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCC 763

Query: 760  GFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGG 819
            GFV+RYLMN+ MNYFGDF HF T+EEYT  ++ K +    +   +++ D S+ +S+ S  
Sbjct: 764  GFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFV 823

Query: 820  LSDPYV------RLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVAL 873
             +D             DP V R+D+KR  NE D+WFTF V +G LV PE IY+C  C+ L
Sbjct: 824  TNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGL 883

Query: 874  HFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALT 933
            HF  L VDLR  NYYMDL A++S T IKR+       +F+ +R   G  +   G L+ L 
Sbjct: 884  HFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELN 943

Query: 934  IHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYD 993
            IH HRM+GLP IE TYFC+W   +  L I+SD +FAKG    F+ IGFGY + EN L+Y+
Sbjct: 944  IHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYE 1003

Query: 994  VETPDDMTSXXXXXXXXXXXXXXXSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSL 1051
            +  P DMTS               ++  VV  D+  ++ + IDFENERYS ++  K+P++
Sbjct: 1004 IIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNI 1063

Query: 1052 SILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLP 1111
             +L+      +E   L +  T + L  F Q RDF  HR+ QR++ITL+DSP++RC+FLLP
Sbjct: 1064 KLLVSEKSSKNEVQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLP 1121

Query: 1112 CYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKC----DYDTQ 1167
               Q++ LY                       TID I E LLG+     +C    +Y  +
Sbjct: 1122 MQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKE 1181

Query: 1168 RTVDDPDSP--SESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVD 1225
              + + +S     S  TS   E         ++Q        P  +YD+ II++    + 
Sbjct: 1182 TAITEENSSFIQGSGSTSALKE------LSSYSQNCPSYKLEPKFEYDSFIINLGKTIIA 1235

Query: 1226 LDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLW-NNTCVLNLKLYVVDINFFW 1284
            ++P     +  +  +F   +  DIID  E+ IV++  + +   + V NL++    I F +
Sbjct: 1236 INPSSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTF 1295

Query: 1285 GDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLR-------SVRATVFDRSI 1337
            G    K     +D L  ++   + DL  + I  +  + SKL        S++A+  +  I
Sbjct: 1296 GSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNS-SKLEYTEEVTSSLKASSINFFI 1354

Query: 1338 TEGVEERP-------PALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYI 1390
             +  + +P       P  S+  E  E +S   E    S++  + D  V+ SQLEWLS Y+
Sbjct: 1355 NQQ-QLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYL 1413

Query: 1391 AEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNG 1450
                     +  SF+K     Q  +++L+     AS  Y I H+  VITKPA+I RLS  
Sbjct: 1414 RAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKN 1473

Query: 1451 HVRENPSWRIITRLRHILTYLPNEW--RNNSAIQVSPTVDSTDA-----SVASHWRRWEI 1503
            H+REN SWRIITRLRHIL YLP  W  R   +++        DA      + S+WR WE 
Sbjct: 1474 HIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEF 1533

Query: 1504 SDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYS-----EGYRVAHNF--VI 1556
            SD+ + YIY+ +FLS +S  + +      KV+     F++ S     E + V  N   VI
Sbjct: 1534 SDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVI 1592

Query: 1557 TRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIF---SKAQT 1613
            +   I     P+A+ ++   + +    M ++ ++ +I+G+L D ++KL  ++   S    
Sbjct: 1593 SNELIESSLPPSAKNTEDSASTEK---MIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSD 1649

Query: 1614 PALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAP 1673
              LK +    ++       VLL  DR++    L   RL  R    + +  +E++ + +  
Sbjct: 1650 TNLKTTSVKHDVKPKLIQGVLLV-DRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSET 1708

Query: 1674 ALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMT 1733
             +S       SE+W++H   VL E+  ++ +L  +  L+       + ++     + AM 
Sbjct: 1709 KVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMA 1768

Query: 1734 STELLVNSIKQIMESISELKRHFAM---EKTTPNVQGTSTNLSIPLQNTALTVSFSDVTA 1790
            STE  ++ I  I  S+  +++  A    +K    +  T    S  L    L  + S  + 
Sbjct: 1769 STEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSL 1828

Query: 1791 ELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQ-V 1849
             + PLTPF +      + +++ +       I+I D +I L S ++ ++Y  F+   +  V
Sbjct: 1829 NIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLV 1888

Query: 1850 KCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLA 1909
              N P +++  LNVG+++ + KLT+S+PR  + S ++DE L  ++   +K L + F    
Sbjct: 1889 ISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKN 1948

Query: 1910 RNKT---QSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNN---ASDGQDEGDH 1963
            + K+   + + + W L  N+ Y GI+V + S  +V E++ +L +++N   A    ++G H
Sbjct: 1949 QEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLH 2008

Query: 1964 HVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSP 2023
             + G  SIEN LLLI    L  +LSKL+D ++ +  SQ+  +  Q+ QIESSHFRV L P
Sbjct: 2009 GIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCP 2068

Query: 2024 GSLVQVLWGTHQLQSLLEYFRKHRK--QDKAISPFSLFDGSASADRQIDFRSIHILSYNL 2081
             SL +VLW  ++   + E ++      Q K  +P  + + S        FRSI ILSYN 
Sbjct: 2069 MSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNK------FRSIQILSYNF 2122

Query: 2082 CIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQ 2141
            CIGW+F  G +   GLI G++RLF+AY+K YGKLTL+D YFS+A+G S+DTF+S G EK 
Sbjct: 2123 CIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKD 2182

Query: 2142 RYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLK 2201
            ++NRS+L ++QI YW  +     +LF+R+ GE L+V+ LS+S  I    + SIQ FQ LK
Sbjct: 2183 QFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELK 2242

Query: 2202 KERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPS 2261
            K  +    +    +  + + +  + P LS IR  +C  KY GGV K++S +D+     PS
Sbjct: 2243 KTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPS 2302

Query: 2262 LEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQ- 2320
             E++SP V +A+ Y H     + H IR LV++DP++N L+  CVPIL+ + +  + M++ 
Sbjct: 2303 FEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKS 2362

Query: 2321 ---KHSPDETPLESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFT 2377
               K  PD     SS  ++YK LL +FDIAF V  G+Q +SLSCEP+AKVQADVGF+   
Sbjct: 2363 FNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLA 2422

Query: 2378 FGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDV---FG 2434
              + TN+L +  P  +S+ +E ++++ RHIFSRE S SF +D +D   + THP++   +G
Sbjct: 2423 VKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYG 2482

Query: 2435 VALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPT 2494
              LVSD+ ++FNMKQLQ+LNLFLDIW+ + ++    +  +      T++ +LS     P 
Sbjct: 2483 TTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGN------TRTRSLSSHDKLPV 2536

Query: 2495 S----------ICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAF 2544
            S            W++TLIF+N+KGD+DLGPSLGVLS+R +R+W  +DH+   R+ L  F
Sbjct: 2537 SKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVF 2596

Query: 2545 ADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHM 2604
             + + + S+GRL G   ++   W SE+++P  G    +  +SLSL +G +A+KT+FDYHM
Sbjct: 2597 LENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHM 2656

Query: 2605 FLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQ 2664
            FLI  ++ +   L +E D  GIL DLL V+++C ++    TAL +AN +DIYNTI RMRQ
Sbjct: 2657 FLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQ 2716

Query: 2665 DNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVL 2724
            DN+ SYIETL++SN+   +      ++L+SL+LLRTDLS  I  F  Q+ P +LFD+EVL
Sbjct: 2717 DNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVL 2776

Query: 2725 VLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASK 2784
            VL  +++SA ++TQ   K+KT L+ Q+ N KVSLS  K + +EE V++I +++Y+ +A+K
Sbjct: 2777 VLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATK 2836

Query: 2785 ISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIK 2844
            + GGTI+  P +LV MTTWQ+  S++IE L+T  F  +V VKWNLGPINFI+EMW+TH++
Sbjct: 2837 VRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVR 2896

Query: 2845 SLAVRQTQSNKTMSEKDKQ--ADLDPEEEIK-----AKLQYVPLDEPYIEMPQIKDLGDA 2897
            +LA+R+      M +K+K    D   EE+IK      K  Y+PL+EP IEMPQIKDLGDA
Sbjct: 2897 ALALRRVHD---MRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDA 2953

Query: 2898 TPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939
            TPP+EWFGV+R+R P  THQ  +V +QKL H AE+EYA+V G
Sbjct: 2954 TPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLG 2995

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1767 bits (4576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/3040 (34%), Positives = 1638/3040 (53%), Gaps = 181/3040 (5%)

Query: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64
            SQF+RVSLS   +FSWVFLVDWVL+  V+L   FY GR+F Y +T +LEW  WK +KVKI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124
            S++SL+I+ L G I F+NL ++ ++QT S L+GS+ WRY LL +R++ + +AS   D   
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID--- 119

Query: 125  VGEEDVNSMKNI-TLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQE 183
                     K++  LPCRF + C+G E FIYN+T A++NI+    RE+  +F+ F     
Sbjct: 120  ---------KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS 170

Query: 184  MSELFHCH--SERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQL 241
                  C    + +  +               ++NDR F    +     F++ LP+E  +
Sbjct: 171  DKNTDECSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPP--FLKLLPLEYSV 228

Query: 242  SRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIEY 301
             +G++V+GNK + S+++ S     GV+D C P  K+DLYK+  + +F    IS++ N+  
Sbjct: 229  QKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSL 288

Query: 302  ---NRKKATFKNGKLSRMW----ATFVKVLHIPFYNKSHNNKGTESEPFMTKWKGLGLYK 354
               N  K+  K  KLS++W      F K       N +++ K     P + +W+GLGLY 
Sbjct: 289  ESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP-LKRWRGLGLYW 347

Query: 355  GLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPT---LEG 411
                + D    D   FD + HEYA+ + ++K    +L Y++D PG+VPHGA PT   ++G
Sbjct: 348  K---EEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDG 404

Query: 412  PEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRR 471
            P+VGN+G PP++ ID+Q  G ++ YGPW+  EI  L ++ SP V+R S P++ L+PGS+R
Sbjct: 405  PDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKR 464

Query: 472  IYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVT 531
            IYT  + +  ++  S WRIPTRE SKD EFLK+F+ T +E RPFGWL++  +  S     
Sbjct: 465  IYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFN 524

Query: 532  TVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINL 591
              +CP   GF N + +HF + E  +SVNHD++L      +   +GYPLGWN  A W  + 
Sbjct: 525  IAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDS 584

Query: 592  HSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNI 651
             S Q + F+L++H+TL+ DI +DF SGEPTPYELFRPF Y  NW   GYSIYLNVND NI
Sbjct: 585  VSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANI 644

Query: 652  VNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXX 711
            VNNP++FNENCYLS HG++L ++   P ++I G    + Y++ TP+FR            
Sbjct: 645  VNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLH 704

Query: 712  EFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKM 771
            EFMK+KEVGRS +F++ G Y  +S+LD+DN+DT+ +EC S  TTL CYG+V+RY + VKM
Sbjct: 705  EFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKM 764

Query: 772  NYFGDFFHFITSEEYTGVIRAKEKESVGKTEEES---LRDNSTNLSTDSGG----LSDPY 824
            NYFGDF HF T+EEY   +R     +V KT  +S   +++    +  DS      + DP 
Sbjct: 765  NYFGDFVHFKTTEEYMEELRG--TNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPL 822

Query: 825  VRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRS 884
                      ++ +KR  NE D+WFTF V +G  +LPE +Y+CD C AL F  L +DLR 
Sbjct: 823  T-------AKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRH 875

Query: 885  CNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRT---EKEHGSLAALTIHGHRMYG 941
             NYYMD+ A +S   I+R +     E+FE      GR    E   G L+ L IH HRM+G
Sbjct: 876  INYYMDMQAALSPLRIRRLIDCGCEEVFEQ----KGRALCGELVAGRLSRLHIHTHRMFG 931

Query: 942  LPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMT 1001
            LPP E TYFC+W   L  L ++SD  F  GF   +  +GFG+ + EN + Y V    DMT
Sbjct: 932  LPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMT 991

Query: 1002 SXXXXXXXXXXXXXXXSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSE 1059
            S                    +  +  +++    D EN  YS R+DL V +L+  ++   
Sbjct: 992  SVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKN 1051

Query: 1060 DDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPL 1119
              ++ I      T + +++F Q +D   H  +Q+ +I  ND+PF+RC FL+P  LQ S  
Sbjct: 1052 KSNKAI--ASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSD 1109

Query: 1120 YKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSES 1179
            YK                     E +  +       F   LK +  ++  VD        
Sbjct: 1110 YKGLFGCIPPGVSIPSLAVPLQTENVKAV-------FQGYLKAENASKDFVD------RW 1156

Query: 1180 FDTSQEHEGPDDVRYDRFAQLPKILSPN---------PLEQYDNVIIDVKFLAVDLDPLI 1230
            F  ++          D   QL  IL  N         P  +++ ++++++   + + P  
Sbjct: 1157 FPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPEC 1216

Query: 1231 CSYVDGLLGEFWKVNTVDIIDEIEMSIVK---RLGQLWNNTCVLNLKLYVVDINF-FWGD 1286
               +   + +  K      ID IE+ +V    ++     N   + + +  +D+ F  +  
Sbjct: 1217 YEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNK 1276

Query: 1287 KNAKVVDLYFD------KLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVF---DRSI 1337
            +N   V+           LD+ L +  +    +    +  +L K+ S+   VF   D+  
Sbjct: 1277 ENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKT 1336

Query: 1338 TEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLI 1397
                 +   A   +V+  EA+S++      S+ L S + +V   +  WL  ++ +  +  
Sbjct: 1337 KFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDS 1396

Query: 1398 KNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPS 1457
            K ++   +     ++   ++    I+ AS+ YQI+H+P VITKPA+I RL + HVRE+ S
Sbjct: 1397 KQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRS 1456

Query: 1458 WRIITRLRHILTYLP--------NEWRNNSAIQVSPTVDSTDASVASHWRRWEISDITRS 1509
            W+I+TRLRHIL YLP        N+ + NS      T + T   + S+W  W+ SD+ + 
Sbjct: 1457 WKIVTRLRHILNYLPTTLISDIFNDLK-NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKC 1515

Query: 1510 YIYRTIF-------LSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVA-HNFVITRANI 1561
            Y+YR +F       ++ +S T+ ++   ML     +FF +I +    V   N    R   
Sbjct: 1516 YMYRRVFTNTLDDTVAHESSTKIETGTFML-----NFFDSINTGSDSVILKNLKAQRTLE 1570

Query: 1562 VGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELND----QLLKLRNIFSKAQTPALK 1617
              ++  A + S +  A D D    L+  +   +  L+D    +LL +R +F+     A  
Sbjct: 1571 ACKDEAAEKRSNMSNAED-DLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAV 1629

Query: 1618 RSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSF 1677
            +    +   + Y   V    DR ++Q + G  R   +   G    ++ + K+  A A S 
Sbjct: 1630 KENEKLPAFQQYTALV----DRCDIQLLCGANRANLKSF-GNTLTIVRENKSEDADAFST 1684

Query: 1678 VFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPS-LSINIQCSNSHIRAMTSTE 1736
             F     E  ++H + +L +A SR  S  + A  +S   S   ++++     ++  + ++
Sbjct: 1685 AFAWSWFEFGIRHRNTILLDAFSR--SSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESK 1742

Query: 1737 LLVNSIKQIMESISELKRHFAMEKTTPNVQ---GTSTNLSIPLQNTALTVSFSDVTAELM 1793
                 I  + ES + L+   A+   T  ++     +T    P    AL +  SD+T ++ 
Sbjct: 1743 HYCTFIDSLEESWNNLR--LALGPNTGFLEKPHSAATEKVAP--QFALNIDISDLTTDIS 1798

Query: 1794 PLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNL 1853
             L+   +    K+L L   +  S+ + ++    +I + S +TT+QY   +  ++    + 
Sbjct: 1799 LLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHR 1858

Query: 1854 PTESSAI-LNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPL---- 1908
            P +++A    V L +++ KL L +PR I     +D   I ++   +  L   F  L    
Sbjct: 1859 PKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKN 1915

Query: 1909 ------ARNKTQSSALRWSLDANLNYFGILVPMASTFFVF---EIHMLLAAMNNASDGQD 1959
                    N   + +  W     LNY G+L+P+ ST ++    EI   + A    +   +
Sbjct: 1916 DKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASE 1975

Query: 1960 EGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRV 2019
                 + G +S  +   LI +  LP  LS+++DF++ +  +++     +S QIES +FR+
Sbjct: 1976 NSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRI 2035

Query: 2020 CLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSY 2079
             LSP SLV++L+  ++L  L E     ++Q     P S+        R+  FRS+ +LSY
Sbjct: 2036 ALSPFSLVRILFLVNELSRLSEL---QKRQTVGKLPESVEVRETFRFRRA-FRSVQVLSY 2091

Query: 2080 NLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSE 2139
            N C+GW+F + D  + GLI G+ RLF+A+EK YGKLTL+D YFS+A G ++D FY+  + 
Sbjct: 2092 NFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNS 2151

Query: 2140 KQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQT 2199
             +  NRSFL ++QI YW++      +LFIR+NGE L+V  LS S D+    + S+  F  
Sbjct: 2152 FENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDE 2211

Query: 2200 LKKERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEG 2259
            LKK+ +    S    K     ++ +  P LS I+ +DC+ +Y GGV ++YSLDD+    G
Sbjct: 2212 LKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAG 2271

Query: 2260 PSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMV 2319
            PS +++SP V I   Y      +  H +R  + +  +HN ++  CVP+LN++    ++++
Sbjct: 2272 PSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLL 2331

Query: 2320 Q--KHSPDETPLE--SSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDS 2375
            +    SP E   +  S +S+DY+S L   DI+F +  G+QQ+S SCEP+AKVQAD+GF+ 
Sbjct: 2332 KGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEK 2391

Query: 2376 FTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---V 2432
                V TNDL    P  +S+ + +I +  RHIFSRE S S  +D + +  I THPD    
Sbjct: 2392 LAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHT 2451

Query: 2433 FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS----MTLSK 2488
            +G+  + +I+V+FN+KQLQ+LN+F++IW+ +  +  +     +  +  T      +   K
Sbjct: 2452 YGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFK 2511

Query: 2489 RTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADEL 2548
            + S+ TS  W+F LI + +KGD+DLG SLGVLSL   R W  TDHY    + L    +++
Sbjct: 2512 KVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKI 2571

Query: 2549 SIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIG 2608
             + S+GRL G   L+N +W+S + +P    +  S  ++L + +    +K +FDYH+ LI 
Sbjct: 2572 LLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIA 2631

Query: 2609 TIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRI 2668
            +++ +K  L ++ D  GI  +LL VA+S        TAL  ANILD+YNTI RMR+DNR 
Sbjct: 2632 SVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRK 2691

Query: 2669 SYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNI 2728
            SY ETL +SN+ + R      DIL SL+ LRT+L   +     QI P  LFD+EVL    
Sbjct: 2692 SYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKA 2751

Query: 2729 DNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGG 2788
             +   +S+ +  EKLKT L  Q+   K++LS  K +L E+  ++I +++Y+ +A K  GG
Sbjct: 2752 KDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGG 2811

Query: 2789 TIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAV 2848
            TI+ +P +L+ MTTW    ++ +E L++  F  ++ ++WNLG INF++EMW+TH++++A+
Sbjct: 2812 TILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMAL 2871

Query: 2849 RQTQS--------NKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPP 2900
            R++ +        ++ + EK +  DL  E E      YVPL+EP+IE+PQ KDLG+ATPP
Sbjct: 2872 RRSHNGQPRGFFEDEHLEEKLRDVDLGDEYE------YVPLEEPHIEIPQTKDLGEATPP 2925

Query: 2901 MEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            +EWFGV+RK+ P  THQ  IV +QKL H AE E+A++ GR
Sbjct: 2926 VEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGR 2965

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1731 bits (4483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1039/3020 (34%), Positives = 1638/3020 (54%), Gaps = 166/3020 (5%)

Query: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64
            S+F RV +S  ++FSWVFL DWVL+  V+L   FY GR+  Y IT +LE+  WK + VK+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124
                       G + F+NL +I +DQT SIL GS+ WRY LL++R++  E  S       
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE------ 105

Query: 125  VGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS--KQ 182
                     K   LPCRF + C+G E FIYNRT A++NI+    RE++   +KF S    
Sbjct: 106  ---------KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSP 156

Query: 183  EMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQLS 242
              +E     ++ +  K               ++NDR + ++ N   S F+R LP+E  + 
Sbjct: 157  RATEETSTENDSAAQKSHLETSMSSPSASTESLNDRTY-QLPNSMPS-FLRLLPLEYSVQ 214

Query: 243  RGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIEY- 301
            +G++++GNK T S++++S    +G +D C P  K+DLYK+  Q D     +S+R N+ Y 
Sbjct: 215  KGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYD 274

Query: 302  ------NRKKATFKNGKLSRMWATFVKVLHIPFYNKSHNNKGTESEPF-------MTKWK 348
                  N  KA      L + + TF++V       K + ++G+++E         + +W+
Sbjct: 275  NDEPLKNLPKANRLPKLLHKYYETFLRV------RKRYLSRGSKTESTRKDLRNPLERWR 328

Query: 349  GLGLYKGLTFDRDGEDYDEV-HFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHP 407
            GLGLY    +  +   +D+V HF+   HEYA+ S ++K    ++ YS+D PGVVPHGA P
Sbjct: 329  GLGLY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFP 384

Query: 408  TLE---GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKT 464
            TLE   GP+VGN GAPP+F +D+Q +G  I YGPWA  EI  + ++ SP V+R S P + 
Sbjct: 385  TLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTER 444

Query: 465  LSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAM 524
            LS GS R++T  + +  ++  S WRIPTRE SKD +FLK++K T ++ RPFGWL+L  A 
Sbjct: 445  LSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAE 504

Query: 525  DSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSS 584
             S   +   +CP   GF NK+ +HF + E  +SVNHD++L     D+   +GYPLGWN+ 
Sbjct: 505  GSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAK 564

Query: 585  ATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYL 644
            A W  +L S Q   F+L++H+TL+ DI +DF +G+PTPY+LFRPFIY+ NW + GYS+YL
Sbjct: 565  AKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYL 624

Query: 645  NVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXX 704
            NVND NIVNNP+DFNENCYLS HG++L I    P DSI G    + Y + TP+FR     
Sbjct: 625  NVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNT 684

Query: 705  XXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMR 764
                   EFMK+KEVGR+  F++ G Y  +S+LD++N+DT+ +EC S  TTL CYG+V+R
Sbjct: 685  PSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVR 744

Query: 765  YLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGG--LSD 822
            +L+ VKMNYFGDF HF T+EEY   +R    E    +E+ +   NST  +T   G    +
Sbjct: 745  FLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSA---NSTETTTAGEGEDKQN 801

Query: 823  PYVRLRADPPVSRS-DVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVD 881
                   DP +++   +KR  NE D+WFTF V +G L+LP+ +Y+C+ C A  F  L +D
Sbjct: 802  APKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDID 861

Query: 882  LRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGR--TEKEHGSLAALTIHGHRM 939
            LR  NYYMDL A +S   ++         LF       GR  +    GS++ L IH HRM
Sbjct: 862  LRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG---SEGRCPSRANFGSISDLHIHAHRM 918

Query: 940  YGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDD 999
            +GLPP E TYFC+W   +  L I+SD      F   ++ + F + + EN + Y +    D
Sbjct: 919  FGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILD 978

Query: 1000 MTSXXXXXXXXXXXXXXXSSR--AVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLT 1057
            MTS               +     +V+V N+T   +DFENERYS R D+ + S+++ +  
Sbjct: 979  MTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKE 1038

Query: 1058 SEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQES 1117
               D   I   D ++ + +T F Q ++F  H  +Q+ +I  ND+PF+RCSFLLP  +Q S
Sbjct: 1039 GGKDGSLIG--DFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRS 1096

Query: 1118 PLYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPS 1177
              Y+                     E +  I+++ L      L+   +   +  + D  +
Sbjct: 1097 DNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYA 1156

Query: 1178 ESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGL 1237
             +F +       +D   +  + + K++ P    Q       +K      D    ++V+ L
Sbjct: 1157 FNFASGLMSSTENDSNVESESLVVKLIKP----QASISACCIKPFRSFSDQAYSNFVEQL 1212

Query: 1238 LGEFWKVNTVDIIDEIEMSIVKRLGQLWNNTCVLNLKLYVVDINFFWGDKN----AKVVD 1293
            +      N ++++     + +KR  +   N  V +    +   NF  G  N    +  VD
Sbjct: 1213 IDS----NEIEVVLHFIETTLKR--KQCKNVKVFSPTFEMTLSNF--GSDNISQTSDTVD 1264

Query: 1294 LYFDKLDFDLGQR---TRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVE--ERPPAL 1348
            +   ++  D+  R   + +   ++ V +   L K+ S+   V + S    +E        
Sbjct: 1265 IVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLC 1324

Query: 1349 SLAVEGWEAYSWMREKIV--GSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTK 1406
            S +++  E   WM  + +   S +  S D  V   + E   +++      I  +    + 
Sbjct: 1325 STSIKDLEF--WMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSV 1382

Query: 1407 LHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRH 1466
              E  Q  +RD    I+TAS+ YQI H+P VITKPA+I RL N HVREN SW+IITRLRH
Sbjct: 1383 HKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRH 1442

Query: 1467 ILTYLPNEWRNN--SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSD 1519
            IL YLP         A++ +     T+A     ++ S WR WE SD+ + Y+YR  F S 
Sbjct: 1443 ILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYS- 1501

Query: 1520 QSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALD 1579
            Q + Q   L   L+V+  S   T+    ++      +    ++ + I  +E+     A+D
Sbjct: 1502 QYEGQAGPLN--LRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAID 1559

Query: 1580 YDNVMN---LTVSLGAIKGELND---QLLKLRNIFSKAQTPALKRSKTSINISKSYKV-N 1632
                 +   L+ SL A+K  +++   +LL  R +F    +  +  +   +   K  K+  
Sbjct: 1560 DGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLME 1619

Query: 1633 VLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHAD 1692
            + L  DR E++  L       +      +  L   +++     S        E  ++H +
Sbjct: 1620 LALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNN 1679

Query: 1693 LVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISEL 1752
             ++ +A +R  SL              +++      ++  +ST+   N I  + ES S L
Sbjct: 1680 AIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSL 1739

Query: 1753 KRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLN 1812
                     + ++     N S      A      D T+E+  L+P  +    K L +   
Sbjct: 1740 APKLKFNTRSKDLSPEMKNFS----KVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFE 1795

Query: 1813 RVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILN-VGLSTSLMK 1871
            +  ++ + + + + ++ L S  T +QY   +   +++   +  +   + + + L ++L K
Sbjct: 1796 KEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTK 1855

Query: 1872 LTLSEPRRILSSFLQDEKLIGESLGYIK-GLLQLFSPLARNKTQSSAL-------RWSLD 1923
              L +PR I+ +  QD     ++L  +K  LL L +    + T             W   
Sbjct: 1856 FKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQ 1915

Query: 1924 ANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSL 1983
             ++ Y G+LVP+ +T ++ EI+ L +++ +  +  +     V G++S+     LI +  L
Sbjct: 1916 LDMKYVGLLVPLGTTSYISEINELSSSL-SCDEAAEFSFPLVHGELSVAGISFLINDKEL 1974

Query: 1984 PADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYF 2043
            P DLSK+L+F+ R+  ++   NS +S QIES+HFR+ L P SL+++L         L Y 
Sbjct: 1975 PEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL--------SLAYE 2026

Query: 2044 RKHRKQDKAISPFSLFDGSASADRQID-------FRSIHILSYNLCIGWMFQLGDDVKTG 2096
              H    +A+   +   G  S+D   D       F SI ILSY+ C+GW+F       +G
Sbjct: 2027 ATHLSGLQALKDNA---GVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSG 2083

Query: 2097 LIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYW 2156
            L  G+ RLF+A+EK YGKLTL+D YF +A G +++ FY Q  E  R NRS L ++QI YW
Sbjct: 2084 LTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYW 2143

Query: 2157 LKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHK-RDSGPRNK 2215
             +   S  +LF+R+NGE L+VS LS S  I      S+  FQ LK++ +   +   P  +
Sbjct: 2144 FETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKR 2203

Query: 2216 LNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKY 2275
            +   +  + + P LS I  ++C+ +Y GGV K+YSLDD+ R  GPS +++SP V +  +Y
Sbjct: 2204 VPAGSAFSKL-PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEY 2262

Query: 2276 NHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQ--KHSPDETPLESS- 2332
                  +R H +R L+S+D +HN L+  CVPI++++    +++++    S  ETP  S+ 
Sbjct: 2263 TKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNM 2322

Query: 2333 -QSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPT 2391
             + I+Y+SLL   DI+F +   +QQ+SLSCEP+AKVQADVGF+ F   + TND     P 
Sbjct: 2323 QEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPL 2382

Query: 2392 GVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---VFGVALVSDINVFFNMK 2448
             +SL +  I ++ RHIFSRE S S +++ + F  + THPD    +G+A +  I+V+FN+K
Sbjct: 2383 SLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIK 2442

Query: 2449 QLQNLNLFLDIWQLNGK------LNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTL 2502
            QLQ+LN+F++IW+L+ K      L+NK      + +K   S    K+  + +S  W+F +
Sbjct: 2443 QLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKY--KKVISNSSFPWNFVV 2500

Query: 2503 IFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDL 2562
            I + ++G++DLG SLGVLSL   + W  TDHY    + L    D+LS+ S+GRL G F L
Sbjct: 2501 ILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLL 2560

Query: 2563 KNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESD 2622
            +N  W+S++ +P       S  + L++ +   A+K  FDYH+ LI +++++   L ++ D
Sbjct: 2561 QNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRD 2620

Query: 2623 LYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEA 2682
              G++ +LL V+LS        TAL  ANI D+YNTI RMR+DNR SY+ETL +SN+ + 
Sbjct: 2621 PRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDT 2680

Query: 2683 RVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEK 2742
            + +    +IL SL+ LRT+LS  +     Q+ P +LFD+EV+     + S  S+T+  +K
Sbjct: 2681 KGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKK 2740

Query: 2743 LKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTT 2802
            LKT+L L+V N K++LST K +L E   ++I +++Y+ +ASK+ GGTI+  P +L+ MTT
Sbjct: 2741 LKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTT 2800

Query: 2803 WQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMS--EK 2860
            W    ++ +E L++  F  ++ V+WNLG INF++EMW+TH +++A+R++ + ++ S  E 
Sbjct: 2801 WHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFED 2860

Query: 2861 DKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAI 2920
            +   D   + ++  +  Y+PL+EP+IE+PQ KDLG+ATPP+EWFGV+RK+ P  THQ  I
Sbjct: 2861 EHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVI 2920

Query: 2921 VLIQKLVHAAEKEYAKVQGR 2940
            V +QKL H AE E+A++ GR
Sbjct: 2921 VPLQKLAHLAESEWARILGR 2940

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1596 bits (4132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/2809 (34%), Positives = 1530/2809 (54%), Gaps = 138/2809 (4%)

Query: 214  NINDRVFDEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQP 273
            ++NDR + ++ N   S F+R LP+E  + +G++++GNK T S++++S    +G +D C P
Sbjct: 10   SLNDRTY-QLPNSMPS-FLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAP 67

Query: 274  KEKLDLYKMHFQVDFIDIDISIRQNIEY-------NRKKATFKNGKLSRMWATFVKVLHI 326
              K+DLYK+  Q D     +S+R N+ Y       N  KA      L + + TF++V   
Sbjct: 68   DTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV--- 124

Query: 327  PFYNKSHNNKGTESEPF-------MTKWKGLGLYKGLTFDRDGEDYDEV-HFDFANHEYA 378
                K + ++G+++E         + +W+GLGLY    +  +   +D+V HF+   HEYA
Sbjct: 125  ---RKRYLSRGSKTESTRKDLRNPLERWRGLGLY----WKENDPAWDDVFHFELPKHEYA 177

Query: 379  KVSNIIKSPRTVLTYSYDIPGVVPHGAHPTLE---GPEVGNNGAPPEFGIDLQFYGVTIC 435
            + S ++K    ++ YS+D PGVVPHGA PTLE   GP+VGN GAPP+F +D+Q +G  I 
Sbjct: 178  RYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIH 237

Query: 436  YGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRER 495
            YGPWA  EI  + ++ SP V+R S P + LS GS R++T  + +  ++  S WRIPTRE 
Sbjct: 238  YGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREP 297

Query: 496  SKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEAT 555
            SKD +FLK++K T ++ RPFGWL+L  A  S   +   +CP   GF NK+ +HF + E  
Sbjct: 298  SKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIR 357

Query: 556  SSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDF 615
            +SVNHD++L     D+   +GYPLGWN+ A W  +L S Q   F+L++H+TL+ DI +DF
Sbjct: 358  TSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDF 417

Query: 616  SSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDV 675
             +G+PTPY+LFRPFIY+ NW + GYS+YLNVND NIVNNP+DFNENCYLS HG++L I  
Sbjct: 418  GTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISF 477

Query: 676  TAPNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYS 735
              P DSI G    + Y + TP+FR            EFMK+KEVGR+  F++ G Y  +S
Sbjct: 478  RVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHS 537

Query: 736  ELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEK 795
            +LD++N+DT+ +EC S  TTL CYG+V+R+L+ VKMNYFGDF HF T+EEY   +R    
Sbjct: 538  KLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYV 597

Query: 796  ESVGKTEEESLRDNSTNLSTDSGG--LSDPYVRLRADPPVSRS-DVKRTTNETDIWFTFS 852
            E    +E+ +   NST  +T   G    +       DP +++   +KR  NE D+WFTF 
Sbjct: 598  EPKANSEQSA---NSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFI 654

Query: 853  VWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELF 912
            V +G L+LP+ +Y+C+ C A  F  L +DLR  NYYMDL A +S   ++         LF
Sbjct: 655  VEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLF 714

Query: 913  ESIRRDNGR--TEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAK 970
                   GR  +    GS++ L IH HRM+GLPP E TYFC+W   +  L I+SD     
Sbjct: 715  SG---SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCIL 771

Query: 971  GFFTLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXXXXXXXXXXSSR--AVVDVPNL 1028
             F   ++ + F + + EN + Y +    DMTS               +     +V+V N+
Sbjct: 772  SFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENV 831

Query: 1029 TFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKH 1088
            T   +DFENERYS R D+ + S+++ +     D   I   D ++ + +T F Q ++F  H
Sbjct: 832  TARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIG--DFSSSLKITKFCQLKNFLVH 889

Query: 1089 RSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFI 1148
              +Q+ +I  ND+PF+RCSFLLP  +Q S  Y+                     E +  I
Sbjct: 890  SMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMI 949

Query: 1149 IEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNP 1208
            +++ L      L+   +   +  + D  + +F +       +D   +  + + K++ P  
Sbjct: 950  LDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKP-- 1007

Query: 1209 LEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNT 1268
              Q       +K      D    ++V+ L+      N ++++     + +KR  +   N 
Sbjct: 1008 --QASISACCIKPFRSFSDQAYSNFVEQLIDS----NEIEVVLHFIETTLKR--KQCKNV 1059

Query: 1269 CVLNLKLYVVDINFFWGDKN----AKVVDLYFDKLDFDLGQR---TRDLDGETIVSEKIT 1321
             V +    +   NF  G  N    +  VD+   ++  D+  R   + +   ++ V +   
Sbjct: 1060 KVFSPTFEMTLSNF--GSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITA 1117

Query: 1322 LSKLRSVRATVFDRSITEGVE--ERPPALSLAVEGWEAYSWMREKIV--GSVSLLSTDIT 1377
            L K+ S+   V + S    +E        S +++  E   WM  + +   S +  S D  
Sbjct: 1118 LVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEF--WMTSEDIRKSSFNATSIDTW 1175

Query: 1378 VDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYV 1437
            V   + E   +++      I  +    +   E  Q  +RD    I+TAS+ YQI H+P V
Sbjct: 1176 VHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPV 1235

Query: 1438 ITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SAIQVSPTVDSTDA--- 1492
            ITKPA+I RL N HVREN SW+IITRLRHIL YLP         A++ +     T+A   
Sbjct: 1236 ITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEI 1295

Query: 1493 --SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRV 1550
              ++ S WR WE SD+ + Y+YR  F S Q + Q   L   L+V+  S   T+    ++ 
Sbjct: 1296 FLNIFSKWRSWESSDVEQCYMYRKAFYS-QYEGQAGPLN--LRVEVDSCSATVSDSTHKE 1352

Query: 1551 AHNFVITRANIVGEEIPAAELSKVQQALDYDNVMN---LTVSLGAIKGELND---QLLKL 1604
                 +    ++ + I  +E+     A+D     +   L+ SL A+K  +++   +LL  
Sbjct: 1353 GDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAF 1412

Query: 1605 RNIFSKAQTPALKRSKTSINISKSYKV-NVLLAFDRSELQFVLGQTRLTNRILNGKAALL 1663
            R +F    +  +  +   +   K  K+  + L  DR E++  L       +      +  
Sbjct: 1413 RELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFA 1472

Query: 1664 LEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQ 1723
            L   +++     S        E  ++H + ++ +A +R  SL              +++ 
Sbjct: 1473 LVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLG 1532

Query: 1724 CSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQNTALTV 1783
                 ++  +ST+   N I  + ES S L         + ++     N S      A   
Sbjct: 1533 SQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFS----KVAFEA 1588

Query: 1784 SFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFA 1843
               D T+E+  L+P  +    K L +   +  ++ + + + + ++ L S  T +QY   +
Sbjct: 1589 HVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVS 1648

Query: 1844 LGDLQVKCNLPTESSAILN-VGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIK-GL 1901
               +++   +  +   + + + L ++L K  L +PR I+ +  QD     ++L  +K  L
Sbjct: 1649 QSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHL 1708

Query: 1902 LQLFSPLARNKTQSSAL-------RWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNA 1954
            L L +    + T             W    ++ Y G+LVP+ +T ++ EI+ L +++ + 
Sbjct: 1709 LALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSL-SC 1767

Query: 1955 SDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIES 2014
             +  +     V G++S+     LI +  LP DLSK+L+F+ R+  ++   NS +S QIES
Sbjct: 1768 DEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIES 1827

Query: 2015 SHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQID---- 2070
            +HFR+ L P SL+++L         L Y   H    +A+   +   G  S+D   D    
Sbjct: 1828 THFRIALCPFSLIRIL--------SLAYEATHLSGLQALKDNA---GVKSSDDAKDFFNI 1876

Query: 2071 ---FRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANG 2127
               F SI ILSY+ C+GW+F       +GL  G+ RLF+A+EK YGKLTL+D YF +A G
Sbjct: 1877 SQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARG 1936

Query: 2128 QSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDII 2187
             +++ FY Q  E  R NRS L ++QI YW +   S  +LF+R+NGE L+VS LS S  I 
Sbjct: 1937 STSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIA 1996

Query: 2188 ESTLASIQKFQTLKKERMHK-RDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVL 2246
                 S+  FQ LK++ +   +   P  ++   +  + + P LS I  ++C+ +Y GGV 
Sbjct: 1997 GGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKL-PILSSISHVNCKVRYAGGVF 2055

Query: 2247 KIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVP 2306
            K+YSLDD+ R  GPS +++SP V +  +Y      +R H +R L+S+D +HN L+  CVP
Sbjct: 2056 KLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVP 2115

Query: 2307 ILNDIVEASQRMVQ--KHSPDETPLESS--QSIDYKSLLDSFDIAFKVTSGRQQLSLSCE 2362
            I++++    +++++    S  ETP  S+  + I+Y+SLL   DI+F +   +QQ+SLSCE
Sbjct: 2116 IISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCE 2175

Query: 2363 PRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVD 2422
            P+AKVQADVGF+ F   + TND     P  +SL +  I ++ RHIFSRE S S +++ + 
Sbjct: 2176 PKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLS 2235

Query: 2423 FTSIFTHPD---VFGVALVSDINVFFNMKQLQNLNLFLDIWQLNGK------LNNKGRAK 2473
            F  + THPD    +G+A +  I+V+FN+KQLQ+LN+F++IW+L+ K      L+NK    
Sbjct: 2236 FVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIG 2295

Query: 2474 DDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDH 2533
              + +K   S    K+  + +S  W+F +I + ++G++DLG SLGVLSL   + W  TDH
Sbjct: 2296 PTNLEKPLTSKY--KKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDH 2353

Query: 2534 YGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGR 2593
            Y    + L    D+LS+ S+GRL G F L+N  W+S++ +P       S  + L++ +  
Sbjct: 2354 YSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDE 2413

Query: 2594 VAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANIL 2653
             A+K  FDYH+ LI +++++   L ++ D  G++ +LL V+LS        TAL  ANI 
Sbjct: 2414 TAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIF 2473

Query: 2654 DIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQI 2713
            D+YNTI RMR+DNR SY+ETL +SN+ + + +    +IL SL+ LRT+LS  +     Q+
Sbjct: 2474 DVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQV 2533

Query: 2714 SPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKI 2773
             P +LFD+EV+     + S  S+T+  +KLKT+L L+V N K++LST K +L E   ++I
Sbjct: 2534 YPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQI 2593

Query: 2774 SIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPIN 2833
             +++Y+ +ASK+ GGTI+  P +L+ MTTW    ++ +E L++  F  ++ V+WNLG IN
Sbjct: 2594 GVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSIN 2653

Query: 2834 FIKEMWSTHIKSLAVRQTQSNKTMS--EKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQI 2891
            F++EMW+TH +++A+R++ + ++ S  E +   D   + ++  +  Y+PL+EP+IE+PQ 
Sbjct: 2654 FLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQT 2713

Query: 2892 KDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            KDLG+ATPP+EWFGV+RK+ P  THQ  IV +QKL H AE E+A++ GR
Sbjct: 2714 KDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGR 2762

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 1506 bits (3899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 971/3041 (31%), Positives = 1550/3041 (50%), Gaps = 200/3041 (6%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+ Q++FE + +  ER F WVFLV+W  L ++ +   FYL R   Y +T +L W +WK +
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            KV I+++SL  + + G + F+N+ I  +DQTISILKG+  WRY LL  R +Q + ++   
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIN- 119

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
                    D NS       CRF L C+G E+FIYN+   YE+I+   ++ ++    KF +
Sbjct: 120  --------DENS------KCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFAT 165

Query: 181  ---------KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKK-SI 230
                     K + S +F    E S+                  +   + + V NQ    +
Sbjct: 166  DDESIFGRVKTDSSVMFDPLDESSEQS---------------KVGQTILNSVSNQSAVPL 210

Query: 231  FMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFID 290
            ++ FLP E+ LS G++V+GNK TPS+ I       G++D+  P   LD YK+  + +   
Sbjct: 211  YLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSS 270

Query: 291  IDISIRQNIEYNRKKATFK---NGKLSRMWATFVKVLHIPFYNKSH------NNKG-TES 340
              +S++ NI +    ++ K   +GK   +W      L    +  SH      N KG T  
Sbjct: 271  TRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCL---LFTISHILAFTGNKKGLTGQ 327

Query: 341  EPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGV 400
            E F+T WKGL +Y   T D      DE+ FD  NHEYAK + I+ + R  L YSYD PGV
Sbjct: 328  EEFLTSWKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGV 384

Query: 401  VPHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSV 460
            +       ++G E G+    PE+ ID+Q Y     YGPWA R++Q+ ++M SP V+R   
Sbjct: 385  I---TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFS 441

Query: 461  PIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDL 520
              +    G  R +  F+    +++ S WRIPT+E SKD  FL K+K+T++E R FGW+D+
Sbjct: 442  AHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDI 501

Query: 521  KFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLG 580
            K   D+  S+   L   E GF N  + +       +SVNHDV+       +     YP  
Sbjct: 502  KLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQ 561

Query: 581  WNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGY 640
            WNS+ TW ++  S+ LE F+LR+H  L+ D+FTDF+SG+  PYELFRP +YQ +W I  Y
Sbjct: 562  WNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNY 621

Query: 641  SIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRX 700
            S+YLN ND NIVNNPLDFNENCY+S+HG    I V  P ++I+   + + Y+I TP F  
Sbjct: 622  SLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDI 681

Query: 701  XXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYG 760
                       EFM  + VGRS+ F+  G Y  Y+++DIDNVDT+++EC +   T   YG
Sbjct: 682  QLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYG 741

Query: 761  FVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGL 820
            F++RY+MN+K+NYFG+F  F T+EEY+      ++  V      +  D+ T    +    
Sbjct: 742  FLLRYVMNLKLNYFGEFAQFRTTEEYSE--ELAQRNDVATDIFNNNDDDQTTELVEPNSY 799

Query: 821  SDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIV 880
             +    +     + ++ +KRT NE DIW TF   +G  VLPE+ Y+   C  LHF  +  
Sbjct: 800  GESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITF 859

Query: 881  DLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMY 940
            D+R  +YY DL  +M+ST IKRY    S+ +F+    +   T    G L+   IH HRM+
Sbjct: 860  DMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMF 919

Query: 941  GLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDM 1000
            GLPP E TY  +  + L  L+  SD E  KGF        FG+ N E+ L Y++    D+
Sbjct: 920  GLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDI 979

Query: 1001 TSXXXXXXXXXXXXXXXSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTS 1058
            +                 +   +   +PN++   +DF   +YS R ++ +P+   L+  S
Sbjct: 980  SCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLV--S 1037

Query: 1059 EDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESP 1118
              D   I L  ++T +    F +  DF    + Q  +I L+D+PF RCSFL P   Q S 
Sbjct: 1038 SMDDHNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSD 1097

Query: 1119 LYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE 1178
            LYK                        D I E+LLG+    +  DY ++ T D  +    
Sbjct: 1098 LYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGD----IYQDYISEGTFDISNDTKL 1153

Query: 1179 SFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLL 1238
              +  +  +  ++       +   I   + L +  + + ++  + +D+   +      L 
Sbjct: 1154 QLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLY 1213

Query: 1239 GEFWKVNTVDIIDEIEMSIVKRLGQ-LWNNTCVLNLKLYVVDINF------FWGDKNAK- 1290
             +       D ID + + IV    +  +  + V   K+    I+F      ++  ++ K 
Sbjct: 1214 RQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKH 1273

Query: 1291 --VVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVF-------DRSITEGV 1341
              V D+  +KLD +L  R ++ D E+  SE  + +KL     T           +     
Sbjct: 1274 YFVSDI--NKLDLNLRLR-QEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPS 1330

Query: 1342 EERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNML 1401
            E    +     E  E Y++  + +V   +L    + +++   + +S +I          +
Sbjct: 1331 ESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFI 1390

Query: 1402 TSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRII 1461
             S T    + +  +R+LL  I  A + Y I H+P VITKPA I RLS  HVRE+ SWRI+
Sbjct: 1391 KSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIV 1450

Query: 1462 TRLRHILTYLPNEWRNNSAIQVSPTV--DSTDAS-----VASHWRRWEISDITRSYIYRT 1514
            TRLRH+L YLP  W   +++++         DA      + + WR WE +D+ R ++Y+ 
Sbjct: 1451 TRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKK 1510

Query: 1515 IFLSDQ---SKTQCQSLKKMLKVDF----------HSFFFTIYSEGYRVAHNFVITRANI 1561
             ++  +   +KT C S   +L + F          +SF   I ++ Y          ++ 
Sbjct: 1511 TYIPAEVTFAKTICFS-SDLLTISFNERDKEHLFMNSFMIDIRNDCY---------VSSA 1560

Query: 1562 VGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQ-LLKLRNIFSKAQTPALKRSK 1620
            VGE + A            +NV    VSL  ++  ++ + +LKL  +    +   +  + 
Sbjct: 1561 VGESMAAKS----------NNVYKTVVSLDELQINVDKKIILKLSKLIHTLKFEYVYSNP 1610

Query: 1621 TSINISKSYKV-NVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVF 1679
              +    + +  N+ L  ++      LG   L           L++ L +     LS + 
Sbjct: 1611 IVVAKDANGRCKNISLQLNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLL 1670

Query: 1680 FAKRSESWLKHA--DLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTEL 1737
            F   ++ + ++   +L   +      +LT  ++  +Y    S      NS I ++     
Sbjct: 1671 FFDVAKLFFRYKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMNINSSIPSIND--- 1727

Query: 1738 LVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNL---SIPLQNTALT-VSFSDVTAELM 1793
            ++ +  +I   I+E+ + FA      N+Q T   +   S  L+  A+  ++ + +  +L 
Sbjct: 1728 IIEANNEIRLHINEIGQDFA-----SNIQYTELPVLPDSQVLKPIAMVKMNIAAINIQLQ 1782

Query: 1794 PLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNL 1853
             L PF++R+  K+  + ++  +  +  +S+ D ++ L S +  E Y  ++   L++    
Sbjct: 1783 LLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842

Query: 1854 PTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKG-LLQLFSPLARNK 1912
               +  +  + L +S  KL++ EP++ +  FL D +   +++  ++  +L+  S   +N+
Sbjct: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNE 1902

Query: 1913 TQSSAL-RWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSI 1971
               S L    L+ N+ Y G+L+   +T +V E + L  + +      +      +   S 
Sbjct: 1903 FPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSS 1962

Query: 1972 ENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLW 2031
            E+   LIK+  +   LSK+LDFS+R+   +    + QS QIESS+    LSP SLV++L 
Sbjct: 1963 ESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLL- 2021

Query: 2032 GTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGD 2091
                  S +  F   +     I P S    S  +   I  +S HILSYNLCIGW+F LG 
Sbjct: 2022 ------SFVNEFSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGY 2075

Query: 2092 DVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNV 2151
            +   GLI G++RLF+ Y+K YGKLTL+D YFSVA+G S+ T+Y  G+EK   NRS+L ++
Sbjct: 2076 NANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSM 2135

Query: 2152 QITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSG 2211
            QI YWL+E +  KDLFIRVNGE L+VSLL+  F I++    S+ KF+ LK+  +      
Sbjct: 2136 QINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVT 2195

Query: 2212 PRNKLNLE-NTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVV 2270
              + +  E N  +N  P  S +R+I+C   Y G  +K+YS DD+      S EI+SP   
Sbjct: 2196 SNDPILGEWNYLDN--PLASSVRSINCIINYAGSSMKLYSRDDIQHGTC-SFEIRSPAHT 2252

Query: 2271 IALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQ----KHSPDE 2326
            + + Y +  ++++ H IR L +++ THN L+  CVP+LN++      M++    + S   
Sbjct: 2253 VTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGA 2312

Query: 2327 TPLESSQS-IDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDL 2385
              L S+++ I+Y+ LL++FDIA  +  G+Q++SL+CEP AK+QA +GF+ F   + TN +
Sbjct: 2313 PNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSM 2372

Query: 2386 VDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---VFGVALVSDIN 2442
            V   P  +S+ +  + +S RH+FSRE S+S S+  +      TH +    +G  L+S   
Sbjct: 2373 VPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPL 2432

Query: 2443 VFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDD--------DRKKQTKSMTLSKRTSTPT 2494
             +FN+KQ+++LNLFL+IW +      K ++ +D           +   SM   +R     
Sbjct: 2433 FYFNVKQIEDLNLFLEIWSI-----EKQKSVNDIILAPVTASSFESVPSMPKLQRVPINA 2487

Query: 2495 SICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEG 2554
            +  W + LI + +  ++DLGPSLG++ ++    W  + H     + L     E+ + S G
Sbjct: 2488 TFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSG 2547

Query: 2555 RLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMK 2614
            RL G   +K+  W S++ +P   +  G   + LSL++G    K +FDYHMF I TI    
Sbjct: 2548 RLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAA 2607

Query: 2615 FHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETL 2674
              L ++ D  G L DLL V++S   +    T+L  AN+ DIY+TI RMR D+  + ++ L
Sbjct: 2608 IELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL 2667

Query: 2675 RESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNV--- 2731
             ESN  +   +     +L SL  LRT+LS +       I   +L   EV+VL    V   
Sbjct: 2668 -ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIAN 2726

Query: 2732 ---SARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGG 2788
                A S+T S  K++TEL  Q+ +  +SLS+ K +LDE ++ KI + DY+  AS I GG
Sbjct: 2727 TKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGG 2786

Query: 2789 TIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAV 2848
             I++ P + V+M TWQ   S++IE L++  F + V++ WNL PINFIK+MWS HI ++ +
Sbjct: 2787 IILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKL 2846

Query: 2849 RQTQSNKTMSEKDKQADLDPEEEIKAKLQ---------YVPLDEPYIEMPQIKDLGDATP 2899
            R  Q   +      +  +  +E+I+AKL          Y PL+EP IEMP+IKDLGDATP
Sbjct: 2847 RHMQKGNS-----SEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATP 2901

Query: 2900 PMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            P+EWFG++R R P  THQ+ +V +QKL   AEKEY ++ G+
Sbjct: 2902 PVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILGK 2942

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score = 1400 bits (3623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/3061 (30%), Positives = 1562/3061 (51%), Gaps = 266/3061 (8%)

Query: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60
            M+  S F  +S+S+E++ S  FLVDW+L  ++ +   FYLGR+ A+ +T  L++++W+ +
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120
            K+KI+++S++++ L G I F+NL ++  D TIS L+GS  WRY LL TR           
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIR--------- 111

Query: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180
             G+    ED ++ +N  LPCRF+L C+G E+F+YN+   YE+++    R+      K   
Sbjct: 112  -GIDFESEDGDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL----RDHFTNVTKDGQ 166

Query: 181  KQEMSELFHCHSERSDDKGXXXXXXXXXXXXXPNINDRVFDEVHNQKKSIFMRFLPMELQ 240
            + E ++    ++E++                     D         K S   +  P++L+
Sbjct: 167  ETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDA-------PKLSAKTKLFPIQLE 219

Query: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300
             +R +IVLGN+ T  + +      +GV D+      LD Y+    +D  D    +R N+ 
Sbjct: 220  ANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLG 279

Query: 301  Y---NRKKATFKNGKLSRMWATF------VKVLHIPFYNKSHNNKGTESEPFMTKWKGLG 351
            Y   N  K       + ++W T       +  L +P   K+ NN+    + ++  WKGL 
Sbjct: 280  YQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQ----QAYIDSWKGLD 335

Query: 352  LYKGL-TFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL- 409
            LY        +  D   +H      EYA+ S ++K+ R  LTY +DIPG+VP  +     
Sbjct: 336  LYHHTKAVQEENVDTTVLH----EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINS 391

Query: 410  -----EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKT 464
                 E      +   P FG D+  Y   + YGPWA + +Q ++R+ SP V+R  +    
Sbjct: 392  QSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATK 451

Query: 465  LSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAM 524
              PGS RIY  FK +    D S   IPTRE SKD+EF+K++K T + +R FGWL++    
Sbjct: 452  PEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNE 511

Query: 525  DSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSS 584
                     LC + +  PN++Y+     E  SSVNH+V+ +CN   +  ++GYP GWN  
Sbjct: 512  GGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQ 571

Query: 585  ATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYL 644
            A W   L S   E FLLR+H++L++D+FTDFS+ +   YELFRPF Y+I W+   Y ++L
Sbjct: 572  ADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFL 631

Query: 645  NVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRXXXXX 704
            NVND NI+NN LD NENC+LSL G+ L   +  P  SI     +  + + +P+ +     
Sbjct: 632  NVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHP 691

Query: 705  XXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMR 764
                   EF+     G    F++ G Y  +  +D+DN DT+ ++  S+ T    +GFV+R
Sbjct: 692  PCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLR 751

Query: 765  YLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPY 824
            YLMN+K+NYFGDF HF T+EEY+  +  +E     KT+ ++ ++  TN        S   
Sbjct: 752  YLMNIKLNYFGDFNHFKTTEEYSNDLSMEED---TKTKTKNFQEQPTNDVESLTSSSSDG 808

Query: 825  VRLRADP----PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIV 880
                AD      + +S + RT NETD+W TF V +G +++PE +Y+C     L F  L  
Sbjct: 809  SYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEF 868

Query: 881  DLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMY 940
            D+R  NY+MDL A  S    + Y++  +   F  +        +  G L  L +HGHRM+
Sbjct: 869  DMRYTNYFMDLTAFFS----RIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMF 924

Query: 941  GLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDM 1000
            G+PP+E TY C+W I +  L+ +SD +F   F      +GF Y + EN L+Y +  P+D+
Sbjct: 925  GVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDV 984

Query: 1001 TSXXXXX-XXXXXXXXXXSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSE 1059
            TS                   A + + ++T  S D  N RYS+R+DL V ++S+  +   
Sbjct: 985  TSLTISIGRVSSIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAI--- 1041

Query: 1060 DDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPC-YLQESP 1118
             D +   L    T V LT F+ + +   HR  Q++ + LNDSPF+RC FLL    L  S 
Sbjct: 1042 -DEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHST 1100

Query: 1119 LYKXXXXXXXXXXXXXXXXXXXXAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE 1178
            LY                      +T D I E LLG +   +  D D   T +  D    
Sbjct: 1101 LYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNLTD---- 1156

Query: 1179 SFDTSQEHEGPDDVRYDRFAQ-LPKILSPNPLEQYD--NVIIDVKFLAVDLDPLICSYVD 1235
                    + PDD R    +  +   LS    E+++  N  +++  L+V + P   ++ +
Sbjct: 1157 --------DRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAE 1208

Query: 1236 GLLGEFWKVNTVDIIDEIEMSIVKRL-------GQLWNNTCVL-NLKLYVVDINFFWGDK 1287
                    ++T  I+D  EM+IV          G+ +N++ +L N+K+ + D      DK
Sbjct: 1209 NAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETAL--DK 1266

Query: 1288 NAKVVDLYFDKLDFDLG------------QRTRDLDGETIVSEKITLS-KLRSVRATVFD 1334
                     D+L+  +             Q     +  T +++  T+S    S++  +F 
Sbjct: 1267 TQLEA---LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFK 1323

Query: 1335 RSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLL---STDITVDESQLEWLSVYIA 1391
             S     +  P A    +     ++ +    VG VS L   S    + ++ +EW   Y+ 
Sbjct: 1324 SSKNRLTKVLPIAWFEIL----MFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLL 1379

Query: 1392 EQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQIS---HEPYVITKPAFIMRLS 1448
            +   L K          E  +    D+   I   +E  +IS     PY+ITKPA+I RLS
Sbjct: 1380 K---LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLS 1436

Query: 1449 NGHVRENPSWRIITRLRHILTY-------------LPNEWRNNSAIQVSPTVDSTDASVA 1495
              HVR+  SW+IITRLRH+  +             +P E RN    +      S    + 
Sbjct: 1437 KFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDK------SQFLDIF 1490

Query: 1496 SHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFV 1555
              W+ W++ ++ +S ++ T+  S +S    + L   L +           E   +   + 
Sbjct: 1491 VDWKNWDVYEVEQSSLF-TLLFSGESTVHEEDLFNELSLSL---------EMLHLELPYA 1540

Query: 1556 ITRANIVGEEIPAAELSKVQQA-LDYDNV--------MNLTVSLGAIKGELNDQLLKLRN 1606
              +++I+ ++I          A LD+D +         +L +S   I+  +  QL++   
Sbjct: 1541 PQQSSIIAKQIDLCVKKMSHDAILDFDTMGYDKKEIDFDLLISYADIRASM--QLIERII 1598

Query: 1607 IFSKAQTPALK--RSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLL 1664
            +  +   P +    +KT+  +SK Y+ +  ++             +LT  +L  K  +LL
Sbjct: 1599 LLKQKLFPQITDIENKTNRWVSKIYQTSFRIS-------------QLTLHMLIEKYMMLL 1645

Query: 1665 EKLKNSAA-----PALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLS 1719
            +    S A       ++ +  AK S   L    L L   +SR L   +TA   ++  + +
Sbjct: 1646 DLQDLSIAGLETSSEINSLLSAKFSSETLSFNLLYLDRIISRILLEKVTA---NFFGTEN 1702

Query: 1720 INIQCSNSHIRA-------MTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNL 1772
             NI+   S+I +       +T TE++ ++ + ++ SI ++K        TP+      N 
Sbjct: 1703 ENIRFFTSNIGSVVLDSSDLTLTEMMKHA-RALLASIDDMK------AITPDHDSEKKNG 1755

Query: 1773 SIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKS 1832
             + L    L++    +  +     PF++R  +  L      +    I+++  +  +    
Sbjct: 1756 HVDLV-WVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYF 1814

Query: 1833 HQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIG 1892
            +Q      + ++  +  + N     + + ++GL T ++KLTLS+ R  +      E+L  
Sbjct: 1815 NQLKLLRISNSVTKVDYRSN-----TLLTDIGLDTDIVKLTLSDNRVYI------EELTD 1863

Query: 1893 ESLGYIKGLLQLF-SPLARNKTQSSALR-WSLDANLNYFGILVPMASTFFVFEIHMLLAA 1950
               G +  L+++F +  A N+  +   +  S   N  Y G+L  + +T +V E +    +
Sbjct: 1864 SLNGTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFS 1923

Query: 1951 MNNASDGQDE---GDHHVTGQVSIENCLLLIKEPSLPADLSKLLD--FSIRVMSSQKVPN 2005
              + ++  +E    D+     + I+N  +L+  P +   LSK+ D  F+++++      +
Sbjct: 1924 CASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED----D 1979

Query: 2006 SPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASA 2065
              ++ QIE+ H RV L+P +L+ V++   + +  L+  ++  K          F+ S++A
Sbjct: 1980 IKKTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGK----------FNSSSNA 2029

Query: 2066 DR---QIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYF 2122
                   +  S++ILS  LC+GW+F+   D + G++IG++ LF+AYEK YGKLT++DGY 
Sbjct: 2030 IEIPPYFETLSVNILSNKLCLGWIFEEDTD-ENGIVIGYESLFAAYEKPYGKLTIVDGYV 2088

Query: 2123 SVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSN 2182
            + A G+ ++ F+      +  NRS LS++QI +W       KDLF+R+N + L+V +L+ 
Sbjct: 2089 ATAQGKESNNFFFANGVPE-LNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTT 2147

Query: 2183 SFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNISPFLS--HIRTIDCQFK 2240
            S +I+    +SI+ FQ    +++ K  +  ++ ++  N + N+S  +S   IR+I+C  K
Sbjct: 2148 SVEIVNVMRSSIESFQ----KKLAKISNIKKSSISTHNVAENLSDKVSILSIRSINCIAK 2203

Query: 2241 YVGGVLKIYSLDDLNR-AEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNI 2299
            Y GG++ +Y+ DD+ + +   SLE+ SP + ++L Y HN   ++ H IR LV+++ THNI
Sbjct: 2204 YGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNI 2263

Query: 2300 LYSQCVPILNDIVEASQRMVQK---------HSPDETPLESSQ-SIDYKSLLDSFDIAFK 2349
            L+S CVP+L ++    Q+ +++         H   E    + + S DYK+L    D A  
Sbjct: 2264 LFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIV 2323

Query: 2350 VTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFS 2409
            +  G Q ++L+CEPRAK+QAD+GF +F   + T+      P  +SL   +I+ S RHIFS
Sbjct: 2324 INVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFS 2383

Query: 2410 RETSASFSVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKL 2466
            RE S+S  ++ V    + TH +    +G  L+SD+  + NMKQLQ + LFLDIW    K 
Sbjct: 2384 REISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKK 2443

Query: 2467 NNK-GRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLS 2525
              K G      +K Q +++T     +TP  I W + +IF N    +D+ PSLG ++ ++ 
Sbjct: 2444 AQKLGSGPHSGQKCQPQALT---EFTTP-KIPWIYQIIFKNTSAVIDMDPSLGSINFKVP 2499

Query: 2526 RTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEM 2585
              W ++ H       +  + DEL+ KS+GRL G+F++KN  + S +++P   +   +  +
Sbjct: 2500 TFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLI 2559

Query: 2586 SLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCAT 2645
            +L+  +  ++ K  FDYH FLI  + +++  +R+E D  G+L DLL+V++S   ++   T
Sbjct: 2560 NLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLT 2619

Query: 2646 ALTAANILDIYNTITRMRQDNRISYIETLRESN-STEARVTLLYDDILQSLNLLRTDLSF 2704
            AL +AN+ DIY T  RMR +N+ SY++TL+ESN  +  ++    +++L  L L RT+L+ 
Sbjct: 2620 ALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTA 2678

Query: 2705 DITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEE 2764
            +I +F+  + P +LFD EVLVL  + ++  + TQ+ +K KT+L  Q+ +  +SL+  K E
Sbjct: 2679 EIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNE 2738

Query: 2765 LDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQK-PKSDLIEYLFTCRFFDRV 2823
            L EE+ A++S+E+Y   A+ + G  I+  P + V +TTWQK P +D IE+L++  F D+V
Sbjct: 2739 LTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTD-IEFLYSSSFGDKV 2797

Query: 2824 AVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIK-----AKLQY 2878
             +KWNL PINFI+EMW+TH+++L+VR+  +  + S K    D +  E+IK      K +Y
Sbjct: 2798 DIKWNLDPINFIREMWATHVRALSVRRGHTEPSPS-KPFFEDENIAEKIKIVNLGTKYKY 2856

Query: 2879 VPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQ 2938
            +PL+EP+IEMP ++DLG+ATPP+EWFGV+RKR P   HQL +V +QKL++ AE +Y +  
Sbjct: 2857 IPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTL 2916

Query: 2939 G 2939
            G
Sbjct: 2917 G 2917

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1537 (31%), Positives = 744/1537 (48%), Gaps = 133/1537 (8%)

Query: 32   VTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKISVESLRIAPLSGSILFRNLCIIGKDQT 91
            + +  IFY+GR+  Y ++      LWK ++V +S++SL  +PL+G + F+N+ +  +DQ 
Sbjct: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 92   ISILKGSLRWRYRLLATRRSQYEEASSQKDGLGVGEEDVNSMKNITLPCRFVLFCEGFEI 151
            IS+LKG++ WRY L+   R      S   DG                 CRF L  EGFE 
Sbjct: 61   ISVLKGTITWRYWLIGRYRR-----SGTADG--------------ARRCRFALKFEGFEY 101

Query: 152  FIYNRTVAYENIIQMFSREERVQFEKFMSKQEMSELFHCHSERSDDKGXXXXXXXXXXXX 211
            F+YNR   Y+ I +    E+    E  +S   + E+    +E  DD              
Sbjct: 102  FVYNRNGVYDRIARELDGED-TSAEPTVSVPSVEEVI---AELQDDP------------- 144

Query: 212  XPNINDRVFDEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLC 271
                              +  RFLP+E   ++G+IVLGNK T S+ I +     G V + 
Sbjct: 145  ------------------LIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIE 186

Query: 272  QPKEKLDLYKMHFQVDFIDIDISIRQNIEY---NRKKATFKNGKLSRMWATFVKVLHIPF 328
             P +         +    +  ++I+ NI Y   N  K   +  + +R+W  +  +L    
Sbjct: 187  VPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVL 246

Query: 329  YNKSHNNKGTE---SEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIK 385
                H  +  E   +  +   W+GL +Y     + D E  +EV FD  +HEYAK + ++K
Sbjct: 247  EATLHAKRKKEQHQTPKWYDNWRGLSMYD---VNLDEELDEEVKFDIEHHEYAKCTTVLK 303

Query: 386  SPRTVLTYSYDIPGVV-----PHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWA 440
            + +  +TYSY +PG        +  +P LE PE+ ++       +D+  Y     YGPWA
Sbjct: 304  ADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHS-------VDILVYDANCTYGPWA 356

Query: 441  QREIQHLLRMISPTVARSSVPIKTLSP---GSRRIYTVFKTTFRVLDGSSWRIPTRERSK 497
             R++Q  LR+ SPTV R+    K  +P     +     FK +  +++ S  R+P +E SK
Sbjct: 357  NRQVQQCLRVFSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSK 413

Query: 498  DQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSS 557
            D  FL+K+K T +E RPFGW+D++ A +S  +V     P E GF N ++ +  +   ++S
Sbjct: 414  DAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTS 473

Query: 558  VNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSS 617
            VNHD +LK    D+  D  YP GW   A W  N+ STQ E F+LR+HV L++D+ TDFS 
Sbjct: 474  VNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSG 533

Query: 618  GEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTA 677
            GE   YE FRPF Y+  W I GYS YLNVND NI+NNP+DF ENCYLS+HG++  I  + 
Sbjct: 534  GEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSL 593

Query: 678  PNDSITGAYMDVPYKISTPMFRXXXXXXXXXXXXEFMKNKEVGRSYSFAVCGLYTVYSEL 737
            P  SI   Y+ V + I TP F             E +  KE+GRS +F + G YT YSE+
Sbjct: 594  PITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEV 653

Query: 738  DIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKES 797
            D+DNVD L++ C +    + CYG +++ ++NVK+NYFG+  HF T+EEY   ++ + K++
Sbjct: 654  DVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQN 713

Query: 798  VGKTEEESLRDN---STNLSTDSGGLSDPYVRLRADPP-VSRSDVKRTTNETDIWFTFSV 853
                   +   N   S  ++T+S  + D        PP + +S +KR+ NE D+WFTF  
Sbjct: 714  PSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFIS 773

Query: 854  WEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFE 913
              G    PE IY  D C+  +F  L   LR  NYY+D   ++ S   KR+    +  LF+
Sbjct: 774  KGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFK 833

Query: 914  SIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFF 973
             I       +     L+  +   H+M G+ P E +Y C++ + +D L ++ D    K F 
Sbjct: 834  VIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFV 893

Query: 974  TLFAGIGFGYTNLENTLLYDVETPDDMTSXXXXXXXXXXXXXXXSSRAVV----DVPNLT 1029
                 + FG+ ++EN+L Y+ E   D+                      +    ++P  T
Sbjct: 894  NTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTT 953

Query: 1030 FTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHR 1089
             TS D  NERYS+R DL +P L  L      DSE   L   +T V +T F +   FA+ R
Sbjct: 954  LTSFDLANERYSRRSDLSIPEL--LFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCR 1011

Query: 1090 SKQRDYITLNDSPFYRCSFLLPCYLQESPLYKXXXXXXXXXXXXXXXXXXXXAETIDFII 1149
              QR +I +ND+PF+RCSF+LP   ++ P+Y+                    A+  + I 
Sbjct: 1012 VLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIF 1071

Query: 1150 EDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPL 1209
            E LLGE       D   Q T DD  S +E    +Q            F     I S N  
Sbjct: 1072 EKLLGEIYQEYASDSSYQIT-DDSISSTEHDYHNQTVNAAIGTSSSLF-----IRSQNHQ 1125

Query: 1210 EQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWN-NT 1268
            +   + I++   +   LD     ++  +     +V+  + ID +E+ I+ +  Q +  + 
Sbjct: 1126 QTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDN 1185

Query: 1269 CVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVS----------E 1318
             +  +++   +I+    +K +K          F L  + ++LD  + +           E
Sbjct: 1186 GISEVRVLCPNISLSATNKQSKFS-------MFKLSSKIKNLDITSRIKSSDPNLKPDPE 1238

Query: 1319 KITLS-KLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDIT 1377
            K TL  K+  +RA +    I    ++     S ++E  E Y    +  +   ++ S  +T
Sbjct: 1239 KTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVT 1298

Query: 1378 V----DESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISH 1433
            +    D+   E+L+ +I+   DL++  L+SF    +    ++R+ L +I      Y+I H
Sbjct: 1299 LSPGTDKLLFEFLNPFIS-TFDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQH 1354

Query: 1434 EPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDA- 1492
            +P VITKPA I R SN H+R   SWRII RLRHIL YLP EW  +    +  T D T   
Sbjct: 1355 DPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLG-TQDFTSPE 1413

Query: 1493 -------SVASHWRRWEISDITRSYIYRTIFLSDQSK 1522
                   S+ S WR WE +D+  S+++  +F   +S+
Sbjct: 1414 EAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSR 1450

 Score =  598 bits (1543), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 408/1298 (31%), Positives = 664/1298 (51%), Gaps = 97/1298 (7%)

Query: 1703 LSLTMTAELWSYMPS---LSINIQCSNSHIRAMTST-ELLVNSIKQIMESISELKRHFAM 1758
            + + M + L  Y+P     SI+ +    HI + ++T + L  S+  + + I  L      
Sbjct: 1625 IDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVP 1684

Query: 1759 EK-TTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSN 1817
            E    P ++  S+   I           +++T +L  L+PF++ +  +   L      S 
Sbjct: 1685 ELFAEPPIERESSGNKI--HAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSV 1742

Query: 1818 EILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAIL--NVGLSTSLMKLTLS 1875
               ++  ++ + + S +    YF +    L++     T SSA L  ++     ++KL++ 
Sbjct: 1743 IFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSG---TSSSARLFEHISCDIGILKLSVF 1799

Query: 1876 EPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSALRW------SLDANLNYF 1929
            + +  ++  LQD   I  +L  +K L  + +    + T S+   W      +L     Y 
Sbjct: 1800 DLKTRITDLLQD---IKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYA 1856

Query: 1930 GILVPMASTFFVFEIHMLLAAMNNASDGQDEG---------DHHVTGQVSIENCLLLIKE 1980
            G+L+    T ++ E +   A   +  DG  +          DH      SIE+   LIK+
Sbjct: 1857 GLLLGFGHTLYILEFNNFEA--KHTRDGLPDAITPRPCFKVDH------SIESASFLIKD 1908

Query: 1981 PSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLL 2040
              +   L+K++DF++            QS QIES+H ++ L+P ++V++L       SL+
Sbjct: 1909 RRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL-------SLI 1961

Query: 2041 EYF---RKHRKQDKAISPFSLFDGSASADR------QIDFRSIHILSYNLCIGWMFQLGD 2091
              F   RK   ++   +P S  + S + +       ++  +S HILS++  I W+F + +
Sbjct: 1962 NEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPN 2021

Query: 2092 DVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDT-FYSQGSEKQRYNRSFLSN 2150
                GLI G+DRLFS YEK YGKLTL++ YFS A   +++  FYS    KQR N S+LS+
Sbjct: 2022 SSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSD 2081

Query: 2151 VQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKE-----RM 2205
            +Q+ YW  E     DLFIR++G  L V + +    ++E T+ SIQ F  LKK      R 
Sbjct: 2082 MQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRT 2141

Query: 2206 HKRDSG-PRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEI 2264
             K+DS   +   N  N         + +R+++C   Y G  LK++S D   R +   LE+
Sbjct: 2142 KKQDSDISKEPYNWNNQ------LATGVRSLNCIINYAGVTLKLHSHD--GRGDASPLEL 2193

Query: 2265 KSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSP 2324
             SP   +A+ Y +     + HR R L++  PTHN  YS    +++D+     ++++  S 
Sbjct: 2194 TSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSST 2253

Query: 2325 DETPLESS-------QSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFT 2377
            +     +S       +  D  +LL S D+   +  G+Q+++ SCEP+AKVQA VGF+ F 
Sbjct: 2254 ENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFD 2313

Query: 2378 FGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDV---FG 2434
              +  N++ D     +++ +E + ++ RHI+SRE  AS  +  +          V   +G
Sbjct: 2314 IKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYG 2373

Query: 2435 VALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKD----DDRKKQTKSMTLSKRT 2490
              L+S    +FNMKQLQ+L LF+D W       N G   +    DD  +   S     + 
Sbjct: 2374 STLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRSIGSKFY--KG 2431

Query: 2491 STPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSI 2550
            S+ +S  W +++I      +++LGPSLGVL++     W  +       + L     +L +
Sbjct: 2432 SSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDV 2491

Query: 2551 KSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTI 2610
             S GRL G F ++NA    E+ +P          + + L    V  K +FDYH F I ++
Sbjct: 2492 TSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSL 2551

Query: 2611 DEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISY 2670
             +    L +E D  G L DLL V +S + ++   TAL AANI DI N+ITR+++DN +SY
Sbjct: 2552 KQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSY 2611

Query: 2671 IETLRESN--STEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNI 2728
            + +   S+  S E         I  +L+LLRT LS ++  F+ QISP SLFD +VL+L  
Sbjct: 2612 LSSFLASDQPSDEPEED---GGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTA 2668

Query: 2729 DNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGG 2788
              + A +  Q+  K+KT+LH Q+ +  ++L      LDE  +A + +  Y+  +S I GG
Sbjct: 2669 TKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGG 2728

Query: 2789 TIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAV 2848
             I   P ++V+MTTWQ+P+S++IE L++  F   V ++WNLGPI+FIK+MW  H+ ++ +
Sbjct: 2729 AIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQL 2788

Query: 2849 RQ------TQSNKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPME 2902
            R+       +S   ++  + +A +  E  + +  QY+PL EP IEMP+IKDLGDATPP+E
Sbjct: 2789 REGYYHGLAESGVAVTPLNSKA-VPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIE 2847

Query: 2903 WFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940
            WFGV+R + P  THQ  IV +QKL   AEKEY K+ GR
Sbjct: 2848 WFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGR 2885

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%)

Query: 5  SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64
          S+F RV +S  ++FSWVFL DWVL+  V+L   FY GR+  Y IT +LE+  WK + VK+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>Kpol_1060.23 s1060 (57472..61314) [3843 bp, 1280 aa] {ON}
            (57472..61314) [3843 nt, 1281 aa]
          Length = 1280

 Score = 37.7 bits (86), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 7/110 (6%)

Query: 1219 VKFLAVDLDPLICSY-VDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNTCVLNLKLYV 1277
            +K+   D DP +C    D              I E  ++IVK +  L N+      +LY 
Sbjct: 907  LKYFNEDFDPSLCEKNCDNCKNSGSTYMEEREITEEAIAIVKLVKYLKNDKVT---RLYC 963

Query: 1278 VDINFFWGDKNAKVVDLYFDKLD-FDLGQRTRDLDGETIVSEKITLSKLR 1326
             DI  F G +NAK+V L  D+L+   LG+     D E I S+ ITL  L+
Sbjct: 964  QDI--FKGSRNAKIVQLGHDRLETHGLGKAFSKSDLERIFSQLITLRILQ 1011

>ZYRO0E03014g Chr5 (230333..233779) [3447 bp, 1148 aa] {ON} similar to
            uniprot|P47108 Saccharomyces cerevisiae YJR041C URB2
            Nucleolar protein required for normal metabolism of the
            rRNA primary transcript proposed to be involved in
            ribosome biogenesis
          Length = 1148

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 24/114 (21%)

Query: 1507 TRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEG--YRVAHNFVITRANIVGE 1564
            T S +YR+I      KT  + ++K L  +    + T Y++   Y  AH  V+   +I  E
Sbjct: 797  TVSNLYRSI------KTSDKEMQKKLLTNIFLLYSTTYADKLEYLYAHYMVLRNCDIESE 850

Query: 1565 EI-PAAE----------LSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNI 1607
            EI PA E          L +  QA       NLT SLG+ K   N+ LL+L  +
Sbjct: 851  EILPAIEDVLSDSSKTNLVEFNQAF-----ANLTFSLGSCKSNFNEGLLELYRV 899

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 24/113 (21%)

Query: 1436 YVITKPAFIMRLSNGHVREN----------------PSWRIITRLRHILTYLPNEWRNNS 1479
            Y    PA  M   NG  REN                PSW + T L  +L+++     + S
Sbjct: 64   YPFNPPAIRMLTPNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTT---DES 120

Query: 1480 AIQVSPTVDSTDASVASHWRRWEISDITRSYIYRTIF--LSDQSKTQCQSLKK 1530
            +I    T++STD++   +  + +  + TRS I+  IF  L++Q++   +  KK
Sbjct: 121  SIG---TMESTDSTKRKYAAKSKEHNATRSPIFCQIFPELAEQNRRDIEEAKK 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 303,702,372
Number of extensions: 13454897
Number of successful extensions: 39022
Number of sequences better than 10.0: 42
Number of HSP's gapped: 39217
Number of HSP's successfully gapped: 49
Length of query: 2942
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2814
Effective length of database: 38,804,151
Effective search space: 109194880914
Effective search space used: 109194880914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)