Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038608.259ON1399139967830.0
Suva_10.1708.259ON1416142338070.0
YLR086W (SMC4)8.259ON1418142638020.0
ZYRO0C01716g8.259ON1413141038010.0
Skud_12.1548.259ON1417143537890.0
NCAS0B050008.259ON1409141237840.0
Smik_12.1458.259ON1418141937760.0
KAFR0B027108.259ON1416141936930.0
SAKL0H17094g8.259ON1422142836450.0
Kpol_392.88.259ON1427144336320.0
KLTH0G13750g8.259ON1399141035090.0
KNAG0G020208.259ON1444137734350.0
AGR089C8.259ON1370133434210.0
NDAI0B019708.259ON1415141934090.0
Kwal_56.238258.259ON1396138633920.0
Ecym_43118.259ON1376136533600.0
TBLA0E044108.259ON1422137233490.0
TPHA0J007208.259ON1393140932560.0
KLLA0F19085g8.259ON1372140431140.0
CAGL0L12188g8.259ON1398141530370.0
CAGL0F02079g8.68ON122313455583e-57
KLTH0A02706g8.68ON12282203601e-33
NDAI0G033208.68ON12311643565e-33
Kwal_23.50438.68ON12251713556e-33
KAFR0C032008.68ON12231533521e-32
Suva_6.528.68ON12641633521e-32
TPHA0P003408.68ON12191533502e-32
Skud_6.648.68ON12301633484e-32
Smik_6.718.68ON12281533467e-32
SAKL0B02288g8.68ON12281703459e-32
Kpol_1011.58.68ON12211543403e-31
TBLA0G035308.68ON12321673342e-30
YFL008W (SMC1)8.68ON12253963296e-30
TDEL0C009608.68ON12221583296e-30
NCAS0C040008.68ON12237173252e-29
ZYRO0F03828g8.68ON12171533215e-29
AGL023W8.68ON12221823207e-29
KLLA0D07502g8.68ON12438153082e-27
Ecym_73038.68ON12226992813e-24
KNAG0G009108.68ON12262022421e-19
ZYRO0D15642g7.186ON11701592392e-19
TDEL0H026107.186ON11701622357e-19
KAFR0G029307.186ON11701612359e-19
Skud_6.1197.186ON11701612322e-18
AGR236W7.186ON11701592322e-18
CAGL0D05258g7.186ON11701612303e-18
Suva_6.1047.186ON11701612303e-18
YFR031C (SMC2)7.186ON11701612294e-18
Kpol_1063.207.186ON11711612285e-18
SAKL0F07282g7.186ON11701612261e-17
Smik_7.3467.186ON11701612241e-17
NDAI0G020707.186ON11711622241e-17
KLTH0E04774g7.186ON11701592232e-17
Kwal_55.204217.186ON11701612232e-17
KNAG0L011607.186ON11701612187e-17
NCAS0E019207.186ON11701612171e-16
TPHA0C044407.186ON11701612143e-16
TBLA0D046107.186ON11741602133e-16
KLLA0D16005g7.186ON11701622133e-16
Kpol_1018.21.295ON12112102124e-16
ZYRO0G21296g1.295ON12274112053e-15
KAFR0A016101.295ON1227992026e-15
Kwal_14.24351.295ON1247982018e-15
SAKL0D06116g1.295ON12291192001e-14
Suva_6.1491.295ON12307181992e-14
KLTH0H09966g1.295ON1224971963e-14
KNAG0B052301.295ON1225981938e-14
NCAS0A093301.295ON12271061928e-14
Skud_10.1701.295ON12307101911e-13
TDEL0D016201.295ON12237191902e-13
CAGL0H02805g1.295ON12192371892e-13
NDAI0G056301.295ON1229951883e-13
Smik_10.1671.295ON12292231874e-13
TPHA0I010901.295ON1216951822e-12
YJL074C (SMC3)1.295ON1230951812e-12
Ecym_63221.295ON12321031802e-12
TBLA0C027401.295ON11191521793e-12
AAL182W1.295ON12311021751e-11
Ecym_43907.186ON1170961678e-11
KLLA0A00286g1.295ON1224721642e-10
ZYRO0G01584g7.101ON10881631338e-07
Skud_15.1217.101ON10931641273e-06
KNAG0L006307.101ON11081591275e-06
YOL034W (SMC5)7.101ON10931631175e-05
KLTH0D02816g7.101ON10941651167e-05
Suva_15.1337.101ON10921631132e-04
KLLA0F07997g7.101ON11191641132e-04
Kwal_26.72047.101ON11171601132e-04
TDEL0E013404.237ON1106851113e-04
Smik_15.1317.101ON10931581096e-04
NCAS0I005707.101ON10951661040.002
ZYRO0B12122g4.237ON1109781020.003
KAFR0D013307.101ON10801591020.003
Kpol_1044.137.101ON11031891010.005
SAKL0B09526g7.101ON10992201000.005
NDAI0A084507.101ON1119417980.011
TDEL0H034907.101ON110385960.017
TBLA0E021907.101ON1089184960.019
NCAS0J013904.237ON109668960.019
Ecym_26257.101ON1097189960.019
CAGL0H05071g4.237ON111076950.022
NCAS0G002305.702ON1735219950.022
TPHA0B008404.237ON111968950.023
Skud_12.4684.237ON112068950.025
YLR383W (SMC6)4.237ON111468950.026
Smik_12.4704.237ON111468940.027
NDAI0J021804.237ON1108107940.027
KNAG0B060104.237ON1117101940.027
Suva_10.5004.237ON111568940.028
KLLA0E05303g4.237ON109892940.029
TPHA0L006007.101ON111762930.038
TBLA0A053001.67ON70763890.096
TBLA0I028904.237ON109871880.15
AEL337C7.101ON1097162860.25
CAGL0F01155g7.101ON110564850.31
SAKL0H03322g4.237ON111147850.31
Kwal_26.93804.237ON110285850.34
KLTH0D14080g4.237ON110267840.46
YNL247W1.115ON767163830.53
TDEL0G028102.351ON109471830.55
NCAS0B087001.67ON71572820.64
KAFR0A060404.237ON110268811.0
AER044W4.237ON110352782.1
Smik_10.4274.364ON706113782.4
KLTH0E01056g5.702ON1771200773.1
Ecym_53444.237ON110247773.2
Kpol_483.104.237ON111864773.3
Skud_16.3363.330ON118089763.9
SAKL0H08294g8.609ON462115744.9
AFR637W1.110ON1296195755.7
NDAI0D044204.238ON1914167747.2
YDR356W (SPC110)5.414ON94493747.4
Kpol_1039.282.259ON39937737.5
TDEL0C041902.203ON10444678.1
AFR683C1.67ON67782738.8
CAGL0M00462g4.364ON611133729.7
Ecym_20615.88ON1362185739.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03860
         (1399 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  2617   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1471   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1469   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1468   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1464   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1462   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1459   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1427   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1408   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1403   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1356   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1327   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1322   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1317   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1311   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1298   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1294   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1258   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1204   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1174   0.0  
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   219   3e-57
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   143   1e-33
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             141   5e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   141   6e-33
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   140   1e-32
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   140   1e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   139   2e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   138   4e-32
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   137   7e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   137   9e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   135   3e-31
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   133   2e-30
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   131   6e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   131   6e-30
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   129   2e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   128   5e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   127   7e-29
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   123   2e-27
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   112   3e-24
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    98   1e-19
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    97   2e-19
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    95   7e-19
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    95   9e-19
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    94   2e-18
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    94   2e-18
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    93   3e-18
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    93   3e-18
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    93   4e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    92   5e-18
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    92   1e-17
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    91   1e-17
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    91   1e-17
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    91   2e-17
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    91   2e-17
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    89   7e-17
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    88   1e-16
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    87   3e-16
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    87   3e-16
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    87   3e-16
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    86   4e-16
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    84   3e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    82   6e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    82   8e-15
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    82   1e-14
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    81   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   3e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    79   8e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    79   8e-14
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    78   1e-13
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    78   2e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    77   2e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    77   3e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   4e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   2e-12
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    74   2e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   2e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    74   3e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   1e-11
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    69   8e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    68   2e-10
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    56   8e-07
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    54   3e-06
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    54   5e-06
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    50   5e-05
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    49   7e-05
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    48   2e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    48   2e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    47   6e-04
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.003
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    44   0.005
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    43   0.005
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.011
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    42   0.017
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    42   0.019
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.019
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    42   0.019
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    41   0.022
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    41   0.022
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    41   0.023
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    41   0.025
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.026
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.027
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.027
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.027
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.028
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    41   0.029
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.038
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.096
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.15 
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    38   0.25 
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    37   0.31 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    37   0.31 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.34 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.46 
YNL247W Chr14 (182875..185178) [2304 bp, 767 aa] {ON} Cysteinyl-...    37   0.53 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.55 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    36   0.64 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   1.0  
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   2.1  
Smik_10.427 Chr10 complement(662836..664956) [2121 bp, 706 aa] {...    35   2.4  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...    34   3.1  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    34   3.2  
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    34   3.3  
Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa] ...    34   3.9  
SAKL0H08294g Chr8 (713096..714484) [1389 bp, 462 aa] {ON} simila...    33   4.9  
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    33   5.7  
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    33   7.2  
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    33   7.4  
Kpol_1039.28 s1039 (88670..89869) [1200 bp, 399 aa] {ON} (88670....    33   7.5  
TDEL0C04190 Chr3 (748567..748881) [315 bp, 104 aa] {ON} Anc_2.20...    30   8.1  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   8.8  
CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar...    32   9.7  
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    33   9.8  

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 2617 bits (6783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1298/1399 (92%), Positives = 1298/1399 (92%)

Query: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTXXXXX 60
            MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTT     
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTSQSQP 60

Query: 61   XXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXXKLELIKISPVKKNRLELQR 120
                    APSLQHPNSSSRGREQRTY              KLELIKISPVKKNRLELQR
Sbjct: 61   IVSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTRKLELIKISPVKKNRLELQR 120

Query: 121  LYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLF 180
            LYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLF
Sbjct: 121  LYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLF 180

Query: 181  VFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTR 240
            VFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTR
Sbjct: 181  VFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTR 240

Query: 241  KAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXX 300
            KAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKA     
Sbjct: 241  KAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAEKEGE 300

Query: 301  XXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXXXX 360
                     ITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKD    
Sbjct: 301  DGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDEALE 360

Query: 361  XXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKD 420
                       RSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKD
Sbjct: 361  FLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKD 420

Query: 421  ESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNA 480
            ESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNA
Sbjct: 421  ESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNA 480

Query: 481  TEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEP 540
            TEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEP
Sbjct: 481  TEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEP 540

Query: 541  WDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQE 600
            WDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQE
Sbjct: 541  WDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQE 600

Query: 601  ESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQ 660
            ESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQ
Sbjct: 601  ESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQ 660

Query: 661  KSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYAR 720
            KSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYAR
Sbjct: 661  KSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYAR 720

Query: 721  FILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAY 780
            FILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAY
Sbjct: 721  FILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAY 780

Query: 781  GKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTE 840
            GKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTE
Sbjct: 781  GKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTE 840

Query: 841  KEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXXXXXXXX 900
            KEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMS               
Sbjct: 841  KEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEKLLLERLEA 900

Query: 901  XXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSK 960
               ATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSK
Sbjct: 901  QKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSK 960

Query: 961  VTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLKENADNV 1020
            VTSTIQRMEILT             ENELKKSAKIVGNTQKDLDLYSQEIASLKENADNV
Sbjct: 961  VTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIASLKENADNV 1020

Query: 1021 QQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALL 1080
            QQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALL
Sbjct: 1021 QQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALL 1080

Query: 1081 GHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTEGADATRQXXX 1140
            GHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTEGADATRQ   
Sbjct: 1081 GHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTEGADATRQEGE 1140

Query: 1141 XXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVN 1200
                       NDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVN
Sbjct: 1141 ESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVN 1200

Query: 1201 VDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLK 1260
            VDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLK
Sbjct: 1201 VDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLK 1260

Query: 1261 EMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFAL 1320
            EMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFAL
Sbjct: 1261 EMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFAL 1320

Query: 1321 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 1380
            HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK
Sbjct: 1321 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 1380

Query: 1381 TQNMTKSASLKNNDILNRT 1399
            TQNMTKSASLKNNDILNRT
Sbjct: 1381 TQNMTKSASLKNNDILNRT 1399

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1471 bits (3807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/1423 (54%), Positives = 1001/1423 (70%), Gaps = 33/1423 (2%)

Query: 1    MPDTPLTKRQRVNDNESREFEAVNG--------------STKSP----LTSNSNSTISHT 42
            M D+PL+KRQ+    E  E    +G              + K+P    L+  S+   SHT
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 43   PKKLVIGTNDD-TTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXX 101
            P+KLV+ + ++                 P+LQ P + SRGR+ + Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 102  KLELIKISPVKKNRLELQRLYDAEQ-SQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
            +LEL+++SPVK +R+ELQ+LYD+ Q S     RL I+KLVL++FKSYAG+QVVGPFH+SF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL+SCSV VHF+YVV
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            DEP GT+RIDEEKP LV+TRKAF+NNSSKYY+N KESNYT+VT+LLK EGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVENIAQM+ KA              I GTA YKP IE  L +IE LNE C+EKENR
Sbjct: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F IV++EK+SLE+GK+               +SK+ Q+K+ Q++ KL STL+K+S L   
Sbjct: 361  FEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKD 420

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
             + E +K+ E+LKEVD ++ + K++  R+ + A +EK L  +KR L+  RV++EE+ K++
Sbjct: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
              K  KAEK+LKS  HS++  E  L EL   Q ++E E++DLNQ L  ER  L+D+K+SL
Sbjct: 481  VNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSL 540

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            K+KT +ISA I Q+EKDLEPWD QLQ+K+++IQLAESELSLL++T  ++ K+ E L+  I
Sbjct: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENI 600

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
            A     K   +  I +LK+    +         + S+A  +LK+M  IL A RQR ++AR
Sbjct: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
            ++ S A+NKS VLTAL++LQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV++
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VEC Q CI+YLRKNKLGYARFILLD+LR+F+   + TPENVPRLFDLVKPKD KF  AFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVLRDTL A+ L QAN VAYGK+RFRVV++DGKLIDISGTMSGGG+HVV+GLMR+ +N S
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
               D ++PEEV ++ENEL+E+EK+F++A+DT  EME +LKK++D+ P+++ ++ +  ME 
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940
            +S  S                  +     +       ++ L+ E   L  +T T +++I 
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQ 1000
             L+D+IM+IGG+ LQIQNSKV S  QR++IL                ++ K  K + N +
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060
            +D++L S E+  ++E ++ ++  L   +  V    +L  ++ E+ +QLK+++A+ME    
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKM 1120
            EFKSL++E+ +KLEKLN+LL +I  +++Q E +LN L IRDVT TL +LD      N++M
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILD------NNQM 1134

Query: 1121 PNELQEKRTEGADATRQXXXXXXXXXXXXXX---NDE--VMEVDEKPHELENGLPRVSEA 1175
              ++ +K  E    T Q                 ND+   M +DE   E+  G+PR+SE 
Sbjct: 1135 --DILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSED 1192

Query: 1176 ELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMRE 1235
            ELK L++E L   I +L  Y+D+ NVD+ +LEEYA+RLAE KRRK+DLN+AV +RD ++E
Sbjct: 1193 ELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKE 1252

Query: 1236 KLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1295
            +L  LKK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK
Sbjct: 1253 QLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1312

Query: 1296 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1355
            KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK
Sbjct: 1313 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1372

Query: 1356 NAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398
            NAQFIVISLRNNMFELAQQLVG+YK  N TKS ++KN DILNR
Sbjct: 1373 NAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1469 bits (3802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1426 (53%), Positives = 1006/1426 (70%), Gaps = 35/1426 (2%)

Query: 1    MPDTPLTKRQRVNDNESREFEA--------------VNGSTKSPLTS----NSNSTISHT 42
            M D+PL+KRQ+    +  E                 VN S  +P        ++ + S+T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 43   PKKLVIGTNDD-TTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXX 101
            P+KLV+ + ++                 P+LQ P +SSRGR+ ++Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR 120

Query: 102  KLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
            +LEL+++SPVK +R+ELQ++YD  QS  +  +RL IN+LVL++FKSYAG+QVVGPFH+SF
Sbjct: 121  RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L+SCSV VHFQYV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            DE  GT+RIDEEKP L++TRKAFKNNSSKYY+N+KES+YTEVT+LLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVENIAQM+PKA              I GTA YKP IE  + +IE LNE C+EKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F IVD+EK+SLE+GK+               RSK+ Q+K+ Q++ KL STL+K S     
Sbjct: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
            L+ E  K+ E+LK+VD +K + K++  RI + + +EK L+ ++R L+  RV++EE+ K++
Sbjct: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
              K  KAEK LKS +HS++  E  L ELR  Q ++E E++DL Q L  ER+ L+D+K+SL
Sbjct: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            K+KT NISA I ++EK+LEPWD QLQ+K ++IQLAESELSLL++T A++ K++E L+ +I
Sbjct: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
                  K   + +I +LK++ + +  E        +SA  +LK+M ++L A RQR ++AR
Sbjct: 601  LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
            ++ S AQNKS VLTAL++LQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV++
Sbjct: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VEC Q CI+YLRKNKLGYARFILLD+LR+F+   I TPENVPRLFDLVKPK+ KF  AFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVLRDTL AQ+L QAN VAYGKKRFRVV++DGKLIDISGTMSGGG+HV +GLM+L  N S
Sbjct: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
               D ++PEEV ++E EL+E+E +F++ASDT  EME++LKKL+D  P+++ ++SK  ME 
Sbjct: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940
            +S  S                  A     +  +    ++ L+ E   L  +T T ++KI 
Sbjct: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960

Query: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQ 1000
             L+D+IM+IGG +LQ+QNSKV S  Q+++IL                ++ K  K++ N++
Sbjct: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE 1020

Query: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060
            +D++L S E+  ++E   + +  L   + +++E  +L  E+ E+ +QLK+++  ME    
Sbjct: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN 1080

Query: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG-------E 1113
            EFKS++IE+ +KLEKLN+LL +I  E+ Q E  LN L IRDVT TL +LD+        +
Sbjct: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140

Query: 1114 STNNSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVS 1173
              NN ++  E +   T+     +               N   M +DE   E+  G+PR+S
Sbjct: 1141 VKNNQELDQEYRSCETQDESEIKD--------AETSCDNYHPMNIDETSDEVSRGIPRLS 1192

Query: 1174 EAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAM 1233
            E EL+ LDVE + ++I +L  YV+  NVD+ +LEEYA+RLAE KRRK+DLN AV +RD +
Sbjct: 1193 EDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEV 1252

Query: 1234 REKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1293
            +E+LG LKK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP
Sbjct: 1253 KEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1312

Query: 1294 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1353
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1313 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1372

Query: 1354 TKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399
            TKNAQFIVISLRNNMFELAQQLVG+YK  N TKS ++KN DILNRT
Sbjct: 1373 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1468 bits (3801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/1410 (56%), Positives = 1005/1410 (71%), Gaps = 19/1410 (1%)

Query: 3    DTPLTKRQRVN-----DNESREFEAVNGSTKS-PLTSNSNSTISH--TPKKLVIGTNDDT 54
            D  L+KRQ+V+     D +    +   G   S P TS+S +T +H  TP+KLV+G  D+ 
Sbjct: 4    DDSLSKRQKVDGLNQIDGKHPTVDLDQGENLSLPTTSSSQNTFAHAKTPRKLVVGNGDNR 63

Query: 55   TXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXXKLELIKISPVKKN 114
                           P LQ P +SSRGR  +TY              KLELI+ISP+K +
Sbjct: 64   YAHSSQSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRSPTRKLELIQISPLKNS 123

Query: 115  RLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNV 174
            RLELQ++YDA+Q+Q    RLCI++L+LQDFKSYAGRQVVGPF++SFSAVVGPNGSGKSNV
Sbjct: 124  RLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNV 183

Query: 175  IDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKP 234
            IDSMLFVFGFRANKMRQDRLSDLIH SE +P+L SCSVEVHF+YV+DEP G TRIDEEKP
Sbjct: 184  IDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKP 243

Query: 235  TLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
             LVVTRKAF+NN+SKYYVND+E+NY EVT+LLKKEG+DLDHKRFLILQGEVENIAQM+ K
Sbjct: 244  NLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSK 303

Query: 295  AXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETG 354
            A              I GTAKYKP IE  L ++E LN+ CIEKENRF IVD+EK+SLE G
Sbjct: 304  AEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENG 363

Query: 355  KDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKE 414
            K+               +SK+ QY I  +++KL +TLDK + L  +L++E++K +   KE
Sbjct: 364  KEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKE 423

Query: 415  VDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSN 474
            +D L+    ++  +++    EEK LL +KR LD + V  EEKIK+  +K +KAEK L S 
Sbjct: 424  LDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSM 483

Query: 475  QHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQY 534
              S++++EA L EL+Q Q+DYE  L++LN++   E+ KLE +K SLK+KT  IS  IAQ 
Sbjct: 484  DRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQL 543

Query: 535  EKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVI 594
            EK+LEPW+ QLQ+K+ +IQLAES++SL+K+  A++ ++I+Q K EI    ++ L   K +
Sbjct: 544  EKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKEL 603

Query: 595  RELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLT 654
              L  +   V  E+ T   EC +A  RLK+M  IL  QRQ+ LDAR+A S+A+NKS VLT
Sbjct: 604  DSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLT 663

Query: 655  ALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKN 714
            AL++LQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE+VECGQQCIEYLRKN
Sbjct: 664  ALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKN 723

Query: 715  KLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQ 774
            KLGYARFILLDKLRKF+   I TPE+VPRLFDL+ PKD KF  AF+SVL +TL A  L Q
Sbjct: 724  KLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQ 783

Query: 775  ANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQL 834
            ANRVAYGKKRFRVV+LDG LIDISGTMSGGGS V RGLM++++N +   +I+S EEVAQL
Sbjct: 784  ANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQL 843

Query: 835  ENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXX 894
            E  L E+EK+FQ+ASDT  +ME+QLK LK++ P I+  +S+L ME ESW S         
Sbjct: 844  EVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQM 903

Query: 895  XXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSEL 954
                         N E +     V++LKDE +++ +QT + + +I  LK++IMEIGG+EL
Sbjct: 904  LESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAEL 963

Query: 955  QIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLK 1014
            +IQ+SKV S IQR++I+              ENE+ KS K+   T +DL+ ++QEI +LK
Sbjct: 964  KIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLK 1023

Query: 1015 ENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLE 1074
               + +Q +L  V +SV   Q     + E+   L+ +L  +      FKS ++E+ ++LE
Sbjct: 1024 TTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELE 1083

Query: 1075 KLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNE-----LQEKRT 1129
            KLN+L  H+ KE++  E  L +LKIRDVT+ L   D  + +NN+  P+E     ++E  +
Sbjct: 1084 KLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILH--DLKDESNNASDPSENPVSDVEESES 1141

Query: 1130 ---EGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLG 1186
               EG D  +                D  M+V++     + GL + SE EL  +++E+L 
Sbjct: 1142 SVGEGKDENKD-LDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSEDELHEIEIEELE 1200

Query: 1187 AQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFD 1246
             +IEDLQN++D+ N D+++LEEYA+RL E K R++DLN+AV ER+ ++EKL ELKK+RFD
Sbjct: 1201 KEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFD 1260

Query: 1247 EFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1306
            EFMQGFGIISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSG
Sbjct: 1261 EFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSG 1320

Query: 1307 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1366
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1321 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1380

Query: 1367 NMFELAQQLVGIYKTQNMTKSASLKNNDIL 1396
            NMFELAQQLVGIYK  N TKSA++KN D +
Sbjct: 1381 NMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1464 bits (3789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1435 (53%), Positives = 1007/1435 (70%), Gaps = 56/1435 (3%)

Query: 1    MPDTPLTKRQR----------VNDN----ESREFEAVNGSTKSPLTSN----SNSTISHT 42
            M D+PL+K+Q+          +ND     ESR    VN + K+P  ++    S+   SHT
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 43   PKKLVIGTNDD-TTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXX 101
            P+KLV+ + ++                 P+LQ P  SSRGR+ + Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 102  KLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
            +LEL+++SPVK +R+ELQ+LYD+ +S  +   RL INKLVL +FKSYAGRQVVGPFH+SF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L++CSV VHF+Y++
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            DEP GT+RIDEEKP LV+TR+AFKNNSSKYY+N+KES+YTEVT+LLKKEGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVENIAQM+PKA              I GTA YKP IE  L +IE LNE C+EK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F IVD+EK+SLE+GK+               +SK++Q+K+ Q++ KL STL+K S L  +
Sbjct: 361  FEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNRE 420

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
             + E +K+ E+L+EVD +K + K +  RI +    EK L  +KR L+  RV++EE+ K++
Sbjct: 421  FESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
              K  KAEK LKS +HS++ +E   +EL++ Q ++EKE++DLNQ L  ER  L+D+K+SL
Sbjct: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            K+KT +ISA I ++EK+ EPWD QLQ+K+++IQLAESELSLL++T A++ K+ E L+ +I
Sbjct: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKI 600

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
                + K   + ++ +L Q    +         +  SA  +LK+M  IL A RQR ++AR
Sbjct: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
            ++ S AQNK+ VLTAL+KLQKSGRI+GFHGRLGDLGVID  +DVAISTACPRL+D+VV++
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VEC Q CI+YLRKNKLGYARFILLD+LRKF+   I TPENVPRLFD+VKPKD KF  AFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVL+DTL A+ L QAN+VAYGK+RFRVV++DGKLIDISGTMSGGG+HV++GLMRL  N S
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
               + ++PEEV ++E+EL E+EK+F++A+DT  EME++LKK++D+ P+++ ++S+  ME 
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEA--RVKTLKDEQRALSDQTTTTRQK 938
            +S  S                  A   NE+ Q+ E    ++ L+ E   L  +T T +++
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAV--NEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQ 958

Query: 939  IAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGN 998
            I +L+D+IM+IGG++L  QNSKV S  QR++IL              E ++ K  K + N
Sbjct: 959  IKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKN 1018

Query: 999  TQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAG 1058
             ++D +L S E+  ++E     +  L   + ++ E  +L  E+ ++ +QLK+RL +ME  
Sbjct: 1019 FEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEEN 1078

Query: 1059 FTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLD-------- 1110
              EFKSL+IE+ +KLEKLN+LL HI  E++Q + +LN+L IRDVT TLQ+LD        
Sbjct: 1079 IDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVE 1138

Query: 1111 -------EGESTNNSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPH 1163
                   + +    S +P++  EK  E  DA                 N   M +DE   
Sbjct: 1139 DGIKDEQDADQDKPSGIPDD--EKIQEKDDADN---------------NHHSMNIDEMSS 1181

Query: 1164 ELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDL 1223
            E+  G+P++ E ELK LD+E L + I  L  Y++  +VD+ +LEEY +RL E KRRK+DL
Sbjct: 1182 EISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDL 1241

Query: 1224 NEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPF 1283
            N+AV +RD ++E+L  LKK RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPF
Sbjct: 1242 NQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1301

Query: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNV
Sbjct: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398
            SIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TKS ++KN DIL R
Sbjct: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1462 bits (3784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1412 (53%), Positives = 996/1412 (70%), Gaps = 31/1412 (2%)

Query: 5    PLTKRQRVNDNESR------EFEAVNGSTKSPL--------TSNSNSTISHTPKKLVIGT 50
            P TKRQ+V + ES+      E +  N S +SPL         S  N++ SHTP+KL++G 
Sbjct: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILGQ 63

Query: 51   NDDTTXXXXXXXXXXXXXAPSLQHPNSSS-RGREQ-RTYXXXXXXXXXXXXXXKLELIKI 108
            ND+                P+LQ P+SSS RGR+  ++Y              +LELI++
Sbjct: 64   NDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLELIQL 123

Query: 109  SPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNG 168
            SPVK NR++L+ LYDA  SQ    RL INKL L +FKSYAG+QVVGPFH+SFSAVVGPNG
Sbjct: 124  SPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNG 183

Query: 169  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTR 228
            SGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L SCSV+V F Y +DE DG T+
Sbjct: 184  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTK 243

Query: 229  IDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENI 288
            I E KP LV++RKAFKNNSSKYY+N KESNYT+VT+LLK+EGIDLDHKRFLILQGEVENI
Sbjct: 244  ISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENI 303

Query: 289  AQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEK 348
            AQM+PKA              I GT+KYK  IE  L EIE LNE CIEKENRF IVD+EK
Sbjct: 304  AQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREK 363

Query: 349  SSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKY 408
            +SLE+GK+               +SK++QY +WQN+ KLT+TL K S L  + + E  K 
Sbjct: 364  NSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKN 423

Query: 409  SETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAE 468
                 E++  K    +   +I+ L  EEK  L  KR L+ + V+++EK+K++ QK  K E
Sbjct: 424  QTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTE 483

Query: 469  KLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNIS 528
            K++ + + ++++  + ++EL +SQ +Y  EL+ LNQ+L +ER  LE +K+ LKEKT  IS
Sbjct: 484  KIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGIS 543

Query: 529  AGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKL 588
              I  +E DLEPW+ ++Q+K+ EIQL ES++SLL++   ++  DI+ L  E++     K+
Sbjct: 544  EEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKI 603

Query: 589  AKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQN 648
             +E+ +  LK+++S +T E+     EC+   ++LK+M  +L  QRQR  +AR A ++ QN
Sbjct: 604  KREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQN 663

Query: 649  KSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCI 708
            +  VLTAL KLQKSGRI GFHGRLGDLG ID  YDVA+STACPRL+DIVVE+VECGQQCI
Sbjct: 664  RGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCI 723

Query: 709  EYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLA 768
            EYLRKNKLGYARFILLDKLR F+T  IQTP+NVPRLFDL+KPKD KF+PAFYSVLRDTL 
Sbjct: 724  EYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLV 783

Query: 769  AQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSP 828
            A+ L QANRVAYG++R+RVV+LDGKLID+SGTMSGGG+HV +GLM L +      D ++P
Sbjct: 784  AKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNP 843

Query: 829  EEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXX 888
            E+V Q+E +L++KEK+F++A++ F EME++L+KL +R PEI+L++SK++ME +++ +   
Sbjct: 844  EDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIK 903

Query: 889  XXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIME 948
                               NEE ++A   ++ LK+E  AL D+T   ++KIA LK+KIM+
Sbjct: 904  SKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMK 963

Query: 949  IGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQ 1008
            IGG ELQ+QNSKVTS +QR++ILT             + EL+K+ K +  ++ D+ L + 
Sbjct: 964  IGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITD 1023

Query: 1009 EIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIE 1068
            +I  + E  D +  +L +++KS++E Q     + ++ D+LK ++  +E    EFKS +IE
Sbjct: 1024 DIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIE 1083

Query: 1069 INDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLD---EGESTNNSKMPNELQ 1125
            +N+KLEKLN LL HI  +++ LE  L+ L +R + + L  LD   E ++ NN  + +E  
Sbjct: 1084 VNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQI 1143

Query: 1126 EKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDL 1185
              +T G + T                +D+ M++D     + NGLP +S+ EL +LD+  +
Sbjct: 1144 HDQT-GHELTN-----------TAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLV 1191

Query: 1186 GAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRF 1245
              ++ DL+ Y++S + ++E+LEEY KRL E K RK+DLN+AV +R+ +R++L ELKK R+
Sbjct: 1192 ETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRY 1251

Query: 1246 DEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLS 1305
            +EFM GFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLS
Sbjct: 1252 EEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLS 1311

Query: 1306 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1365
            GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR
Sbjct: 1312 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1371

Query: 1366 NNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397
            NNMFELAQQLVGIYK +N T SA++KN +ILN
Sbjct: 1372 NNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1459 bits (3776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/1419 (53%), Positives = 1004/1419 (70%), Gaps = 21/1419 (1%)

Query: 1    MPDTPLTKRQR----------VNDNE-SREFEAVNGSTKSPLTSNSNSTI-------SHT 42
            M D+PL+KRQ+          ++D++ ++E +A   + +S  T + NS         SHT
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 43   PKKLVIGTNDD-TTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXXX 101
            P+KLV+ + ++                 P+LQ P +SSRGR+ + Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 102  KLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
            +LEL+++SPVK +R+ELQ+LY++ QS  +   RL IN+LVL++FKSYAGRQVVGPFH+SF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL+SCSV VHF+YV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            DE  GT+RIDEEKP LV+TRKAFKNNSSKYY+N KES+YTEVT+LLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVENIAQM+PKA              I GTA YKP IE  + +IE LNE C+EKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F IVD+EK+SLE+GK+               +SK+ Q+K+ Q++ KL STL+K S L   
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
             + E  K+ E+LK+V+ +K + K++  RI +    EK L+ ++R L+  RV++EE+ K++
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
              K  K+E+  K  + S++  E  L+EL   Q ++E E++DLNQ L  ER+ L+++K+SL
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            K+KT +IS  I Q+EK+LEPWD QLQ+K ++IQLAESELSLL++T +++ K++E ++ +I
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
                  K   + +I  LK++ S +  E        SSA  +L++M ++L   RQR ++AR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
            ++ S AQNKS VLTAL+KLQKSGRI+GFHGRLGDLG+ID  +DVAISTACPRL+D+VV++
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VEC QQCI+YLRKNKLGYARFILLD+LR+F+   I TPENVPRLFDLVKPKD KF  AFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVLRDTL A+SL QAN VAYG+KRFRVV++DGKLIDISGT+SGGG+HV +GLMRL  N S
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
               D ++PEEV ++E+EL+E+E +F++A+DT  EME +LK L+D+ P I+ K+SK  ME 
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940
            +S  S                  A     +  +    ++ LK E   L  +T T ++KI 
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQ 1000
            VL+ +IM+IGG++LQ+QNSKV S  QR++IL              E ++ K  K + N++
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060
            +D++L S E+ +++E   + +  L   +  + E  +L  E+ E+ +QLK+ +A+ E    
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENID 1080

Query: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKM 1120
            EFKSL+IE+ +KLEKLN+LL HI KE+ Q E  L+ L IRDVT TL++LD   + +  K 
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD-NNTMDIVKT 1139

Query: 1121 PNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSL 1180
             N++++   +   ++                +   M++DE  +E+  G+PR SE ELK L
Sbjct: 1140 DNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKEL 1199

Query: 1181 DVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGEL 1240
            D+E L  +I +L  Y+D  NVD+ +LEEYA+RLAE KRRK+DLN+AV +RD ++ ++  L
Sbjct: 1200 DIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVL 1259

Query: 1241 KKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRN 1300
            KK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRN
Sbjct: 1260 KKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRN 1319

Query: 1301 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1360
            ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI
Sbjct: 1320 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1379

Query: 1361 VISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399
            VISLRNNMFELAQQLVGIYK  N T+S ++KN DILNRT
Sbjct: 1380 VISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1427 bits (3693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/1419 (52%), Positives = 988/1419 (69%), Gaps = 26/1419 (1%)

Query: 1    MPDTPLTKRQRVNDNESR----EFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTX 56
            M  TPL+K+Q+V  +E R    + E  N  T   +T++S    SHTP+KL++G+ D+   
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASS-FLKSHTPRKLLLGSADNKYV 59

Query: 57   XXXXXXXXXXXXAPSLQHPN------SSSRGREQRTYXXXXXXXXXXXXXXKLELIKISP 110
                        + SLQ PN        SRGR+++ Y              KLELI++SP
Sbjct: 60   LSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPGRSPVRKLELIQLSP 119

Query: 111  VKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSG 170
            +K NR+ELQ+LY+++   +N  RL I+KLVLQDFKSYAG Q+VGPF++SFSA+VGPNGSG
Sbjct: 120  IKNNRIELQKLYNSKN--QNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSG 177

Query: 171  KSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRID 230
            KSNVIDSMLFVFGFRANKMRQDRL DLIH SE  PN++SCSVEVHFQYV+DE DGT++I 
Sbjct: 178  KSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII 237

Query: 231  EEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQ 290
            E++  LVV RKAFKNNSSKYY+N KESNYTEVT+LLK+EGIDLDHKRFLILQGEVENIAQ
Sbjct: 238  EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297

Query: 291  MRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSS 350
            M+ KA              I GT+KYK  IE  + EIE LNE C+EKE RF IV+ EK+S
Sbjct: 298  MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357

Query: 351  LETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSE 410
            LE+ KD               RSK+ QYK++Q + KL +TLDK S  K  L +E  KY +
Sbjct: 358  LESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417

Query: 411  TLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKL 470
               E+D    E ++  ++I     +E+ L+ +KR  D Q V++EE+IK++ QK  KAEK 
Sbjct: 418  IQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKT 477

Query: 471  LKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAG 530
            L   +  +   E+ L++L+  Q++Y+ E  +L +EL  ER+KL+D+K+SLK+KT +IS+ 
Sbjct: 478  LHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQ 537

Query: 531  IAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAK 590
            I+ YEKD+EPW  ++Q+K+ +IQLAESE+SLLK++ A++ + +  LK EI    +E   K
Sbjct: 538  ISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNK 597

Query: 591  EKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKS 650
              +I  LK+E+  +  EV    +ECS A  + K+M  IL + RQR +DAR+A   A+NKS
Sbjct: 598  NSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKS 657

Query: 651  TVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEY 710
            TVL+ALT+LQKSGRI+GFHGRLGDLGVI +KYD+AISTAC RL+DIVV+SVECGQQCIEY
Sbjct: 658  TVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEY 717

Query: 711  LRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQ 770
            LRKNKLGYARFILLDKLR F  G++QTPENV RLFDLV+P D KF  AFYSVLRDTL A 
Sbjct: 718  LRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVAT 777

Query: 771  SLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEE 830
             + QANRVAYGK+R+RVV+LDGKLIDISGTM+GGGSHV +GLM+L  +N    +++   +
Sbjct: 778  DIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGD 837

Query: 831  VAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXX 890
            V ++E +L E+E +F+IA DT +EM ++LK+L+D+ PEI+L+++KL+M+ +S        
Sbjct: 838  VEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLK 897

Query: 891  XXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIG 950
                            K +    AEA ++TL++E RAL DQ+ + ++KI  LK++IM+IG
Sbjct: 898  EQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIG 957

Query: 951  GSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEI 1010
            G ELQIQNSKV+S  +R+ I+              E EL+K  ++    + D      ++
Sbjct: 958  GKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDL 1017

Query: 1011 ASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEIN 1070
             +L+ N   ++  L+  E   D   +   ++  + + LK+++  ME    E+KS +IEI 
Sbjct: 1018 ETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIK 1077

Query: 1071 DKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNS----KMPNELQE 1126
            +KLEKLN+LL +  K++R L  +L +  +RDVT++L+ + + E+ NNS    +  N L  
Sbjct: 1078 NKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKI-QNENANNSVGVKQSSNNLDV 1136

Query: 1127 KRTEGADATRQXXXXXXXXXXXXXXND--------EVMEVDEKPHELENGLPRVSEAELK 1178
              +   +  +               N+        ++M++D    E+  G+P++++ +LK
Sbjct: 1137 SSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPKLTDDDLK 1196

Query: 1179 SLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLG 1238
            S+D++ L ++I  LQ+YV++ N D+E+LEEY +RL E K+RK+DLN  V  RD +R++L 
Sbjct: 1197 SIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELE 1256

Query: 1239 ELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1298
            +LKK R DEFM+GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW
Sbjct: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1316

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1358
            RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ
Sbjct: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1376

Query: 1359 FIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397
            FIVISLRNNMFELAQQLVGIYK  NMT+SA+LKN DILN
Sbjct: 1377 FIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1408 bits (3645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1428 (51%), Positives = 1002/1428 (70%), Gaps = 39/1428 (2%)

Query: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTI--------------SHTPKKL 46
            M D+PL K+Q+   ++  + ++    T SP+   S S++              S TP+KL
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQS--NPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKL 58

Query: 47   VIGTNDDTTXXXXXXXXXXXXXAPSLQHPN-SSSRGREQRTYXXXX----XXXXXXXXXX 101
            V+G+  +                P+LQ PN   SRGR  R Y                  
Sbjct: 59   VLGS-PEKKYAYSQPSTSSSLSVPNLQPPNVDGSRGR--RFYSQSPPRSPHRSPNRSPTR 115

Query: 102  KLELIKISPVKKNRLELQRLYDAEQSQRNAA--RLCINKLVLQDFKSYAGRQVVGPFHSS 159
            +LELI++SPVK NR ELQ++YD +    N    RLCI+KL L +FKSYAG Q++GPFH+S
Sbjct: 116  RLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTS 175

Query: 160  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYV 219
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIH SE +PNL+SCSV++HF+YV
Sbjct: 176  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYV 235

Query: 220  VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFL 279
            VDE DGTTR D+EKP +V+TRKAF+NNSSKYY++ KESNYTEVTQLL+ +GIDLDHKRFL
Sbjct: 236  VDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFL 295

Query: 280  ILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKEN 339
            ILQGEVE+I+QM+PKA              I GTAKYK  IE  L EI+ LN+ C+EKEN
Sbjct: 296  ILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKEN 355

Query: 340  RFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKG 399
            RF +V++EK+SLE+GKD               +SK+ QY IWQ+  KL+ TL K S+L  
Sbjct: 356  RFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNE 415

Query: 400  QLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKS 459
             L QE  KY +  +EV  L++      K++  L  E K L +++R +D+++ ++EEK ++
Sbjct: 416  HLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRN 475

Query: 460  VNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKIS 519
            +++K  KAEKLLKS ++S+  ++  L EL  SQ  Y+++L  LN+ L+ ER+KL+++K+S
Sbjct: 476  LDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLS 535

Query: 520  LKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579
            L++KT  ISA IA +E+DLEPW+ QLQ+K+++++L ES++++LK++  +  ++I QLK E
Sbjct: 536  LRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTE 595

Query: 580  IARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDA 639
            I    E+   +E  I +L+ E++++   +     EC SAS++L +M  +LI+ RQR ++A
Sbjct: 596  IEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEA 655

Query: 640  RAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE 699
            R+  S+ +NK+ VL+AL +LQ+SGRI+GFHGRLGDLG ID+ YDVAISTACPRL+DIVV+
Sbjct: 656  RSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVD 715

Query: 700  SVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAF 759
            +VECGQQCIE+LRKNKLGYARFI+LDKLRKF+   IQTPE VPRLFDLV+ K+ KF+PAF
Sbjct: 716  NVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAF 775

Query: 760  YSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNN 819
            YSVLRDTL    L QANRVAYGK+RFRVV+LDGKLID SGT+SGGG+HV++GLM+  Q  
Sbjct: 776  YSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQP 835

Query: 820  SYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVME 879
                  ++PEEV  +E EL E+EK+F IA +TF +ME+ LKK KDR PEI+++++K  ++
Sbjct: 836  GAG---YTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLD 892

Query: 880  TESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKI 939
             ES  +                   + ++ E   AE++++ L +E   + ++T   +Q I
Sbjct: 893  IESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLI 952

Query: 940  AVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNT 999
              LK+KIM+IGG++LQ+QNSKV S  +++ I++             EN+LK+        
Sbjct: 953  NSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREA 1012

Query: 1000 QKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGF 1059
              D++  + EI+ +      ++  +  ++ S++E + L  E+ E+ +++K  L +     
Sbjct: 1013 SNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNT 1072

Query: 1060 TEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSK 1119
            ++FKS++IEIN++LEKLN L  HI KE++  + +LN+LKIRD+T+TLQ L+EG+    ++
Sbjct: 1073 SDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENE 1132

Query: 1120 MPNELQ------EKRTEGAD--ATRQXXXXXXXXXXXXXXNDEV--MEVDEKPHELENGL 1169
               E+Q      E+R   +D  A                 + E+  M++DE  +E  NGL
Sbjct: 1133 DDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETSNGL 1192

Query: 1170 PRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGE 1229
            P+ SEA+L+S+ +ED+  QI++L +YVD+ +VD+++LEEYA+RLAE+K+RK+DLN+AV +
Sbjct: 1193 PKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLK 1252

Query: 1230 RDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1289
            RD +R+   ELKK+R D+FM+GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGV F
Sbjct: 1253 RDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1312

Query: 1290 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1349
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1313 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1372

Query: 1350 IKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397
            IKERTKNAQFIVISLRNNMFELAQQLVGIYK  NMT+S +L+N DILN
Sbjct: 1373 IKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1403 bits (3632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/1443 (52%), Positives = 987/1443 (68%), Gaps = 62/1443 (4%)

Query: 1    MPDTPLTKRQRV-----NDNE----------SREFEAVNGSTKSPLTSNSNSTISHTPKK 45
            MP TPL+KR ++     N NE          +R+   V+ +T+     +  +  S TPKK
Sbjct: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKK 60

Query: 46   LVIGTNDDTTXXXXXXXXXXXX-XAPSLQHPN-SSSRGREQRTYXXXX----XXXXXXXX 99
            L++   D                 APSL  P  SSSRGR  RTY                
Sbjct: 61   LILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPARSPARSP 120

Query: 100  XXKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSS 159
              KLELI++SPVK +R+ LQ++Y++ ++++   RLCI+KLVL DFKSYAG QVVGPFHSS
Sbjct: 121  TRKLELIQLSPVKNSRIALQKIYES-KNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSS 179

Query: 160  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYV 219
            FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIH SE  P+LKSCSVEVHF+YV
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYV 239

Query: 220  VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFL 279
            +D+PDGTT I+  K  LV+TRKAFKNN+SKYY+N KESNYT VT+LLK EGIDLDH RFL
Sbjct: 240  IDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFL 299

Query: 280  ILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKEN 339
            ILQGEVENIAQM+PKA              I GTAKYKP IE   +EIE LNE CIEKEN
Sbjct: 300  ILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKEN 359

Query: 340  RFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKG 399
            RF IVD+EK+SLE+GKD               +SK+ QYK+WQ++ KL++TL+K S +K 
Sbjct: 360  RFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKE 419

Query: 400  QLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKS 459
            + ++  +K+S T  +++ +     ++ K I+    +EK L  QKR  D +RV++EE+ K+
Sbjct: 420  EFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKN 479

Query: 460  VNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKIS 519
            + +K  K EK L+    +++ T+  + +L +++ +YE +L +LN +L  ER  LE++KIS
Sbjct: 480  IMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKIS 539

Query: 520  LKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579
            LK+KT+  S  I+Q+EK+LEPW+ QLQ K+++IQ+ ESE+SL+K+   ++  DIE L + 
Sbjct: 540  LKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSL 599

Query: 580  IARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDA 639
            I+   EEK+++EK I  L+ E + +T EV     E ++A  +L++M  +L   RQ+ +DA
Sbjct: 600  ISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDA 659

Query: 640  RAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE 699
            R + S+ +NK+ VL +L +LQKSGRISGF+GRLGDLG ID++YD+AISTACPRL D+VVE
Sbjct: 660  RTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVE 719

Query: 700  SVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAF 759
            +VECGQQCIEYLRKNKLGYARFILL+KLR F   KI TP NVPRLFDLV   D KF+PAF
Sbjct: 720  TVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAF 779

Query: 760  YSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNN 819
            YSVLRDTL   +L  ANRVAYG KRFRVV+L G+LID+SGTMSGGG+   RGLM+L+++ 
Sbjct: 780  YSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSG 839

Query: 820  SYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVME 879
            +     ++ E+V ++E EL  +EK+F+IA++TF EME +L++LKDR P+++L++SK  +E
Sbjct: 840  NSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELE 899

Query: 880  TESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKI 939
              SW++                      NEE    E  + TL+++ ++L  +T + + +I
Sbjct: 900  ITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRI 959

Query: 940  AVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNT 999
              LKD+IM++GG +LQ+Q+SKV S IQ+ +IL              E ELK+ +K     
Sbjct: 960  KFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSEC 1019

Query: 1000 QKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMN-------EKLDQLKQRL 1052
              DL   + ++    EN D     L  + KS+ E + L HE+        +  + LK +L
Sbjct: 1020 STDLLTSTDKL----ENTDG---QLSKISKSLSETETLLHELEFSREESLQNSENLKDQL 1072

Query: 1053 AQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG 1112
             + E     FK  ++E  +K EKLN LL  I K++R  +S+L +LKIRD+T TLQ LD G
Sbjct: 1073 KEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNG 1132

Query: 1113 E-----------------STNNSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEV 1155
                              S NNS   +E      EG +                  ND  
Sbjct: 1133 NIDQDEEDVSMKDNAVSVSANNSLGNSE----NMEGVEI-----ETNESDVSPDANNDLE 1183

Query: 1156 MEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAE 1215
            ME+DE  +E+  G+PR+SE E K++DVE+L AQ   LQ+Y+D+VNV++++LEEYA+R+AE
Sbjct: 1184 MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAE 1243

Query: 1216 HKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELE 1275
            +KRRK+DLN AV ER+ +RE L +LKK RF+EFMQGFG+IS+TLKEMYQMITMGGNAELE
Sbjct: 1244 YKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELE 1303

Query: 1276 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1335
            LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID
Sbjct: 1304 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1363

Query: 1336 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDI 1395
            AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ N TKSA+L+NNDI
Sbjct: 1364 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDI 1423

Query: 1396 LNR 1398
            +NR
Sbjct: 1424 INR 1426

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1356 bits (3509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/1410 (51%), Positives = 966/1410 (68%), Gaps = 25/1410 (1%)

Query: 3    DTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTXXXXXXX 62
            ++PL+K+Q+   N   +F     S      S S      TP+KLV+G+  D         
Sbjct: 2    ESPLSKKQKTFVNRDEDFSQTEESVDVTRASRS-----RTPRKLVLGS-PDKRFAFSQPV 55

Query: 63   XXXXXXAPSLQHPNS---SSRGREQRTYXXXXXXXXXXXXXXKLELIKISPVKKNRLELQ 119
                   P LQ   S   SSRGR    Y              KLELI++SP KK RLE Q
Sbjct: 56   TSSSSNVPYLQPLKSELSSSRGR---VYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQ 112

Query: 120  RLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSML 179
            +        +   RLCIN+L L +FKSYAG QVVGPFHSSFSAVVGPNGSGKSNVIDS+L
Sbjct: 113  KTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLL 172

Query: 180  FVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVT 239
            FVFGFRANKMRQ +LSDLIH SE HPNL SC VEV FQYV DE DG T + +++P LVVT
Sbjct: 173  FVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVT 232

Query: 240  RKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXX 299
            RKAFKNN+SKYYVN KES+YT+VT+LL+KEGIDLDHKRFLILQGEVE+IAQM+PKA    
Sbjct: 233  RKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEG 292

Query: 300  XXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXXX 359
                      I GTAKYKP IE  L +I+ LN+ C EKENR+ IV++EKSSLE+GKD   
Sbjct: 293  DDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGKDEAL 352

Query: 360  XXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLK 419
                        RSK++Q+K+W+N  K T+T +K   L+ +L  E  KY+E  +E+  L+
Sbjct: 353  EFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLE 412

Query: 420  DESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLN 479
             ESK +   I  +   E +L ++KR  D+ RV++EEK+K+++QK  KAEK   +  +S+N
Sbjct: 413  SESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSIN 472

Query: 480  ATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLE 539
            AT+A L EL + Q+ YEKEL +LN+ L+ E+ KL+++KISLK KT  IS  I + E++LE
Sbjct: 473  ATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELE 532

Query: 540  PWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQ 599
            PW+ +LQ+KR++I+L E+++S+LK++ A+I ++I + +N+I+   ++   + + I  L++
Sbjct: 533  PWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEK 592

Query: 600  EESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKL 659
            E +D+  ++     EC +AS ++K+M  +L   RQR+LDA+++ S+ +NK+ VL+AL +L
Sbjct: 593  EHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRL 652

Query: 660  QKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYA 719
            Q+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+D+VVE+VECGQQCIE+LRKNKLGYA
Sbjct: 653  QRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYA 712

Query: 720  RFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVA 779
            RFILLDKLR F+   IQTP NV RLFDLV P D+KF  AFYSVLRDTL A+ L +ANRVA
Sbjct: 713  RFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVA 772

Query: 780  YGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELT 839
            YGK+RFRVV+LDGKLID+SGTMSGGG+H   G+M+  + N+ +   F+ EEV Q++ ELT
Sbjct: 773  YGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGAS--FTAEEVRQIDEELT 830

Query: 840  EKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXXXXXXX 899
            E+E++F+IA+DT  EMED L+ LKDR PEI+  +SK  ME +S +S              
Sbjct: 831  ERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKK 890

Query: 900  XXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNS 959
                    ++    A +R+ +LK E + L  +  + + KI  L+++IM+IGG++LQ+Q S
Sbjct: 891  EQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGS 950

Query: 960  KVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLKENADN 1019
             V S  QR+ I               EN+LK+  K  G    D+D  + E+ S+KE   +
Sbjct: 951  LVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISS 1010

Query: 1020 VQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNAL 1079
                +  +E S+D+ Q    E+ EK+ ++++ + +  +   +F   +++IN++LEKLN L
Sbjct: 1011 SDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDL 1070

Query: 1080 LGHITKEVRQLESDLNNLKIRDVTRTLQLLDE---GESTNNSKMPNELQEKRTE----GA 1132
            L HI K+   L   L +LKIRDVT TLQ L++    ES +  ++  +  E R++    G 
Sbjct: 1071 LNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGD 1130

Query: 1133 DATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENG---LPRVSEAELKSLDVEDLGAQI 1189
                                ++ M+VDE P E+E     LP+++EA+LK L+VE++  +I
Sbjct: 1131 LMEVDTVEGCMGNEPTASQPEDQMDVDE-PEEMETSPSDLPKLTEAQLKELNVEEVELEI 1189

Query: 1190 EDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFM 1249
              L ++V++   D+E+LEEY KRL + + RK++LN+AV +RD++R+    L+K+R DEFM
Sbjct: 1190 GQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFM 1249

Query: 1250 QGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1309
             GF  ISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEK
Sbjct: 1250 NGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEK 1309

Query: 1310 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1369
            TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF
Sbjct: 1310 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1369

Query: 1370 ELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399
            ELAQQLVGIYK +NMTKS +L+N D++NR+
Sbjct: 1370 ELAQQLVGIYKNRNMTKSVALENKDLINRS 1399

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1327 bits (3435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1377 (50%), Positives = 949/1377 (68%), Gaps = 23/1377 (1%)

Query: 42   TPKKLVIGTNDDT-TXXXXXXXXXXXXXAPSLQHP----NSSSRGREQRTYXXXXXXXX- 95
            TP+KL+IG +++                 P+LQ      +  SRGR  + Y         
Sbjct: 67   TPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPPRSPG 126

Query: 96   ---XXXXXXKLELIKISPVKKNRLELQRLYDAEQSQRNAA-RLCINKLVLQDFKSYAGRQ 151
                     KLELI++SP+K +RLELQ+LYDA  ++     RL I+KLVL +FKSYAG Q
Sbjct: 127  RSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQ 186

Query: 152  VVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCS 211
             +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE   NL  CS
Sbjct: 187  TIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCS 246

Query: 212  VEVHFQYVVDEPDGTTRID--EEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKE 269
            VEVHF+YV DE    T  D  E + TLV+TRKAFKNNSSKY++N KESN+TEVT+LLK++
Sbjct: 247  VEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQ 306

Query: 270  GIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEV 329
            GIDLDHKRFLILQGEVENIAQM+ KA              I GT  YKP IE    EIE 
Sbjct: 307  GIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEA 366

Query: 330  LNESCIEKENRFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTS 389
            +NE CIEKENRF IVD EK+SLE  KD               +SK+ QY ++ N+ K+ +
Sbjct: 367  MNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKT 426

Query: 390  TLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQ 449
            TL +   L+   +QE +++S+ +KEV++L++   +    + +L  EEK+L+ +KR ++ Q
Sbjct: 427  TLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQ 486

Query: 450  RVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITE 509
             V++EE  K+++QK  KA+  ++S++  ++  E  L+E  Q Q +YE E+ DL+++   E
Sbjct: 487  SVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSKQREVE 546

Query: 510  RAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARI 569
               L D+K+ LK+KTV  S  IA  EK+LEP + ++Q+K+++I+L E E+ L++D+  ++
Sbjct: 547  EKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKV 606

Query: 570  NKDIEQLKNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEIL 629
              +IE LK E+ +  ++    EK + +L + + ++  E      EC  A  +L +M  IL
Sbjct: 607  GAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAIL 666

Query: 630  IAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTA 689
             + RQ+T++AR+  S+AQNK+ VLT+L ++Q+SGRI+GFHGRLGDLG+I ++YDVAISTA
Sbjct: 667  NSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTA 726

Query: 690  CPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVK 749
            CPRL+D+VVESVECGQ CIE+LRKNKLGYARF++LDKL++F    IQTPENVPRLFDLVK
Sbjct: 727  CPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVK 786

Query: 750  PKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVV 809
            PK+ +F PA YSVLRDTL A+ L QANRVAYGK+RFRVV+LDG+LIDISGTMSGGGS V 
Sbjct: 787  PKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVF 846

Query: 810  RGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEI 869
            +GLM L+   S + +IFS E++ +LE EL  +EK F +AS+TF  ME +L+KL DR P++
Sbjct: 847  KGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQL 906

Query: 870  QLKVSKLVMETESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALS 929
            +L++SK +++ ++                     +    ++  L    ++ L  E + L 
Sbjct: 907  ELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQELKYLQ 966

Query: 930  DQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENEL 989
            DQ+ T+ ++++ LKD+IM IGGSELQ+QNSKV+S  QR++IL                EL
Sbjct: 967  DQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVKKLNTEL 1026

Query: 990  KKSAK-IVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQL 1048
            KK+ K ++ +T++  +  ++EIA  K  A+  + +L  + KS++  QD    + ++L+  
Sbjct: 1027 KKARKSLIASTEESTN-STEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENF 1085

Query: 1049 KQRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQL 1108
              +L +      EFK++++E+ +K+E+ N++L ++ KE  QL  +LNN ++RDVT TL L
Sbjct: 1086 SDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDL 1145

Query: 1109 LDEGESTNNSKMPNELQEKRTE--------GADATRQXXXXXXXXXXXXXXNDEV-MEVD 1159
            L E E T  ++ P    ++ T          ADA  +              +DE+ M+VD
Sbjct: 1146 LREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVD 1205

Query: 1160 EKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRR 1219
            +    +  G+PR+S+ EL ++D ++L  +I  LQ+++++V++++EILEEYAKRL E K+R
Sbjct: 1206 DCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKR 1265

Query: 1220 KVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDS 1279
            K+DLN +VGER+ +   + ELKK+R++EFM+GF IISMTLKEMYQMITMGGNAELELVDS
Sbjct: 1266 KIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDS 1325

Query: 1280 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1339
            LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1326 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1385

Query: 1340 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDIL 1396
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +NMTK+A+++N + L
Sbjct: 1386 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNREDL 1442

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1322 bits (3421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1334 (52%), Positives = 911/1334 (68%), Gaps = 13/1334 (0%)

Query: 69   APSLQHP--NSSSRGREQRTYXXXXXXXXXXXXXXKLELIKISPVKKNRLELQRLYDAEQ 126
             PSLQ P  +  SRGR Q  Y               +ELI++SP+K +RLELQRLYD +Q
Sbjct: 43   GPSLQPPVAHQISRGRSQ--YSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQ 100

Query: 127  SQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA 186
              +   RLCI  LVL++FKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLF FGFRA
Sbjct: 101  --KKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA 158

Query: 187  NKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNN 246
            NKMRQ +LS LIH SE +P+L  CSVE+ FQYVVDEPDGTTR+   KP L V RKAFKNN
Sbjct: 159  NKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNN 218

Query: 247  SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXX 306
            +SKYY+N KES YTEVT+LL+ EGIDLDHKRFLILQGEVE+IAQM+PKA           
Sbjct: 219  TSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEY 278

Query: 307  XXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXXXXXXXXXX 366
               I GT KYK QIE  L E++ LN+ C+EKENRF +V++EK SLE GKD          
Sbjct: 279  LEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEK 338

Query: 367  XXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVA 426
                  SK  QY ++ N  KL  TL   S    +L+QE  K  E  KE+  L D S+Q+A
Sbjct: 339  DLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLA 398

Query: 427  KRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEANLR 486
             R+ ++    K  LA+ R L+++ V+ EEK KS+ QK +KAEK L + + S+   E  + 
Sbjct: 399  NRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIE 458

Query: 487  ELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQ 546
            E      +YE  L  LN  ++  +A+LE +K++L +KT +I+  +A  EK+LEPW  +++
Sbjct: 459  EYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVE 518

Query: 547  QKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQEESDVTA 606
            +K++EI+L ESE+S++K+ + ++  +I  L  EI +       +E+ I  L  E S +  
Sbjct: 519  EKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRD 578

Query: 607  EVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRIS 666
             +     EC+SA ++L++M ++L+  RQR  DAR+A SSA+NK+ VLTAL++LQKSGRI 
Sbjct: 579  YILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRID 638

Query: 667  GFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDK 726
            G+HGRLGDLG ID+KYD+AISTACPRL+DIVV++VECGQQCIE+LRKNKLGYARFILLDK
Sbjct: 639  GYHGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDK 698

Query: 727  LRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFR 786
            LRKF+     TPENVPRLFDLVKPK+ KF PAFYSVLRDTL    L+QANRVAYGKKR+R
Sbjct: 699  LRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYR 758

Query: 787  VVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQ 846
            VV+LDGKLIDISGTM+GGG     GLM+ +Q +S    +++PEEV ++E EL E+EK+F+
Sbjct: 759  VVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSS----LYTPEEVQRMEEELNEREKNFK 814

Query: 847  IASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXXXXXXXXXXXATG 906
            +A +TF+EME  L+   DR PEI++++SK  M+ E+  +                  +  
Sbjct: 815  VAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIE 874

Query: 907  KNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQ 966
             + E + AE ++  L  +  +    + +  Q+I  L+ KIMEIGG ELQ  NSKV S  Q
Sbjct: 875  DSSELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQ 934

Query: 967  RMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLES 1026
            +++I+              E ELK++ K     + D++    EI  +K + D +   ++ 
Sbjct: 935  QIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQE 994

Query: 1027 VEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKE 1086
            ++K + + Q+    + ++    K  L Q       + S++IE+ ++L+KL  L  ++ KE
Sbjct: 995  LQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKE 1054

Query: 1087 VRQLESDLNNLKIRDVTRTLQLLDEG---ESTNNSKMPNELQEKRTEGADATRQXXXXXX 1143
            + + +S L++LK+RD+ + +  L+E    +S ++S  P+  +E        T        
Sbjct: 1055 MNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPN 1114

Query: 1144 XXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDV 1203
                    N+  MEVDE+   LENGLP++ ++EL  +D+EDL   I  LQ+Y+D+  VD+
Sbjct: 1115 ERKISIAENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDI 1174

Query: 1204 EILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMY 1263
            EIL+EYAKRLAE++RR++DLNEA+ +RD  R     LKKRR DEFM+GFGIIS+TLKEMY
Sbjct: 1175 EILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMY 1234

Query: 1264 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1323
            QMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY
Sbjct: 1235 QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1294

Query: 1324 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQN 1383
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK  N
Sbjct: 1295 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSN 1354

Query: 1384 MTKSASLKNNDILN 1397
            MT+S +L+N DI+N
Sbjct: 1355 MTRSTTLQNRDIIN 1368

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1317 bits (3409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1419 (50%), Positives = 965/1419 (68%), Gaps = 33/1419 (2%)

Query: 1    MPDT---PLTKRQRVNDNESREFEAVNG--STKSPL--------TSNSNSTIS--HTPKK 45
            MP++   P  KRQ+V ++ + E +  N     +SPL         S S   IS  HTP+K
Sbjct: 1    MPESTNIPSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSLSPPAISKSHTPRK 60

Query: 46   LVIGTNDDTTXXXXXXXXXXXXXAPSLQHPNSSS---RGREQ-RTYXXXXXXXXXXXXXX 101
            L++  +D+                PSLQ P +SS   RGR   + Y              
Sbjct: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 102  KLELIKISPVKKNRL-ELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
            KLELI++SPVK NR+ +LQ LY+   SQ    RL INKLVL +FKSYAG QV+GPF+++F
Sbjct: 121  KLELIQLSPVKNNRIRKLQELYN---SQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNF 177

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL SCSV+V FQYVV
Sbjct: 178  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVV 237

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            D+ +G+++ID+ KP L++TRKAFKNNSSKY++N KES+YTEVT+LLK+EGIDLDHKRFLI
Sbjct: 238  DKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLI 297

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVENIAQM+PKA              I GTA YK  IE    E++ LNE CIEKENR
Sbjct: 298  LQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENR 357

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F IV++EK+SLE+ K+               +SK++QY I +   KL STL K S L+ +
Sbjct: 358  FEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEE 417

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
               E+ K+  T +E + L+D  KQ+ K+I ++  + K   ++KR L  ++ ++EEKIKS 
Sbjct: 418  YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSY 477

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
             +K  KA K +  ++  L      +  L   Q + E  LQ L  EL  E+  LE++K+SL
Sbjct: 478  TRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSL 537

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            K+KT +IS  IAQ+E++LEPW  QLQ+K+ EIQ+AES++SLL++  +++  +IE+LKN++
Sbjct: 538  KDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDL 597

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
                E K  +E+ + +LK + S ++ E     +EC++A +++K M  +L  QRQ+ +DAR
Sbjct: 598  KCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDAR 657

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
            +  ++ +NKS VL+AL KLQKSGRISGF+GRLGDLGVID +YD+AISTA  RL+DIVV+S
Sbjct: 658  SRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDS 717

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VECGQ CIEYLRKNKLGYARFILL+KLR     +IQTPENV RLFDLVKP  D FIPAFY
Sbjct: 718  VECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY 777

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVLR+TL A+ L QANRVAYG  RFRVV++DGKLIDISGT++GGG    +GLM+L +   
Sbjct: 778  SVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQ 837

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
             + DI+S +++ ++E EL E+E +F+ A+DT+ EME  L++LKDR PE++L++SK +M+T
Sbjct: 838  ENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDT 897

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940
            +                       T   +E    E ++  L+ E + L D T    +KI 
Sbjct: 898  DISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKID 957

Query: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQ 1000
             LK +IMEIGG +LQ+QNSKV S IQ ++I+              ENE+++S K +   +
Sbjct: 958  KLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAE 1017

Query: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060
             D    S+E+ S  +  ++V+++L S++++  + ++ + E+  +   LK+++ + E   T
Sbjct: 1018 LDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGT 1077

Query: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKM 1120
            +FKS +I++ D+LEKLN LL HI + +++ +  L  L++R+ T      DEG++ + + +
Sbjct: 1078 KFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFG--DEGDNNSINGV 1135

Query: 1121 PNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEV---MEVDEKPHELENGLPRVSEAEL 1177
                 ++ + G     Q               +     ME+D+   E   G+PR+S+A+L
Sbjct: 1136 -----DRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKL 1190

Query: 1178 KSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKL 1237
              +DV+ L A+I  L+ YV   NV++++LEEYA+RLA++  RK+DLN+AV  R+A+++ L
Sbjct: 1191 LQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLL 1250

Query: 1238 GELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS 1297
             ELKK+R+DEFMQGFGIISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKS
Sbjct: 1251 DELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKS 1310

Query: 1298 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1357
            WRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA
Sbjct: 1311 WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1370

Query: 1358 QFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDIL 1396
            QFIVISLRNNMFELAQQL+GIYK  N TKSA+++N D L
Sbjct: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1311 bits (3392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/1386 (50%), Positives = 945/1386 (68%), Gaps = 49/1386 (3%)

Query: 40   SHTPKKLVIGTNDDTTXXXXXXXXXXXXXAPSLQ---HPNSSSRGREQRTYXXXXXXXXX 96
            S TP+KLV+G+  D                P LQ   +  SSSRGR    Y         
Sbjct: 34   SRTPRKLVLGS-PDKRFAFSQPVSSSSSNVPHLQPLKNELSSSRGR---VYSQSPPRSPN 89

Query: 97   XXXXXKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPF 156
                 KLELI++SP+KK+RLE Q+  ++     +  RLCI++LVL +FKSYAG QVVGPF
Sbjct: 90   RSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPF 149

Query: 157  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHF 216
            H+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIH SE+HP+L SC V++ F
Sbjct: 150  HNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFF 209

Query: 217  QYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHK 276
            QYV DEPDGTT I ++KP++V+ RKAF+NN+SKYY+N KES+YT +TQLL+ EGIDLDHK
Sbjct: 210  QYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHK 269

Query: 277  RFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIE 336
            RFLILQGEVE+IAQM+PKA              I GTA+YKP IE  L EI  LN+ C E
Sbjct: 270  RFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEE 329

Query: 337  KENRFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSK 396
            KENRF IV++EKSSLE GK+               RSK++QY +W+N+ KL ST +K +K
Sbjct: 330  KENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAK 389

Query: 397  LKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEK 456
             + +L  E  K ++  +E+ ++K + + +   +  L   EK L  +KR  D+ RV++EEK
Sbjct: 390  AQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEK 449

Query: 457  IKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDV 516
            +K++ QK  K+ + L+S   S++ T+A + EL   Q  +EK+L +LN  +  E+ KL+++
Sbjct: 450  LKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEI 509

Query: 517  KISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARI------- 569
            K SLK+K   IS  I + EK+LEPW+ +LQ+K+A+++L E+ +S+ K+++A+I       
Sbjct: 510  KSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILV 569

Query: 570  NKDIEQLKNEI--ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHE 627
            NK I++L+N++   RG    L KE+V         D+  ++    +EC +A  ++K+M  
Sbjct: 570  NKGIDELRNKMNEQRGSVFSLEKEQV---------DIGRQLTVGQSECDNAVKKIKEMKG 620

Query: 628  ILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAIS 687
            IL A RQR++DAR++ S+ +NK+ VL AL +LQ+SGRISGFHGRLGDLG ID+KYDVAIS
Sbjct: 621  ILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAIS 680

Query: 688  TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDL 747
            TACPRL+DIVVE+VECGQQCIEYLRKNKLGYARFILLDKLR F+   I+TPENVPRL+DL
Sbjct: 681  TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDL 740

Query: 748  VKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSH 807
            V+P + KF  AFYSVLRDTL A+ L +AN+VAYGK+R+RVV+LDGKLID+SGTMSGGG+ 
Sbjct: 741  VRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNF 800

Query: 808  VVRGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVP 867
              RG+M+  Q ++ +   F+ EEV Q++ EL+E+E +FQIA+DT  EME+ L+KLKDR P
Sbjct: 801  KARGMMKSEQQSNSA---FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREP 857

Query: 868  EIQLKVSKLVMETESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRA 927
            EI+L +SK  ++ +S  S                      NEE   AE ++K+LK E R 
Sbjct: 858  EIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRE 917

Query: 928  LSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXEN 987
            L ++  + ++++ VL+++IM++GG++LQ+Q+S V S  QR+ I+              + 
Sbjct: 918  LENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVL-------AKSKKTKT 970

Query: 988  ELKKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQ 1047
            +LKK+   +   QK  +  ++E+ S  +    ++  L+S  K VDE  +  +++ ++L+ 
Sbjct: 971  DLKKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELEL 1030

Query: 1048 LKQRLAQMEAGFTE-------FKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIR 1100
             ++R+ + E    E       F++L+I+   +L+KL  L   + KE  +    LN+LKIR
Sbjct: 1031 TEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIR 1090

Query: 1101 DVTRTLQLLDEG---ESTNN--SKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEV 1155
            DVT TLQ LDE    ES N   ++ P E   + +                        + 
Sbjct: 1091 DVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQA 1150

Query: 1156 MEVDEKPHE--LENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRL 1213
             E + +  E  L NGLP++ E EL++ +VE +  +I  LQ+YV++   D+EILEEYA+RL
Sbjct: 1151 GEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRL 1210

Query: 1214 AEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAE 1273
             E+K RKVDLN AV ERD +R+    LKK+R DEFM+GF  I M LKEMYQMITMGGNAE
Sbjct: 1211 IEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAE 1270

Query: 1274 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1333
            LELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1271 LELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1330

Query: 1334 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNN 1393
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +NMTKS +L+N 
Sbjct: 1331 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNT 1390

Query: 1394 DILNRT 1399
            D+++R+
Sbjct: 1391 DLIDRS 1396

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1298 bits (3360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1365 (50%), Positives = 919/1365 (67%), Gaps = 14/1365 (1%)

Query: 42   TPKKLVIGT-NDDTTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXXXXXXXXXXX 100
            TP KL+ G+                    PSLQ P  S   R +  Y             
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNRSPA 74

Query: 101  XKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160
             ++ELI++SP+K +RLELQ++YD +Q+     RL I  L+L +FKSYAG QVVGPFHSSF
Sbjct: 75   RRIELIQLSPIKNSRLELQKIYDGKQT--TTKRLSIKNLILNNFKSYAGVQVVGPFHSSF 132

Query: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIH SE H NL  CSVE+ FQYV+
Sbjct: 133  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYVM 192

Query: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280
            D+ DG T++  +   L V RK FKNN+SKYY+N KES+YTEVTQ L+ EGIDLDHKRFLI
Sbjct: 193  DDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLI 252

Query: 281  LQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENR 340
            LQGEVE+IAQM+PKA              I GTAKYK QI   L E++ LN+ C+EKE R
Sbjct: 253  LQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIR 312

Query: 341  FHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400
            F +V++EK SLE GK+               +SK +Q+ I +   KL  TLDK S    +
Sbjct: 313  FELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTEK 372

Query: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460
            L+ E  KY E  KE+  L++ S  + ++I  +  E+  L+  K  L ++ V+ EEK+KS+
Sbjct: 373  LENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSL 432

Query: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520
            NQK  KAEK L+  + ++   E N+R L ++Q ++E  L +LN+ L +ER++L+ +K+SL
Sbjct: 433  NQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMSL 492

Query: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580
            ++KT +IS  +A  EK+LEPW  +L+ K ++I+LAESE+ ++K++  ++ ++I QL+ +I
Sbjct: 493  RDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDI 552

Query: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640
                +     +K I +L++E + +T+ + TA  EC SA  +L  M ++L   RQR  DAR
Sbjct: 553  ESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDAR 612

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700
             A S+ +NK+ VL AL +LQKSGRI GFHGRLGDLG ID+KYD+AIS ACPRL+DIVVE+
Sbjct: 613  VALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVET 672

Query: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760
            VEC QQCIE+LRKNKLGYARFILLDKL+KF+  K+ TPENVPRLFDL  PK++ F PA Y
Sbjct: 673  VECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALY 732

Query: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820
            SVLRDTL A+ LAQANRVAYG +RFRVV+LDGKLIDISGTMSGGG  VV+GLM+  Q   
Sbjct: 733  SVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR-- 790

Query: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880
             S D+++ EEV ++E ELT++E +F+IA+DTF+EME  L+K KDR P I +++SK  ++ 
Sbjct: 791  -SNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDI 849

Query: 881  ESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940
            ++  S                      N   +  E ++  L  E  AL D++    ++I+
Sbjct: 850  DTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQIS 909

Query: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQ 1000
             L+ +IM+IGG +LQ QNSKV S  Q+++I+              E E+ +++K     +
Sbjct: 910  ELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAE 969

Query: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060
             D++    E++    + + +Q+ L   E  ++  +D   ++N++ +  K+ L    A   
Sbjct: 970  NDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVE 1029

Query: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG----ES-T 1115
            +FKS +IE+   LEKL  L  HI  E+ + + +LN LK+RDV + LQ LDE     ES T
Sbjct: 1030 KFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLT 1089

Query: 1116 NNSKMPNE--LQEKRTEGADATRQXXXXXXXXXXXXXXND-EVMEVDEKPHELENGLPRV 1172
            + +  P+   + E   E  DA                 ND E M+VD+    +  GLP++
Sbjct: 1090 DRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKL 1149

Query: 1173 SEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDA 1232
            +EAEL ++D+E+L  +I  L+ Y+D+   D++ILEEYA RLAE+KRRK+DLNE+V +R+ 
Sbjct: 1150 TEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREE 1209

Query: 1233 MREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1292
            +R +   LKK R +EFM GFGIISMT+KE+YQMITMGGNAELELVDSLDPFSEGV FSVM
Sbjct: 1210 IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVM 1269

Query: 1293 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1352
            PPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1270 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1329

Query: 1353 RTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397
            RTKNAQFIVISLRNNMFELAQQL+GIYK+ NMTKS +L+N DILN
Sbjct: 1330 RTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1372 (50%), Positives = 945/1372 (68%), Gaps = 32/1372 (2%)

Query: 40   SHTPKKLVIGTNDDTTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXX----XXXX 95
            S TP+KL++ + D                 PSLQHP S S GRE + Y            
Sbjct: 68   SRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHP-SVSTGREHKFYSQSPPRSPHRSP 126

Query: 96   XXXXXXKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGP 155
                   LELI++SP+K NR ELQ++Y+ +Q+Q+   RL I +LVL +FKSYAGRQVVGP
Sbjct: 127  VRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVVGP 186

Query: 156  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVH 215
            FH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIH SE +P L SCSVE+H
Sbjct: 187  FHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVEIH 246

Query: 216  FQYVVDEPDG-TTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLD 274
            FQYV+D+P+G  ++IDE K  LVV RKAFKNNSSKYY+NDKES++T+VT LLK EGIDLD
Sbjct: 247  FQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLD 306

Query: 275  HKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESC 334
            HKRFLILQGEVENIAQM+PK+              I GT+ YK QIE  L ++E LNE C
Sbjct: 307  HKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEIC 366

Query: 335  IEKENRFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKS 394
            IEKENRF+IV++EK SL  GK+               +SK  Q++++ ++ KLTSTL K 
Sbjct: 367  IEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKI 426

Query: 395  SKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRI-ETLAIEEKALLAQKRGLDQQRVAI 453
            +  +   D+E EKYS   KE+ +L+DE   + KR+ ET   EEK LL+ +R  + + ++ 
Sbjct: 427  TDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEK-LLSNQRKNNSELIST 485

Query: 454  EEKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKL 513
            +E IK++ +K + AEKL+ + + S+  T   L  L   Q DY K++++LN++L  E++KL
Sbjct: 486  QEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKL 545

Query: 514  EDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDI 573
            E++KISLK KT   S  I + EK+LEP+  QLQ+K ++IQL +SE+SLL +    ++ +I
Sbjct: 546  EEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEI 605

Query: 574  EQLKNEIARGGEEKLAKEKV---IRELKQEESDVTAEVHTAGAECSSASARLKKMHEILI 630
              +K  I    E+KL+  ++   I   KQ+  +   EV +   E +  + ++++M + L 
Sbjct: 606  ISIKKLIE---EKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLD 662

Query: 631  AQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTAC 690
            + RQ+  D+R + S+ QNK++VLTAL KLQKSGRISGF+GRLGDLGVIDEKYDVAISTAC
Sbjct: 663  SHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTAC 722

Query: 691  PRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKP 750
            PRLED+VV+SV+CGQQCI+YLRKN+LGYARFILLDKLRKF+  +I+TP+N PRLFDL++ 
Sbjct: 723  PRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQV 782

Query: 751  KDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVR 810
            ++DKF+PAFYSVLRDTL A +L  AN+VAYGK+RFRVV+LDGKLIDISGTMSGGG++V+R
Sbjct: 783  REDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLR 842

Query: 811  GLMRLSQN---NSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVP 867
            GLM+L Q+   N +     SPEEV +LE EL   EK+F++A ++ +EM  ++  +K+++P
Sbjct: 843  GLMKLGQDLPENDFEQT--SPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIP 900

Query: 868  EIQLKVSKLVMETESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRA 927
              +L +SK  +E E   +                   +  N+E ++A+ +++ LK E  +
Sbjct: 901  ATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS 960

Query: 928  LSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXEN 987
            L+DQT  T+Q+I  L+ +IM+ GG EL++QNSKVTS + +++I+               N
Sbjct: 961  LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNN 1020

Query: 988  ELKKSAKIVGNTQKDLDL-YSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLD 1046
             LKK    + NT KD  L +   + + K+    + + L  +E  +++ Q+   E+   +D
Sbjct: 1021 ILKKLQNEL-NTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNID 1079

Query: 1047 QLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTL 1106
              K++  ++E     FKS ++EI +KL+KL  L  H+ K++ +L+++LN L IR++++ L
Sbjct: 1080 GNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQNL 1139

Query: 1107 QLLDEGESTNNSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELE 1166
            +  DE            L++       AT                N + M++D   +E+ 
Sbjct: 1140 ESFDE-----------RLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEIN 1188

Query: 1167 NGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEA 1226
             G+ R+SE E+  LD+E L A+IE+L+  ++    ++EILEEY +RL+E+K+RK DL+E+
Sbjct: 1189 PGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDES 1248

Query: 1227 VGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1286
            + E++  +E+   LKK+R +EF  GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1249 ISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEG 1308

Query: 1287 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
            VTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1309 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368

Query: 1347 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398
            ANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK++NMT+SA+L NND+LNR
Sbjct: 1369 ANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNR 1420

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1258 bits (3256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1409 (48%), Positives = 938/1409 (66%), Gaps = 28/1409 (1%)

Query: 1    MPDTPLTKRQRVNDNESREF------EAVNGSTKSPLTSNSNSTISHTPKKLVIGTN-DD 53
            M   P  K+Q+V D ES         +       SPL   ++   S+TP K++I  N  +
Sbjct: 1    MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVIISNNHSN 60

Query: 54   TTXXXXXXXXXXXXXAPSLQHPNSSSRGREQRTYXXXX----XXXXXXXXXXKLELIKIS 109
            +               PSLQHP+SSSRGR  + Y                  KLELI++S
Sbjct: 61   SISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLS 120

Query: 110  PVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGS 169
            P+K +R ELQ++Y ++Q ++   R+C+NKLVL +FKSYAG Q +GPFHSSFSAVVGPNGS
Sbjct: 121  PIKNSRSELQKIYSSKQEEK-IERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGS 179

Query: 170  GKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRI 229
            GKSNVIDSMLFVFGFRANKMRQ +L+DLIH SE +P+L SC+V+VHF+Y++D PD TT+I
Sbjct: 180  GKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKI 239

Query: 230  DEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIA 289
            +  K  L++TR+AFKN++SKYY+N KESNY  +T LLK+EGIDLDH RFLILQGEVENIA
Sbjct: 240  NPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIA 299

Query: 290  QMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKS 349
            QM+PKA              I GT KYK  I+    EIE LN+ CIE+ENRF I+D+EK 
Sbjct: 300  QMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKE 359

Query: 350  SLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYS 409
            SLE+ K+               +SK+IQYKIWQN+IKL++TL+K +KL+ + +QE  K +
Sbjct: 360  SLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNT 419

Query: 410  ETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEK 469
            E   ++D L+    +    ++ L  +EK L+  KR LD   V+  E++K++ +K  K  K
Sbjct: 420  ELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAK 479

Query: 470  LLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISA 529
             ++ +  +++++   L+    ++  +E +L +L+  L+TE   LE++K+ LK+KTV +S 
Sbjct: 480  EIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSE 539

Query: 530  GIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLA 589
             I + EKDLEPW+ +L + ++EIQ+ ESE +L +++  ++  +IE L+ ++    +    
Sbjct: 540  EILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTED 599

Query: 590  KEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNK 649
            + K ++ L  +  +V+ EV     E   A+ +L +M +ILI  RQ+  DAR + S+ +N+
Sbjct: 600  RRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENR 659

Query: 650  STVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIE 709
            S VL AL KLQKSGRI+GFHGRLG+LGVIDEKYDVAISTACPRL DIVV+SVECGQQCIE
Sbjct: 660  SKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIE 719

Query: 710  YLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAA 769
            YLRKN LG+ARFILLDKL KF   KI TP NVPRLFDL+K  D+KF+PAFYSVLR+TL A
Sbjct: 720  YLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVA 779

Query: 770  QSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPE 829
              L +AN VAYGK R+RVV+L G LIDISGTMSGGG+   +G M+LS + S     +S E
Sbjct: 780  NDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSKEKSTYSSE 839

Query: 830  EVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXX 889
            EV ++E EL+ +EK++Q A +T +EME +L+ LK+  P+I+L++SKL  E +S  +    
Sbjct: 840  EVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSL 899

Query: 890  XXXXXXXXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEI 949
                              + +    +  + TL ++Q+ +  Q  + + +I  L+DKIM+I
Sbjct: 900  KRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKI 959

Query: 950  GGSELQIQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQE 1009
            GG +LQ+QNSKV S  ++ +IL              E++++K +K +  ++ D    +++
Sbjct: 960  GGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEK 1019

Query: 1010 IASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEI 1069
              +L+    N+++ L   E +++  QD    + EK +     L +ME   +EFK+L++E 
Sbjct: 1020 KIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEY 1079

Query: 1070 NDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRT 1129
              K EKL +LL  I K ++ LE D ++L IR+V   L LL+  E         E Q+ +T
Sbjct: 1080 KIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQ--------EAQKIKT 1131

Query: 1130 EGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQI 1189
            E      Q              NDE++ +++  +E+  G+P   E++ K  D+  L A++
Sbjct: 1132 ELYADFEQ-------NQSNDVINDEMI-IEDNNNEIAKGIPSYMESDFKQFDISSLEAEL 1183

Query: 1190 EDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFM 1249
              LQ+Y +   VD++ILEEY +R+ E+++RK DLN++V +RD +R++L +LKK RF+EFM
Sbjct: 1184 VQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFM 1243

Query: 1250 QGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1309
            + F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEK
Sbjct: 1244 ESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEK 1303

Query: 1310 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1369
            TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF
Sbjct: 1304 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1363

Query: 1370 ELAQQLVGIYKTQNMTKSASLKNNDILNR 1398
            ELA+QLVGIYK  N TKSA+LKNNDIL R
Sbjct: 1364 ELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1204 bits (3114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1404 (48%), Positives = 927/1404 (66%), Gaps = 50/1404 (3%)

Query: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDD---TTXX 57
            + D+P  KRQRV+ + +R                       TP+KLV+G+ +     +  
Sbjct: 10   LGDSPEIKRQRVSQSPTR-----------------------TPRKLVLGSPEKKYAVSNS 46

Query: 58   XXXXXXXXXXXAPSLQHPNSSS-RGRE-QRTYXXXXXXXXXXXXXXKLELIKISPVKKNR 115
                        PSLQ P + + RGRE  ++               KLELI++SP K  R
Sbjct: 47   QATTAASNTMDPPSLQPPTAHAVRGREYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTR 106

Query: 116  LELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVI 175
            LELQ++++A  + + + RLCI+KLVL +FKSYAG Q +GPFH+SFSAVVGPNGSGKSNVI
Sbjct: 107  LELQKMHEA--NTQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVI 164

Query: 176  DSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPT 235
            DSMLFVFGFRANKMRQ +LS+LIH SE  P+L SCSV++HF YV D  +G T+I     T
Sbjct: 165  DSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGT 224

Query: 236  LVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKA 295
            +VV R+AFKNNSSKYYVN KESNYTEVT+LLK+EGIDLDHKRFLILQGEVE+IAQM+ KA
Sbjct: 225  MVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKA 284

Query: 296  XXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGK 355
                          I GTAK+KPQIE  L+EIE LNE C+EKENRF +VD+EK +LE+GK
Sbjct: 285  EKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGK 344

Query: 356  DXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEV 415
            +               +++++Q +I+ ++ KL ++ DK S L  +  +E  +Y    KE 
Sbjct: 345  EEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEA 404

Query: 416  DSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQ 475
            ++L  E     K    L  E K + ++KR L++  +A +EK+KS+ +K   AEK    ++
Sbjct: 405  ETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSE 464

Query: 476  HSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYE 535
             +  A    +  L+++  D E EL +LN  +  E+ KL ++KI L EKT ++S  +   E
Sbjct: 465  SNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLE 524

Query: 536  KDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIR 595
            + LEP+  Q+Q+K++EI+L+E+++++LK +++ + K+   ++++I     E+L +++   
Sbjct: 525  RQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKETET 584

Query: 596  ELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTA 655
             L+ E+S V A + TA  EC  A  +  +M ++LI QRQ   +A+A  +  QNK+ VL A
Sbjct: 585  SLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLA 644

Query: 656  LTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNK 715
            LTKLQ SGRI+GFHGRLGDLG ID++YD+AISTACPRL+DIVVE+VECGQQCI++LRKNK
Sbjct: 645  LTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNK 704

Query: 716  LGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQA 775
            LGY RFILLDKLRK +  +I TPENVPRLFDL+ P  D F PAFYSVLRDTL A+ L QA
Sbjct: 705  LGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQA 764

Query: 776  NRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLE 835
            NRVAYGK+RFRVV+LDGKLIDISGTMSGGGS    GLMR   + + +   +S +EV ++E
Sbjct: 765  NRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR---SKATTASQYSRDEVEKME 821

Query: 836  NELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXXX 895
             +L+ KE +++ A     EME  L+KL DR+PEI +++SK+ +E  S ++          
Sbjct: 822  VQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLS 881

Query: 896  XXXXXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQ 955
                         +     E ++  L+   +   D +  ++ KI  LKD+IM+ GG EL+
Sbjct: 882  QLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELK 941

Query: 956  IQNSKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLKE 1015
            +Q +KV S  Q +EIL              + +L ++ +      +++ + +++I+ L E
Sbjct: 942  MQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSE 1001

Query: 1016 NADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEK 1075
              ++++   E +E+ V E  +   E+N  +++LKQ L  +E    EFK+ ++E +D+LEK
Sbjct: 1002 QLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEK 1061

Query: 1076 LNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG--ESTNNSKMPNELQEKRTEGAD 1133
            L+ L  ++ K++R  E+ L +LKIRDV++ L  L++G  ES  +      +  K   G  
Sbjct: 1062 LHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTD------VTAKVMNGDI 1115

Query: 1134 ATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQ 1193
               Q              N++ ME D       +GLP ++E EL++LD+E L  ++  LQ
Sbjct: 1116 VQTQ--------SITDVGNNDAME-DSGEAATHSGLPSLTETELENLDLETLELELHQLQ 1166

Query: 1194 NYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFG 1253
            +Y+D+ N D+E+LEEYA+RLAE++RRK+DLN+AV +R+ +R K    K  R ++FM+GFG
Sbjct: 1167 DYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFG 1226

Query: 1254 IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSS 1313
            IISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSS
Sbjct: 1227 IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSS 1286

Query: 1314 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ 1373
            LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ
Sbjct: 1287 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ 1346

Query: 1374 QLVGIYKTQNMTKSASLKNNDILN 1397
             LVGIYK  NMTKS +L+N DIL+
Sbjct: 1347 NLVGIYKNNNMTKSTTLQNIDILH 1370

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1174 bits (3037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/1415 (47%), Positives = 919/1415 (64%), Gaps = 35/1415 (2%)

Query: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTXXXXX 60
            M D P++KRQ+V + +  E   V  + K+     S   I  TP+ L+   N +       
Sbjct: 1    MSDRPVSKRQKVTEEDEEE--DVIHTPKAVTFEQSPRAI--TPRNLLGSENRNVLPTGGS 56

Query: 61   XXXXXXXXAPSLQHPNS--SSRGREQRTYXXXXXXXXXXXXXXKLELIKISPVKKNRLEL 118
                     PSL  P S  S+RGR+ ++Y              +L+LI++SP+K +R EL
Sbjct: 57   QNLQ----IPSLLPPESLGSARGRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAEL 112

Query: 119  QRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM 178
            Q+LY++++      RL I++LVL DFKSYAGRQV+GPFH+SFSA+VGPNGSGKSNVIDSM
Sbjct: 113  QKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM 172

Query: 179  LFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVV 238
            LFVFGFRANKMRQDRLSDLIH SE  P+LKSCSVEVHF+YV+D+ DG+T IDE K  LVV
Sbjct: 173  LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV 232

Query: 239  TRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXX 298
            TRKAFKNN+SKY+VN KESNYTEVT LLKKEGIDLDHKRFLILQGEVENIAQM+ KA   
Sbjct: 233  TRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKE 292

Query: 299  XXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXX 358
                       I GT+KYK  IE +  EIE LNE C+EKENRF IV++EK+SLE+GK+  
Sbjct: 293  NDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEA 352

Query: 359  XXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSL 418
                         +SK+ QY + Q++ KL   L+K + ++ +  ++ +++ +    +  +
Sbjct: 353  LQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDI 412

Query: 419  KDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSL 478
                  +   +E +  EE  L   KR L+ ++V  E+ + +++ K  + E+  K  Q  +
Sbjct: 413  TASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKI 472

Query: 479  NATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDL 538
            N+T+  ++ + + Q    +    L+  L  E+ KLE++K+ L+EKT +++  IA+YEK+L
Sbjct: 473  NSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKEL 532

Query: 539  EPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELK 598
             PW+ Q QQ + EI++ ESELS++++    +  DI  L+N I     +   +E+ I+ L 
Sbjct: 533  SPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLL 592

Query: 599  QEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTK 658
            ++++ V  E      EC +A A L  + E + A RQ+ ++ R+ +S+ +N + VL+AL +
Sbjct: 593  EQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLR 652

Query: 659  LQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGY 718
            LQKSGR++GFHGRLGDL VID KYDVAISTACPRL D+VV++VE GQQCIEYLRKNKLGY
Sbjct: 653  LQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGY 712

Query: 719  ARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRV 778
            ARFILLDKL  F+T +I TP+   RLFDL+  K+ +F  AFYSVLRDTL  Q++ QANRV
Sbjct: 713  ARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRV 772

Query: 779  AYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENEL 838
            AYGKKR+RVV+LDG LID+SGTM+GGG +V +GLM+LS+++S     FSPEEV  +ENEL
Sbjct: 773  AYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENEL 832

Query: 839  TEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSXXXXXXXXXXXXX 898
             +KE  ++ A D + EME++L++L+DR PEI   VSK  M+ E+  +             
Sbjct: 833  NQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKR 892

Query: 899  XXXXXATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQN 958
                    +N+      A++K LK +   +  QT +T+ KI  +KDKI+E+GG EL+ Q+
Sbjct: 893  KKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQS 952

Query: 959  -------SKVTSTIQRMEILTXXXXXXXXXXXXXENELKKSAKIVGNTQK---DLDLYSQ 1008
                   +K++   +R++ +                EL ++ + + N  K   + D+ S+
Sbjct: 953  LLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESK 1012

Query: 1009 EIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIE 1068
            EI S       +    ES+E   + +  L HE+  K ++L+      +   +++KS+ +E
Sbjct: 1013 EIES------KLLDIKESIENLKENEVKLEHEIEMKHNELESH----QKVVSDYKSISLE 1062

Query: 1069 INDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKR 1128
             N+KLEKL A    + K +++    L+ L IRDVT+ L  +   E+ +  K   +L+   
Sbjct: 1063 YNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTS 1122

Query: 1129 TE-GADATRQXXXXXXXXXXXXXXNDEV----MEVDEKPHELENGLPRVSEAELKSLDVE 1183
                AD                  ND++    ME+D +   +  G+P +S +EL  +D +
Sbjct: 1123 AVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQ 1182

Query: 1184 DLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKR 1243
            ++   I  L +++ S   +V++LEEYA R  E  +RK DLN AV  RD+++++L  +K++
Sbjct: 1183 EVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRK 1242

Query: 1244 RFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1303
            R+DEFM+GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+N
Sbjct: 1243 RYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISN 1302

Query: 1304 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1363
            LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS
Sbjct: 1303 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1362

Query: 1364 LRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398
            LRNNMFEL +QLVGIYK +NMTKSA+L N D++ R
Sbjct: 1363 LRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGR 1397

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  219 bits (558), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 330/1345 (24%), Positives = 590/1345 (43%), Gaps = 222/1345 (16%)

Query: 139  LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
            L L +FKSY G   V    S+F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 199  H----NSEVHPNL--------KSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNN 246
            +    + E  P          ++  V+  ++Y     DG          + + R   +  
Sbjct: 67   YRDIISRENTPTGADNDENGNRTAYVKAFYEY-----DG--------KVVELMRLISRLG 113

Query: 247  SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXX 306
             + Y ++     Y E +Q L+ + I +  K FL+ QG+VE IA   P             
Sbjct: 114  DTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEE---- 169

Query: 307  XXXITGTAKYKPQIETILQEIEVLNESC---IEKENRFHIVDQEKSSLETGKDXXXXXXX 363
               ++G+ +YK + E +  + + + ++    I+K  R H      + L+T K+       
Sbjct: 170  ---VSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIH------AELKTYKEGMSRDEE 220

Query: 364  XXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESK 423
                    +       +WQ                     E+E+Y + L++++  +++  
Sbjct: 221  YRKYVQKKKRVQTNLSLWQ-----------------LYHMEDERY-QCLQKLEESQNDVD 262

Query: 424  QVAKRIETLAIEEKALLAQKRGLDQQRVAIEEK---IKSVNQKTNKAEKLLKSNQHSLNA 480
             + +++E    EEK L   K+ L ++ V + +K   I+S++++  KAE  LK  +   NA
Sbjct: 263  VIREKLEA---EEKNLEVFKKALSKEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNA 319

Query: 481  TEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISA----------- 529
            +   L+ L       +K +  L ++L  E A LE  K  LK  T + +A           
Sbjct: 320  SINRLKNL-------DKRVDSLQKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSKN 372

Query: 530  --GIAQYEKDLEPWD---GQ-LQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARG 583
                   E DL+ +D   G+ L     EI   E  L+LL +    I  D++ + +++   
Sbjct: 373  NNKFTLSEDDLKLYDELKGEYLNNGGIEI---EDTLNLLDNKKEEITADLKIINDKV--- 426

Query: 584  GEEKLAKEKVIREL--KQEESDVTAEVHTAGAECSSAS-ARLKKMHEILIAQRQRTLDAR 640
               +++K+++  EL  K+EE D  A++  +    +  +     K+ E+   Q+       
Sbjct: 427  ---EISKQRIEDELVTKKEEQD--AKIRDSTLLLNEKNDLHSHKLDELRKTQKDIEYWNN 481

Query: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRL------------GDLGVIDE-------K 681
              F         L  L  L  + R S    +L            G  G++ E       K
Sbjct: 482  KEFDLNHKLRDTLVKLDDLNATQRESNKERKLRENVAMLKRFFPGVRGLVHELCKPKRDK 541

Query: 682  YDVAISTACPR-LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPEN 740
            Y +A+ST   +  + ++V+S+   Q+CI +L+K + G   FI LD +    T ++  PE+
Sbjct: 542  YKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDA-ATPRMPVPES 600

Query: 741  --VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDI 797
                   + V+ KDD  + A Y V  DT+   +L  A  + + K    ++V+LDG LI+ 
Sbjct: 601  ETYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINK 659

Query: 798  SGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMED 857
            +G M+  G        R  ++   S      + +  +E    +  +S  IA    RE+E 
Sbjct: 660  TGLMT--GGITSDSANRWDKDEYQSLLDLKDKLIVDVEEAANKSRQSTLIA----RELEI 713

Query: 858  QLKKLKDRVPEIQLKVS---KLVMETESWMSXXXXXXXXXXXXXXXXXXATGKNEEYQLA 914
             L  L   +  I+ +++   + V ETE+ ++                      + E+   
Sbjct: 714  SLSSLTSEISYIRTQITQTKRAVEETETEINHHNNLI----------------DREFI-- 755

Query: 915  EARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTXX 974
              +VK L+++   L D+      K   L++K      + L     KV  T++  E  T  
Sbjct: 756  -PQVKDLENKISGLEDEIRDWNTKREALQEKCF----ARL---TEKVGFTMKDYESHTGE 807

Query: 975  XXXXXXXXXXXENELKKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQ 1034
                         EL+   K + N +  ++  +    + K+   NVQ+T  SV+      
Sbjct: 808  MIRKQTK------ELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQ------ 855

Query: 1035 QDLSHEMNEKLDQ---LKQRLAQMEAGFT----EFKSLKIEINDKLEKLNA---LLGHIT 1084
                HE+NE +DQ   +K  +  +E        E KS+K   + K +  +A   ++    
Sbjct: 856  ----HELNELVDQEKSIKLSIETLEGELDGKNEELKSIKAAFDSKQKDASATEDIISEYN 911

Query: 1085 KEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTEGADATRQXXXXXXX 1144
              +  +ESD N +K  D+TR    L++     N ++   +    +E              
Sbjct: 912  NRLASIESDRNEIK-DDITRLD--LEKMSILKNCQVSGIIVPVVSEVG----------LE 958

Query: 1145 XXXXXXXNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVE 1204
                   +DE +E+ +K     + LPR  +    +   +DL  QI D+ + ++ +  +  
Sbjct: 959  ELPASKVDDEAIEIAKKIEIDFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNAR 1018

Query: 1205 ILEEYAKRLAEHKRRKVDLNEAVG----ERDAMREKLGELKKRRFDEFMQGFGIISMTLK 1260
             +E +    A+ +  +VD  E  G    ER    E L ++K++R + F   F  I+  L 
Sbjct: 1019 AVERFDD--AKSRFDEVD-KETEGLKTEERKVFDEFL-KVKQKRKELFENAFEKINEHLD 1074

Query: 1261 EMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTL 1311
             +Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+
Sbjct: 1075 AIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTV 1134

Query: 1312 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFE 1370
            ++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE
Sbjct: 1135 AALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFE 1194

Query: 1371 LAQQLVGIYKTQ--NMTKSASLKNN 1393
             +  LVG+++ Q  N +K  +L  N
Sbjct: 1195 KSDALVGVFRQQQENSSKIVTLDLN 1219

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 128/220 (58%), Gaps = 17/220 (7%)

Query: 1191 DLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDA-------MREKLGELKKR 1243
            +LQ  +D +N  + +L+  +K    ++  KV       E +        + E+  ++++ 
Sbjct: 1003 ELQRSIDELNELLTVLQPNSKAAGRYEEAKVKYESIFKETEKCKTKEKKVNEQFAKIRRL 1062

Query: 1244 RFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPP 1294
            R D F   F  +S  + ++Y+ +T          GGNA L L D  +P+  G+ +   PP
Sbjct: 1063 RKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPP 1122

Query: 1295 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
             K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R 
Sbjct: 1123 TKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRA 1182

Query: 1355 -KNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNN 1393
              N QFIVISL+N MFE +Q LVG+++ Q    S +L  N
Sbjct: 1183 LSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTLN 1222

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 176/730 (24%), Positives = 318/730 (43%), Gaps = 132/730 (18%)

Query: 141 LQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHN 200
           L +FKSY G+  +G   S+F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI+ 
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 201 ------------SEVHP---NLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKN 245
                       SE H    N  S  V+  +      P G     +E     +TR    +
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSAYVKAFYS-----PSG-----QENDVAELTRTITLS 118

Query: 246 NSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXX 305
             S Y +N +  ++ +    L+ E I +  + FL+ QG+VE +A  +P+           
Sbjct: 119 QESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPR-------ELTT 171

Query: 306 XXXXITGTAKYKPQIETILQEIEVLNESC---IEKENRFHIVDQEKSSLETGKDXXXXXX 362
               ++G+ +YK + + + +E+E    +    I+   R +I  +   S + G +      
Sbjct: 172 LFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLK---SFKEGVNKDEEYR 228

Query: 363 XXXXXXXXXRSKMIQYKIWQNDIK---LTSTLDKSSKLKGQLDQE--------------- 404
                    + ++I ++++    K   LT +L  S +    LD E               
Sbjct: 229 KHLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIVAKKKLSY 288

Query: 405 NEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKT 464
            +K +   K+   L D++K+V     +L      + + K  +D++  A   KI+S+ +  
Sbjct: 289 AKKQTLAAKQRTRLSDKTKKVDHLTSSLL----PIKSSKESIDKRLSAAVTKIESLQRDI 344

Query: 465 NKAEKLLKSNQHSLNAT-------EANLRELRQSQLDYEKELQDLNQELITERAKLEDVK 517
           ++ E L+K  +H L          +A + E  +S  D++     LN+  +    + ED+K
Sbjct: 345 DRQESLVKQYEHQLKVVNKAKTNFQAEIDESAKSSGDFK-----LNEANL---KRYEDLK 396

Query: 518 ISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLK 577
            +       +S+G ++ E  L     + Q+   EI+L   +L     +  ++N+++    
Sbjct: 397 ETF------LSSGGSELEDKLLLEKNESQEISDEIELYSRQLDA---SRLKVNEEL---- 443

Query: 578 NEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTL 637
                 G EK A E  + EL +E S  T++V          SA +KK+ E  +  R    
Sbjct: 444 ------GAEKEALENEVSELTKELSGKTSQV----------SAAVKKLKE--LQSRAEYN 485

Query: 638 DARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRL------------GDLGVID------ 679
           + R    S + K T LT L  +  + R +    +L            G  G++       
Sbjct: 486 NNREYEVSFKLKET-LTKLDDMNATQRETAKERKLRENVSILRRLFPGVRGLVHELCRPK 544

Query: 680 -EKYDVAISTACPR-LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL--RKFHTGKI 735
            EKY VA+ST   +  + ++V+     QQC+ +L+K + G   FI LD +   K     +
Sbjct: 545 KEKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMAL 604

Query: 736 QTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKL 794
            T +      D +  + D    A   V  D++   SLA A  + + +  R ++VSLDG +
Sbjct: 605 DT-KGCTLAIDAIDYERD-LERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSI 662

Query: 795 IDISGTMSGG 804
           +  +G M+GG
Sbjct: 663 VHKAGLMTGG 672

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  141 bits (356), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 107/164 (65%), Gaps = 11/164 (6%)

Query: 1229 ERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDS 1279
            ER A+++ L ++KK+R + F   F  +S  L  +Y+ +T          GGNA L L D 
Sbjct: 1052 ERKALQQFL-KIKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDE 1110

Query: 1280 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1339
             +PF+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1111 DEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALD 1170

Query: 1340 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
              NV  +A YI+     N QFIVISL+N MFE +  LVG+++ Q
Sbjct: 1171 ITNVERIAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQ 1214

 Score =  140 bits (354), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 175/709 (24%), Positives = 321/709 (45%), Gaps = 80/709 (11%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 199 HNSEV--------HPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
           +   +        H  + S  V+  ++    +       D+E+P  ++ R    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERPVELM-RAISTNGDTTY 125

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXI 310
            +N K   Y E ++ L++E I +  K FL+ QG+VE IA   P                +
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSP-------MDLSKLFEEV 178

Query: 311 TGTAKYKPQIETILQEIEVLNESCIEK-ENRFHIVDQEKSSLETGKDXXXXXXXXXXXXX 369
           +G+ +YK + + + ++IE LN+S  E   NR  I       L+T K+             
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRI----HGELKTYKEGITKDEEYKNNIE 234

Query: 370 XXRSKMIQYKIWQ-----NDIKLTSTLDKSSKLKGQLDQENEKYSETLKEV----DSLKD 420
             +   +   +WQ     N+ K   +LD     K ++ Q   K +   K +     S   
Sbjct: 235 KRKKYYMYLVLWQLYHLENEKK--KSLDNLKNAKSEISQLKNKITNEEKNLQRSKSSFLK 292

Query: 421 ESKQVAKRIETLAI---EEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHS 477
           E+ +V K+ E L     E+  LL     +   + A  ++I ++ ++    +K ++  Q  
Sbjct: 293 ENLKVNKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKDIERQQGY 352

Query: 478 LNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKD 537
           +N  E  L+ + +++  +E+E+++  Q   + +  L D  + L E ++N        EK 
Sbjct: 353 INTFENQLKVVTKAKESFEREIKESAQN--SNKYSLSDDDLKLYE-SLN--------EKY 401

Query: 538 LEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARG---GEEKLAKEKV- 593
           L      ++Q   +I L  ++   + +   R+N+ I+  K  I       +E++  E + 
Sbjct: 402 LMENGSAIEQ---QISLLNNDKQEVLEEMDRLNRKIDASKKRITEELLISQERIQNENIE 458

Query: 594 -IRELKQEE---SDVTAEVHTAGAECSSASARL----KKMHEILIAQRQRTLDARAAFSS 645
            +  L ++    S+ T E+ T  AE  S++ +      K+ E L+       + R +   
Sbjct: 459 LVSSLNEKNSIFSEKTHELKTLQAEIESSNNQEYDTNYKLRETLLKLDDLNANQRESIKE 518

Query: 646 AQNKSTVLTALTKLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVESVEC 703
            + +  V T L +        G  G + DL     +KY +A+ST   +  + I+V+++  
Sbjct: 519 KKLRENV-TMLKRF-----FPGVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNV 572

Query: 704 GQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKP-----KDDKFIPA 758
            Q+CI + +K + G A FI LD +        Q   N+P   D +        D ++  A
Sbjct: 573 AQECIAFFKKQRSGTASFIPLDTI-----SSEQPTLNLPSSQDYILTINAIEYDPEYERA 627

Query: 759 FYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGS 806
              V  D++   SL  A  + + K  R ++V+++G LI  +G M+GG S
Sbjct: 628 MQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTGGIS 676

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  141 bits (355), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 109/171 (63%), Gaps = 10/171 (5%)

Query: 1233 MREKLGELKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1283
            + E    +K+ R + F + F  +S ++ E+Y+ +T          GGNA L L D  +P+
Sbjct: 1049 VNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPY 1108

Query: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1109 LAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNV 1168

Query: 1344 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNN 1393
              VA+YI+ +   + QFIVISL+N MFE +Q LVG+++ Q    S +L  N
Sbjct: 1169 ERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTLN 1219

 Score =  105 bits (261), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 178/376 (47%), Gaps = 55/376 (14%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G+  +G   S+F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 199 HN--------------SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFK 244
           +               SE HPN  S  V+  +    +E D           + ++R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPN--SAYVKAFYSPSNNEDD----------VVELSRTVTR 114

Query: 245 NNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXX 304
           +  S Y ++ K   Y + +Q L+ E I +  + FL+ QG+VE +A  +P+          
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQ-------ELT 167

Query: 305 XXXXXITGTAKYKPQIETILQEIEVL---NESCIEKENRFHIVDQEKSSLETGKDXXXXX 361
                ++G+ +YK   + I +E+E        CI+   R HI  +   S + G D     
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHIGLK---SFKEGVDKDEEY 224

Query: 362 XXXXXXXXXXRSKMIQYKIWQNDIKLTSTLD--KSSK-----LKGQLDQENE-----KYS 409
                     + ++I ++++    K  + +D  K SK     L+   ++E++     K S
Sbjct: 225 RKHLEDRNNLQQQLIVWQLFHLQAKRENLIDKLKHSKEVLQNLQSNFNREDKILKTRKSS 284

Query: 410 ETLKEVDSLKDESKQVAKRIETLAIEEKALLA---QKRGLDQQRVAIEEKIKSVNQKTNK 466
            T  +   +K +SK ++ R++   +   ++L     K G+ ++ VA E KI+S+ +  ++
Sbjct: 285 YTKTQALVVKQKSK-LSARMKAKDLLTSSVLPIKLSKEGVSKRIVAAETKIESLQKDIDR 343

Query: 467 AEKLLKSNQHSLNATE 482
            E L+K  +  L   E
Sbjct: 344 QEILVKQYRRQLKVVE 359

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1290
            +KKRR + F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
            +     N QFIVISL+N MFE +  LVG+Y+ Q
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQ 1206

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 107/163 (65%), Gaps = 12/163 (7%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +KK+R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKTQ--NMTKSASL 1390
             + R  + QFIVISL+N MFE +  LVG+Y+ Q  N +K+ +L
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTVTL 1257

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 111/228 (48%), Gaps = 39/228 (17%)

Query: 126 QSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFR 185
           ++Q    RL    L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R
Sbjct: 32  KNQSTMGRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVR 89

Query: 186 ANKMRQDRLSDLIH-----------------NSEVHPNLKSCSVEVHFQYVVDEPDGTTR 228
           +N +R + L DLI+                 ++ +  N  S  V+  +Q       G   
Sbjct: 90  SNHLRSNILKDLIYRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQ------KGNKL 143

Query: 229 IDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENI 288
           ++       +TR   +N  + Y ++ K   Y + +  L+ E I +  K FL+ QG+VE I
Sbjct: 144 VE-------LTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQI 196

Query: 289 AQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIE 336
           A   P                ++G+ +YK + + + ++IE L++S  E
Sbjct: 197 AAQSP-------TDLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 237

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 104/153 (67%), Gaps = 10/153 (6%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +KK+R + F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ + 
Sbjct: 1050 IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYH 1109

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI
Sbjct: 1110 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYI 1169

Query: 1351 KERT-KNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
            ++ +  + QFIVISL+N+MFE +  LVGI++ Q
Sbjct: 1170 RKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQ 1202

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 21/164 (12%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 199 H--------NSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
           +        N       +S  V+  +     E DGT         + + R       S Y
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFY-----EKDGT--------VVELMRAITAGRDSVY 113

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
            +++K + Y   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 114 KIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 107/163 (65%), Gaps = 12/163 (7%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +K++R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKTQ--NMTKSASL 1390
             + R  + QFIVISL+N MFE +  LVG+Y+ Q  N +K+ +L
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

 Score = 95.5 bits (236), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 103/217 (47%), Gaps = 39/217 (17%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 199 HNS-------------------EVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVT 239
           +                         N KS  V+  +Q       G   ++       + 
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVE-------LM 113

Query: 240 RKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXX 299
           R   +N  + Y ++ K  +Y + +  L+ E I +  K FL+ QG+VE IA   P      
Sbjct: 114 RIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSP------ 167

Query: 300 XXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIE 336
                     ++G+ +YK + + + ++IE L +S  E
Sbjct: 168 -IELSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  137 bits (346), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +K++R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
             + R  + QFIVISL+N MFE +  LVG+Y+ Q
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ 1211

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 11/147 (7%)

Query: 667 GFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVESVECGQQCIEYLRKNKLGYARFILL 724
           G  G + DL     EKY +A+ST   +  + ++VE++   Q+CI +L+K + G A FI L
Sbjct: 531 GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 590

Query: 725 DKLRKFHTGKIQTPENVPRLFDL----VKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAY 780
           D +       +  P++   +  +     +P+ +K   A   V  D++   SL  A  + +
Sbjct: 591 DTIET-ELPTLSLPDSQEYILSINAIDYEPEYEK---AMQYVCGDSIICNSLKIAKGLKW 646

Query: 781 GKK-RFRVVSLDGKLIDISGTMSGGGS 806
            K  R ++V+++G LI  +G M+GG S
Sbjct: 647 NKGVRAKLVTIEGALIHKAGLMTGGIS 673

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  137 bits (345), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 113/170 (66%), Gaps = 12/170 (7%)

Query: 1233 MREKLGELKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1283
            +RE+  ++K+ R + F + +  +S  + ++Y+ +T          GG+A L L D  +P+
Sbjct: 1052 IREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEPY 1111

Query: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
              G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTNV 1171

Query: 1344 SIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKTQ--NMTKSASL 1390
              +A YIK   + N QFIVISL+N+MFE +Q LVG+++ Q  N +K  +L
Sbjct: 1172 EKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVITL 1221

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 103/154 (66%), Gaps = 12/154 (7%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +KK+R + F + F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1351 KERTKNA--QFIVISLRNNMFELAQQLVGIYKTQ 1382
             +R  N   QFIVISL+N+MFE ++ LVGIY+ Q
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQ 1204

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 88/163 (53%), Gaps = 27/163 (16%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 199 H------------NSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNN 246
           +            N +V+PN  S  V+  +Q             +E  T  + R    + 
Sbjct: 67  YRGFLSGDDEDNNNEDVNPN--SAYVKAFYQ-------------KEDVTHELMRSISNSG 111

Query: 247 SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIA 289
            S Y +N+K  +Y + T  L+ E I +  K FL+ QG+VE IA
Sbjct: 112 DSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 108/167 (64%), Gaps = 12/167 (7%)

Query: 1236 KLGELKKRRFDEFMQGFGIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEG 1286
            K   +KK+R + F   F  ++  ++ +Y+ +T          GG A L L D  +PF+ G
Sbjct: 1059 KFLNIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGG 1118

Query: 1287 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
            V +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +
Sbjct: 1119 VKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERI 1178

Query: 1347 ANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYK--TQNMTKSASL 1390
            A YI K   K+ QFI+ISL+N MFE +  LVG+++  T+N +K+ +L
Sbjct: 1179 AAYIRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (51%), Gaps = 12/154 (7%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 199 HNS---EVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDK 255
           H S       N    S  V   Y V +    T +          R    +  + Y +N K
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITEL---------MRIVNLSGETIYKINGK 117

Query: 256 ESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIA 289
            +++   +  L KE I +  K FL+ QG+VE IA
Sbjct: 118 TTSFKNYSDWLAKENILIKAKNFLVFQGDVETIA 151

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  131 bits (329), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 106/396 (26%), Positives = 191/396 (48%), Gaps = 48/396 (12%)

Query: 999  TQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLA--QME 1056
             QKDL+    E+ SL+E    ++  + S+E  ++E ++        LD+L+++    Q E
Sbjct: 849  AQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKN-------HLDELQKKFVTKQSE 901

Query: 1057 AGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTN 1116
               +E         D LE +N+ L  + +E   ++ D+    +  VT          +  
Sbjct: 902  LNSSE---------DILEDMNSNLQVLKRERDGIKEDIEKFDLERVT----------ALK 942

Query: 1117 NSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAE 1176
            N K+ N      +E                     ++E + +         GLP+  +  
Sbjct: 943  NCKISNINIPISSETT----------IDDLPISSTDNEAITISNSIDINYKGLPKKYKEN 992

Query: 1177 LKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREK 1236
                  ++L  +I +++  ++ +  +   LE Y +     +    +  +   E   +  +
Sbjct: 993  NTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQ 1052

Query: 1237 LGELKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGV 1287
              ++KK+R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+
Sbjct: 1053 FLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGI 1112

Query: 1288 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1347
             +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A
Sbjct: 1113 KYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIA 1172

Query: 1348 NYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
             YI + R  + QFIVISL+N MFE +  LVG+Y+ Q
Sbjct: 1173 AYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ 1208

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 87/162 (53%), Gaps = 13/162 (8%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 199 H-------NSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYY 251
           +       NS+ + N  + S      YV        ++ E      + R   +N  + Y 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVE------LMRIISRNGDTSYK 120

Query: 252 VNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           ++ K  +Y + +  L+ E I +  K FL+ QG+VE IA   P
Sbjct: 121 IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  131 bits (329), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 100/158 (63%), Gaps = 10/158 (6%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +K++R   F + F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKS 1387
            +     + QFIVISL+N MFE +  LVG+Y+ Q +  S
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTS 1210

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 31/209 (14%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 199 HN-----------SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNS 247
           +            S+V  N  +  V+  +              +   T+ ++R   K   
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYS-------------KGDSTIELSRSISKGGD 113

Query: 248 SKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXX 307
           + Y +N K  +Y      L+ E I +  K FL+ QG+V  IA                  
Sbjct: 114 TTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIA-------SQSAMELTQFF 166

Query: 308 XXITGTAKYKPQIETILQEIEVLNESCIE 336
              +G+ +YK + + + ++++ L +S  E
Sbjct: 167 EEFSGSIQYKKEYDMLKEKLQTLGQSTAE 195

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 179/717 (24%), Positives = 317/717 (44%), Gaps = 104/717 (14%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 199 HNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFK-------------- 244
           +   +    +  S E       D  DG    +E+ PT    +  ++              
Sbjct: 67  YRGVI----RDFSEE-------DPEDG----EEQHPTSAYVKAFYEMDGKVVELMRTINI 111

Query: 245 NNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXX 304
           N  + Y +++K  +Y +    L+KE I +  K FL+ QG+VE IA               
Sbjct: 112 NGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIA-------SQSALDLS 164

Query: 305 XXXXXITGTAKYKPQIETILQEIEVLNESCIEK-ENRFHIVDQEKSSLETGKDXXXXXXX 363
                I+G+ +YK + +++  E+E L +S  E   NR  I       L+T K+       
Sbjct: 165 KLFEEISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRI----HGELKTYKEGISKDEE 220

Query: 364 XXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESK 423
                   +   + + +W    KL     +  + K +L Q   + S+ LKE   + +E K
Sbjct: 221 YKNNVEKKKKYEMYFTLW----KLFHLDAQRIQFKDKLKQAKTEMSK-LKE--KINNEEK 273

Query: 424 QVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNA--- 480
            +  R ++  ++E ++L +KR   Q    ++EK K ++Q  +    L  S++  +N    
Sbjct: 274 HLT-RSKSAFLKENSILTKKRS--QLDYTVKEKEKVISQCNSIKIPLRASSKRIMNIEKR 330

Query: 481 TEANLRELRQSQLDYEKELQDLNQ-ELITERAKLEDVKISLKEKTVNISAGIAQYEKDLE 539
            E+  R++ + Q DY    +  NQ +++T+  +L +V+I   +K+          + DL+
Sbjct: 331 IESFKRDI-ERQKDYVSTFE--NQLKVVTKAKELFEVEI---KKSARNHDKFRLTDTDLK 384

Query: 540 PWDGQLQQKRAEI--QLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRE- 596
            W  QL +K       L E ++SLL +       ++E L   I       ++K +V  E 
Sbjct: 385 -WYEQLNEKYLSTGGSLLEQKISLLNNDKQEKTDEMELLNRHI------DVSKNRVTEEL 437

Query: 597 ------LKQEESDVTAEVHTAGAECSSASARLK------------------KMHEILIAQ 632
                 L+ + +D+T+ ++   A  +    +LK                  K+ E L+  
Sbjct: 438 NITGENLQNQVTDMTSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLNYKLRETLVKL 497

Query: 633 RQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACP 691
              + + R +    + +  V T L +        G  G + DL     EKY +A+S    
Sbjct: 498 DDLSANQRESLKEKKLRENV-TMLKRF-----FPGVKGLVHDLCRPKKEKYGLAVSVMLG 551

Query: 692 R-LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKP 750
           +  + I+VE++   ++CI +L+K + G A FI LD +          P     L      
Sbjct: 552 KNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTIDSEQPTLSAPPSQEYILTINAIE 611

Query: 751 KDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGS 806
            D  +  A   V  D++   +L  A  + + +  R ++VSLDG LI  +G M+GG S
Sbjct: 612 YDLAYERAMQYVCGDSIICDTLDIARDLKWNRGVRSKLVSLDGSLIHKAGLMTGGIS 668

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  128 bits (321), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1290
            +KK+R   F + F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
             +   ++ QFIVISL+N MFE +  LVG+Y+ Q
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQ 1200

 Score =  118 bits (296), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 165/702 (23%), Positives = 312/702 (44%), Gaps = 80/702 (11%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 199 HNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESN 258
           +   V         E    YV           +   T+ ++R   +N  ++Y +N K   
Sbjct: 67  YRG-VEGEEDEEDGEGRTAYV------KAFYLKSDSTVELSRSISRNGDTQYKMNGKNCG 119

Query: 259 YTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKP 318
           Y +  + L++E I +  + FL+ QG+V  IA                    I+G+ +YK 
Sbjct: 120 YKQYAEFLEEENILIKAQNFLVFQGDVVQIA-------SQSATDLTKLFEEISGSIQYKK 172

Query: 319 QIETILQEIEVLNESCIEK-ENRFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQ 377
           + +++  +++ LN+S  E  +NR  I  + KS  E G D               +     
Sbjct: 173 EYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYRE-GIDKNQEFYHQVEKRKELQRHYAL 231

Query: 378 YKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRIE-TLAIEE 436
           ++++  + +     DK + LK            ++K +   +   +Q+ +R   + A E 
Sbjct: 232 WQLYHLETQRHELEDKLANLKN-----------SIKTIRGKETSQEQILQRSRASFARES 280

Query: 437 KALLAQ----------KRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNAT----- 481
            ++L Q          K  ++QQ + I+   +S  ++    +K + S Q  ++       
Sbjct: 281 ASILKQRSKMESKSREKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDRQREYVE 340

Query: 482 --EANLRELRQSQLDYEKELQDLNQELITERAKLEDVKI--SLKEKTVNISAGIAQYEKD 537
             E  L  + +++ D+EKE+++ +++    +   +D K+  SL EK +N      + +K 
Sbjct: 341 RFENQLNVVTKAKSDFEKEIKESSKDHDKYKLNEDDTKLYASLNEKYLNQGGFSLESQKQ 400

Query: 538 LEPWDGQLQQKRAEIQLAESELSLLKDTN----ARINKDIEQLKNEIARGGEEKLAK-EK 592
           L   D Q        +L + E+  LK  N    +R+  ++    + IA   E +L++   
Sbjct: 401 LTLNDKQ--------ELMD-EMETLKKRNDISRSRVTDEL----SVIAEKLESQLSEISS 447

Query: 593 VIRELKQEESDVTAEVHTAGAECSSASARL----KKMHEILIAQRQRTLDARAAFSSAQN 648
            + E     SD   E+    ++  S+S +      K+ E+L+   + +   R      + 
Sbjct: 448 TLNERNSTHSDKVKELQKLHSQIESSSNKEYDLNYKLREVLVKIEELSASQRETVKERKL 507

Query: 649 KSTVLTALTKLQKSGRISGFHGRLGDLGVI-DEKYDVAISTACPR-LEDIVVESVECGQQ 706
           +  + T L +        G  G + DL     +KY +AIST   +  + ++V++V   Q+
Sbjct: 508 RENIAT-LKRF-----FPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQE 561

Query: 707 CIEYLRKNKLGYARFILLDKLR-KFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRD 765
           CI YL+K + G A FI LD +  +  T  +   +      + +   + ++  A   V  D
Sbjct: 562 CIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAI-DYEQEYERALQYVCSD 620

Query: 766 TLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGS 806
           ++    +  A  + + K  R ++V+L+G LI  +G M+GG S
Sbjct: 621 SIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGIS 662

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 109/182 (59%), Gaps = 17/182 (9%)

Query: 1223 LNEAVGERDAMRE---KLGEL----KKRRFDEFMQGFGIISMTLKEMYQMIT-------- 1267
             N   GE D ++E   K  EL    K++R + F+  F  +   +  +Y+ +T        
Sbjct: 1027 FNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAE 1086

Query: 1268 -MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1326
              GG+A L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+
Sbjct: 1087 LAGGSASLTLEDEDEPYLGGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPS 1146

Query: 1327 PLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKTQNMT 1385
            P +++DE+DAALD  NV  +A YI+   +   QFIVISL++N+F  ++ + G+++ Q+  
Sbjct: 1147 PFFILDEVDAALDVTNVERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHEN 1206

Query: 1386 KS 1387
             S
Sbjct: 1207 SS 1208

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 183/714 (25%), Positives = 314/714 (43%), Gaps = 104/714 (14%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L +++FKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 199 HNSEV------HPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
           +   +      H N    +    F YV  +  G  R       +  TR       S Y +
Sbjct: 67  YRGRMEEGGSAHENNPKSAYVTAF-YVKQDASGAER------RMEFTRVIHNTGDSTYKL 119

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITG 312
           + K   Y E   +L+ E I +  + FL+ QG+VE IA                    ++G
Sbjct: 120 DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIA-------SQSGVDLTKLFEQVSG 172

Query: 313 TAKYKPQIETILQEIEV----LNESCIEKENRFHIVDQEKSSLETGKDXXXXXXXXXXXX 368
           + +Y+ + E +  + E      NES   K  R   +D     L++ K+            
Sbjct: 173 SVQYQREYERLKDDYEKASAEYNESL--KARRKMQID-----LKSFKEGVQKEEQYISLL 225

Query: 369 XXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEV---DSLKDESKQV 425
                   Q+ +WQ    L     K S L   L     K S+  +++   +++  +SK +
Sbjct: 226 AERVKLQQQFMLWQ----LFHLQSKRSGLVASLKDSKAKLSQLKRQLSNEEAILGKSKSL 281

Query: 426 AKRIETLAIEEKALLAQKRG----LDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNAT 481
             + E L    +  L QK+     L+ Q + +    +   ++    EK + S Q  +   
Sbjct: 282 VAKEELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTRRMVNIEKRIDSLQRDIERQ 341

Query: 482 EANLRELR-------QSQLDYEKELQD--LNQELITERAKLEDVKISLKEKTVNISAGIA 532
           E+ +++L+       +++  +E EL+     +  ++E  K E  ++    K V +S+G +
Sbjct: 342 ESYVKQLKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEEL----KEVYLSSGGS 397

Query: 533 QYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNAR--INKDIEQLKNEIA-RGG----E 585
           ++E+ L     + ++   EI + E  + + K T A   +  DIE+L+ E++ R G    +
Sbjct: 398 EFEEKLAILQNKKEELSEEIAVFEKRIGISK-TRAEHDLKVDIERLEVEVSERTGNLNDK 456

Query: 586 EKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSS 645
             +  EKV RE KQ    + +E+ +A  +    S +L+   E+L       LD  +A   
Sbjct: 457 NAIHSEKV-REWKQ----IQSEIESANNKEYELSYKLR---EVLA-----KLDDLSANQR 503

Query: 646 AQNKSTVL----TALTKLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVE 699
             NK   L      L +L       G  G + DL     EKY V +ST   +  + ++V+
Sbjct: 504 ETNKERKLRENVATLRRL-----FPGVRGLVHDLCRPKKEKYAVGVSTILGKNFDSVIVD 558

Query: 700 SVECGQQCIEYLRKNKLGYARFILLDKLRKF--------HTGKIQTPENVPRLFDLVKPK 751
           S+   QQCI YL+K++ G A FI LD +           +TG I T + +     L K  
Sbjct: 559 SLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPTLPAGDNTGCILTLDAIEYESSLEK-- 616

Query: 752 DDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGG 804
                 A   V  D++   SL  A  + + +  + ++V+L+G LI  +G M+GG
Sbjct: 617 ------AMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLMTGG 664

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa]
           {ON} similar to uniprot|P32908 Saccharomyces cerevisiae
           YFL008W SMC1 Subunit of the multiprotein cohesin complex
           essential protein involved in chromosome segregation and
           in double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1243

 Score =  123 bits (308), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 185/815 (22%), Positives = 338/815 (41%), Gaps = 146/815 (17%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY     VG   S F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 199 HNSEVH---PNLKSCSVEVHFQYVVDE--PDGTTRIDEEKPTLVV--------------- 238
           +   +    P+    +  +H      E  P+  T  +EE  +  V               
Sbjct: 67  YRGRIENGDPD-NGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKF 125

Query: 239 TRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXX 298
           TR    +  S Y +ND+  +Y +  + L+ E I +  K FL+ QG+VE IA   P++   
Sbjct: 126 TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPESLTL 185

Query: 299 XXXXXXXXXXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXX 358
                      ++G+  YK   E + +E ++      +  N    V  +  S + G    
Sbjct: 186 LLEQ-------VSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKSFKEGVQRD 238

Query: 359 XXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSL 418
                        +   I   +W+    L   L +  KL   +D      +ET    + L
Sbjct: 239 EQYRTSLEIRDQLKHNFI---LWE----LFHILKRRKKL---VDSLTVSKTETTALKNKL 288

Query: 419 KDESKQVAKRIETLAIEEKALLAQKRGLDQ-----------------QRVAIEEKIKSVN 461
            DE + + K   T A  E  L   K  L Q                 +R+A  ++I ++ 
Sbjct: 289 SDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLE 348

Query: 462 QKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKIS-- 519
           ++ +  +K ++  Q  +   E  L+ + +++  +EKEL++++  L       ED+K    
Sbjct: 349 KRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLKQYEL 408

Query: 520 LKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579
           LKEK   +S+G +  E+                     +L++LK+    +N++ E +   
Sbjct: 409 LKEKY--LSSGGSHIEE---------------------KLAILKNDEFELNEESELINKR 445

Query: 580 IARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDA 639
           +      K  +E++  EL+        +V    A+ +  + RL   + I  A+ +     
Sbjct: 446 L------KTTRERISDELQ-------VDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGI 492

Query: 640 RAAFSSAQNKST--------VLTALTKLQKSGR------------------ISGFHGRLG 673
           +    S +NK          VL  +  L    R                    G  G + 
Sbjct: 493 QTNLESLKNKEYELNFSLRDVLLKIDDLNADQRETKKERKLRENVSMLKRLYPGVKGLVH 552

Query: 674 DLG-VIDEKYDVAISTACPR-LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFH 731
           DL     EKY +A+ST   +  + I+V+S+    +CI YL+K + G A FI LD +    
Sbjct: 553 DLCHPKKEKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTID--- 609

Query: 732 TGKIQTPENVP------RLFDLVKPKDDKFI-PAFYSVLRDTLAAQSLAQANRVAYGKK- 783
                 P ++P       L  +   + + ++  A   V  D++   +L  A  + + +  
Sbjct: 610 ----VNPPSLPVSNVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNV 665

Query: 784 RFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVA--QLENELTEK 841
           + ++V+L+G LI  +G M+GG +            N ++ D +    V   Q+  ELT  
Sbjct: 666 KAKLVTLNGALIHKAGQMTGGTAQ--------KNQNRWNKDEYQGLMVLKDQITEELTAL 717

Query: 842 EKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKL 876
              F+  +   RE+E+++  L + +  ++ ++++L
Sbjct: 718 SDKFRADNMKSRELENEISLLNNEISSLRTQITQL 752

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 172/699 (24%), Positives = 310/699 (44%), Gaps = 74/699 (10%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 199 H------NSEVH-PNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNS-SKY 250
           +       S+ H  + KS  V+  +   + + +G      E+ T +   +  +N   S Y
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFY---LKDDNG------EQGTKIEFMRIIQNTGDSVY 117

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXI 310
            ++ K  ++    + L+ E I +  + FL+ QG+VE IA                    +
Sbjct: 118 RIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIA-------SQSGIELTKLFEQV 170

Query: 311 TGTAKYKPQIETILQEIEVLNESCIE--KENRFHIVDQEKSSLETGKDXXXXXXXXXXXX 368
           +G+ +Y+ + E + +E +   E   +  K  R   +D     L++ K+            
Sbjct: 171 SGSVQYQREYERLKEEYQKATEEYGDSLKSKRKMQID-----LKSFKEGVHKEQHYKNLL 225

Query: 369 XXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSE---TLKEVDSLKDESKQV 425
                   QY +WQ    L    D+ S L   L     K ++    L   + +  +SK  
Sbjct: 226 SERTKLNRQYVLWQ----LYHLEDRRSGLISSLKDSKSKLAQLKSKLTNEEHILHKSKSQ 281

Query: 426 AKRIETLAIEEKALLAQ----KRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNAT 481
           A + E +   +K  L+Q    +  L+ + + +    +S +++ N  EK + S +  +   
Sbjct: 282 AAKDEIVITRKKEKLSQLQQERSKLNSELLPVGSSRQSASKRINHIEKRIDSLKRDITRQ 341

Query: 482 EANLRELRQSQLDYEKELQDLNQELI--TERAKLEDVKISLKE----KTVNISAGIAQYE 535
           E+ +++  Q+QL    + +D  +  I  +   K    K  LKE    K   + +G +  E
Sbjct: 342 ESYVQQF-QNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKEYESLKETYLCSGGSALE 400

Query: 536 KDLEPWDGQLQQKRAEIQLAESELSLLKD-TNARINKDIEQLKNEIARGGEEKLAKEKVI 594
           + +     + ++   EI L E   ++ K   +  +N + E+L+ E++       +K  + 
Sbjct: 401 EKMTLLQNKREELLEEISLYERRANISKSRISVELNVEREKLELELSEVTRVLNSKNALH 460

Query: 595 RELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLT 654
               +E  +V + + +A  +    + +LK   E+L+     T D R +    + +  V T
Sbjct: 461 SAKVKEWKEVQSAIESANNKEYELNYKLK---EVLVKLDDLTADQRESNKERKLRENVAT 517

Query: 655 ALTKLQKSGRISGFHGRLGDLG-VIDEKYDVAISTACPR-LEDIVVESVECGQQCIEYLR 712
            L +L       G  G + DL     +KY +A+S+   +  + IVV+SV   QQCI YL+
Sbjct: 518 -LKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSVSVAQQCISYLK 571

Query: 713 KNKLGYARFILLDKLRKFHTGKIQTP----ENVPRLFDLVKP--KDDKFIPAFYSVLRDT 766
           K++ G A FI LD      T  I TP     N+      V     D +   A   V  D+
Sbjct: 572 KHRSGAASFIPLD------TIDINTPTLPVRNLKGCILTVNAIEYDSELEKAMQYVCSDS 625

Query: 767 LAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGG 804
           +   +L  A  + + +  + ++V++ G LI  +G M+GG
Sbjct: 626 IICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGG 664

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
           YFL008W
          Length = 1226

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 15/202 (7%)

Query: 139 LVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 198
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 199 HNSEV----HPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVND 254
           +   V             + H  YV            ++ T+ + R   KN  S Y ++ 
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYV----SAFYSKGPQESTVELKRTISKNGDSTYQIDR 122

Query: 255 KESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTA 314
           ++  Y + ++ L+ + I +  K FL+ QG+VE +A   P                ++G+A
Sbjct: 123 RQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSP-------LQLTKLFEEVSGSA 175

Query: 315 KYKPQIETILQEIEVLNESCIE 336
           +YK + + +  ++E L+ S  E
Sbjct: 176 QYKKEYDLLKDQLEQLSHSATE 197

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 87/159 (54%), Gaps = 4/159 (2%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           I +L++  FKSYA R V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVND 254
            DLI+       +   SV + F  +  +P  +    E  P L VTR+     +SKY +N 
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 255 KESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
             +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 85/162 (52%), Gaps = 8/162 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           I +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV V F      + P G T        + VTR+     SSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTVVFDNSDKSNSPIGFTN----SAKISVTRQVMLGGSSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
           N   +    V QL +   +++++  FLI+QG++  +  M+PK
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMF 1369
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           I +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV V F      + P G T      P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTVVFDNSDRDNSPIGFTN----SPKISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 85/143 (59%), Gaps = 3/143 (2%)

Query: 1229 ERDAMR--EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1286
            E+D M+  E +G+L + + +  ++ +  ++    ++++ +     A+L   +  D  +EG
Sbjct: 1008 EKDKMKIQETIGKLNEYKRETLIKTWEKVTNDFGKIFEDLLPNSFAKLVPCEGKD-VTEG 1066

Query: 1287 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
            +   V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   +
Sbjct: 1067 LEVKVRLGTIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNI 1126

Query: 1347 ANYIKERTKNAQFIVISLRNNMF 1369
             + IK R K +QFIV+SL+  MF
Sbjct: 1127 GHLIKTRFKGSQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 87/161 (54%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F     ++ P G T      P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFNNTDKLNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 70/162 (43%), Gaps = 12/162 (7%)

Query: 661 KSGRISGFHGRLGDLGVIDEKYDVAIST-ACPRLEDIVVESVECGQQCIEYLRKNKLGYA 719
           K+  + G  G+L  L   + +Y  A+ T A  RL ++VV+  +   Q +E  R  K    
Sbjct: 519 KANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RV 576

Query: 720 RFILLDKL-------RKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSL 772
             I LDK+       +     K   P  V    +L+K  D     A   +  ++L  +  
Sbjct: 577 TIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DKTVTKAMEFIFGNSLICEDP 635

Query: 773 AQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGSHVVRGLM 813
             A ++ +  K R R ++L G + D  GT+SGG  +    L+
Sbjct: 636 ETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLL 677

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 86/159 (54%), Gaps = 4/159 (2%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVND 254
            DLI+       +K+ SV + F     +P  +    E  P + VTR+     +SKY +N 
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFDN--SDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 255 KESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
             +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 90/159 (56%), Gaps = 12/159 (7%)

Query: 1229 ERDAMR-----EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPF 1283
            E+D M+     EKL E K+   D  ++ +  +++    ++  +     A+L  ++  D  
Sbjct: 1008 EKDKMKIVETIEKLNEYKR---DALVKTWEKVNVDFGNIFAELLPNSFAKLAAIEGKD-V 1063

Query: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            + G+   V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  + 
Sbjct: 1064 TAGLEVKVKLGTLWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHT 1123

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQ 1382
              + + IK R K +QFIV+SL+  MF  A +   ++KT+
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMFTNANR---VFKTR 1159

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 20/181 (11%)

Query: 679 DEKYDVAIS---TACPRLEDIVVESVECGQQCIEY--LRK-------NKLGYARFILLDK 726
           +E +D A +    A  RL +++V++ +   Q +E   LRK       NK+  AR I  D 
Sbjct: 535 EENFDSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDA 593

Query: 727 LRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RF 785
           L K    K   P  V    +L+   + +   A   +   +L  +  A A +V +  + R 
Sbjct: 594 LNK---AKSLAPGAVELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRA 649

Query: 786 RVVSLDGKLIDISGTMSGGG-SHVVRGLMRLSQNNSYSPDIFSPE-EVAQLENELTEKEK 843
           R ++LDG + D  GT+SGG  SH    L+ + + N  +  +   E E+ Q++  ++E E 
Sbjct: 650 RSITLDGDIYDPEGTLSGGSRSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHEN 709

Query: 844 S 844
           +
Sbjct: 710 A 710

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G +    E P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNTDKSNTPIGFS----EYPKISVTRQIVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  I  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKP 158

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 36.2 bits (82), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 75/179 (41%), Gaps = 13/179 (7%)

Query: 665 ISGFHGRLGDLGVIDEKYDVAIS-TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFIL 723
           + G    L  +   + KY + +   A  RL +++V++ + G   ++  R  K      I 
Sbjct: 523 VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIP 580

Query: 724 LDKL-------RKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQAN 776
           LDK+        K    K   P  V    +L+   D+  + A   +  ++L       A 
Sbjct: 581 LDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDE-VVKAMEFIFGNSLICDDAETAK 639

Query: 777 RVAYGKK-RFRVVSLDGKLIDISGTMSGGGSHVVRGLM-RLSQNNSYSPDIFSPEEVAQ 833
           ++ +    R R ++L+G + D  GT+SGG  +    L+  + Q N+   ++ +  E  Q
Sbjct: 640 KITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNTLKKELLAMNEEKQ 698

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G T      P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G T      P + VTR+     +SKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G     E  PT+ VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNSDKSNAPIGF----ESSPTISVTRQVALGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 16/160 (10%)

Query: 665 ISGFHGRLGDLGVIDEKYDVAIS---TACPRLEDIVVESVECGQQCIEYLRKNKLGYARF 721
           + G   RL  L   +  Y  A +    A  RL ++VV++ +   Q ++  R  K      
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 722 ILLDKL-------RKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQ 774
           I L+K+       +  +  K  +P NV    +L+  ++D    A   +   +L  +    
Sbjct: 579 IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAET 637

Query: 775 ANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGSHVVRGLM 813
           A +V +  + R R ++L G + D  GT+SGG  ++   L+
Sbjct: 638 AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F        P G     E  P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNTDKSSSPIGF----ESYPKISVTRQIILGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 1235 EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1294
            EKL E K+   D  ++ +  +S+    ++  +     A+L   +  D  +EG+   V   
Sbjct: 1019 EKLNEYKR---DTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLEVKVKLG 1074

Query: 1295 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
                 ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 SIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1355 KNAQFIVISLRNNMF 1369
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 80/200 (40%), Gaps = 40/200 (20%)

Query: 680 EKYDVAIS---TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL-------RK 729
           E +D A +    A  RL ++VV++     Q +E  R  K      I L+K+         
Sbjct: 536 ENFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENA 593

Query: 730 FHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVV 788
               K   P NV    +L+   +D+   A   +   +L  +    A RV +  + R R +
Sbjct: 594 LKLAKSVAPGNVELALNLI-GYEDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSI 652

Query: 789 SLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIA 848
           +LDG + D  GT+SGG  +           NS   DI                 ++F  A
Sbjct: 653 TLDGDIYDPEGTLSGGSRNT---------KNSLLIDI-----------------QTFNAA 686

Query: 849 SDTFREMEDQLKKLKDRVPE 868
           S    EME +LK++  ++ E
Sbjct: 687 SKRLNEMELELKQINSKIAE 706

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G        P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNTDKSNSPIGFAN----SPQISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 76/166 (45%), Gaps = 22/166 (13%)

Query: 662 SGRISGFHGRLGDLGVIDEKYDVAIST-ACPRLEDIVVESVECGQQCIE--YLRK----- 713
           +  + G  GRL  L   + +Y  A+ T A  RL ++VV   +   Q +E   LRK     
Sbjct: 520 TSSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRKRVTII 579

Query: 714 --NKLGYARFI---LLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLA 768
             +K+ Y R I   +L+  +    GK++   N+ R FD  KP       A   +  ++L 
Sbjct: 580 PLDKI-YTRPITPQVLELAKSIAPGKVELAINLIR-FD--KP----VTKAMEFIFGNSLI 631

Query: 769 AQSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGGSHVVRGLM 813
                 A ++ +  K R R ++L G + D  GT+SGG  +  + L+
Sbjct: 632 CDDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL 677

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 84/162 (51%), Gaps = 8/162 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G          + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGITKASVTIVFDNTDKTNSPIGFNN----SAKISVTRQVVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
           N   +    V QL +   +++++  FLI+QG++  +  M+PK
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 6/96 (6%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKT--QNMTKSASL 1390
            +QFIV+SL+  MF  A +   +++T  QN T   S+
Sbjct: 1138 SQFIVVSLKEGMFSNANR---VFRTRFQNGTSVVSI 1170

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 84/159 (52%), Gaps = 4/159 (2%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVND 254
            DLI+       +   SV + F    D+   +    E  P + VTR+     +SKY +N 
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 255 KESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
             +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 68.6 bits (166), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 61/86 (70%), Gaps = 4/86 (4%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKTQ 1382
            +QFIV+SL+  MF  A +   ++KT+
Sbjct: 1137 SQFIVVSLKEGMFTNANR---VFKTR 1159

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 479 NATEANLR--ELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNI--------- 527
           N  E N+R   L +S  DYE  L+    +  T     ED  +SL     N+         
Sbjct: 325 NLNEENVRRESLERSICDYESSLE----KNTTHSKNTEDEYLSLNNLVSNLEKQLQTKEE 380

Query: 528 -----SAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIAR 582
                + GI+        ++ QL   +A    A+ ++        R    I+ L+ E++ 
Sbjct: 381 LLSTLTTGISSTGATTSGYNLQLSSAKARFNDAQVQVQ-------RFGMKIDLLRKELS- 432

Query: 583 GGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKM--HEILIAQ-------- 632
             E KLAK K I E      +   E+     +CS  +A L+K+  +  L  Q        
Sbjct: 433 ANEPKLAKAKSICE------EAKKEIEAHRMQCSKLNAHLEKLGFNPDLFKQLKEEESTL 486

Query: 633 RQRTLDARAAFSSAQNK-STVLTALTKLQKSGRISGFHGRLGDLGVIDEK-YDVAIS--- 687
           RQ      +   S + + + +    +K  ++   S   G    L  +DEK Y  A +   
Sbjct: 487 RQSIYKLSSEMESLKRRVANIEFTYSKPSENFNPSSVKGVAAQLFSLDEKNYSSATALQV 546

Query: 688 TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL--RKFHTGKIQT-----PEN 740
            A  RL ++VV++     Q +E  R  K      I L+K+  R  H   ++      P N
Sbjct: 547 CAGGRLFNVVVDNEGTASQLLERGRLRK--RVTIIPLNKISARSLHQNAVKAAKELAPGN 604

Query: 741 VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISG 799
           V    +L+   +++   A   +   +L  Q    A +V +  + R R ++L G + D  G
Sbjct: 605 VELALNLI-GYEEEVSKAMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIYDPEG 663

Query: 800 TM 801
           T+
Sbjct: 664 TL 665

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G     E  P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFANSDKNNSPIGF----ESYPKISVTRQIVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 12/151 (7%)

Query: 688 TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL--RKFHTGKIQ-----TPEN 740
            A  RL ++VV +     Q +E  R  K      I L+K+  R+ H   +       P++
Sbjct: 547 CAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDS 604

Query: 741 VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISG 799
           V    +L+   +D+   A   +   +L  +    A +V +  K R R ++L G + D  G
Sbjct: 605 VELALNLI-GYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEG 663

Query: 800 TMSGGGSHVVRG-LMRLSQNNSYSPDIFSPE 829
           T+SGG  +     L+ + + N+YS ++   E
Sbjct: 664 TLSGGSRNNNSSILIDIQKYNAYSRNLSESE 694

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 88.6 bits (218), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  + + F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G      +   + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNSDKSNSPIGFN----DSLKISVTRQIVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  MRP
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRP 158

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 15/156 (9%)

Query: 670 GRLGDLGVIDEK--YDVAISTACP--RLEDIVVESVECGQQCIEYLRKNKLGYARFILLD 725
           G    L  +DE+  Y       C   RL ++VV++     Q +E  R  K   A  I L+
Sbjct: 525 GIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLN 582

Query: 726 KLRK-------FHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRV 778
           K+          +  K   P  V    +L+   +++   A   +   +L  +    A  V
Sbjct: 583 KIAARTLNDNIVNMAKSVAPGRVELALNLI-GYEEEVRRAMEFIFGSSLVCKDAEAAKMV 641

Query: 779 AYGKK-RFRVVSLDGKLIDISGTMSGGGSHVVRGLM 813
            +  K R R ++LDG + D  GT+SGG  +    L+
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLL 677

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G          + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNSDKTNSPIGFNN----SSKISVTRQIILGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V QL +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 6/96 (6%)

Query: 1298 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKT--QNMTKSASL 1390
            +QFIV+SL+  MF  A +   +++T  QN T   S+
Sbjct: 1137 SQFIVVSLKEGMFSNANR---VFRTRFQNGTSVVSI 1169

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 688 TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL-------RKFHTGKIQTPEN 740
            A  RL ++VV++ +     +E  R  K      I L+K+       R     K   P  
Sbjct: 547 CAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGK 604

Query: 741 VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISG 799
           V    +L+   DD+   A   +   +L  Q    A +V +  + R R ++LDG + D  G
Sbjct: 605 VELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEG 663

Query: 800 TMSGG 804
           T+SGG
Sbjct: 664 TLSGG 668

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 84/161 (52%), Gaps = 8/161 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F        P G     E   T+ VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNSDKSKAPIGF----ETSLTISVTRQIVLGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           N   +    V  L +   +++++  FLI+QG++  +  M+P
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1296 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1355 KNAQFIVISLRNNMFELAQQL 1375
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 96/222 (43%), Gaps = 36/222 (16%)

Query: 665 ISGFHGRLGDLGVIDEKYDVAIS---TACPRLEDIVVESVECGQQCIE--YLRK------ 713
           + G   RL    +  + YD A +    A  RL ++VV++     + +E   LRK      
Sbjct: 523 VKGVAARL--FTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRKRVTIIP 580

Query: 714 -NKLGYARFI---LLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAA 769
            NK+  AR I    L+  ++   GK++   N+          +D+   A   +   +L  
Sbjct: 581 LNKIS-ARTIDNNTLNYAKQLAPGKVELALNLIGY-------EDEVAKALQFIFGSSLIC 632

Query: 770 QSLAQANRVAYGKK-RFRVVSLDGKLIDISGTMSGGG-SHVVRGLMRLSQNNSYSPDIFS 827
                A ++ +  K R R ++LDG + D  GT+SGG  ++    L+ + + N       S
Sbjct: 633 NDAETAKKITFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNE------S 686

Query: 828 PEEVAQLENELTEKEKSFQIASDTF---REMEDQLKKLKDRV 866
            E++   +NEL    K      D +   +E+++QL  L  ++
Sbjct: 687 TEKINNYQNELKSIRKKLSEQEDIYKQTKELQNQLSLLNHKL 728

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 83/160 (51%), Gaps = 8/160 (5%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYV--VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G        P + VTR+     +SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFDNTDKSNSPIGFNT----SPRISVTRQIVIGGTSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           N   +    V QL +   +++++  FLI+QG++  +  M+
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMK 157

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 84/162 (51%), Gaps = 8/162 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 194
           + +L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQY--VVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
            DLI+       +   SV + F      + P G     E    + +TR+      SKY +
Sbjct: 63  QDLIY-KRGQAGVTKASVTIVFNNSDTSNSPIGF----ESHAKISITRQIILGGVSKYLI 117

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
           N   +    V QL +   +++++  FLI+QG++  +  M+P+
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQ 159

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 1235 EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1294
            EKL E K+   +  ++ +  +S+    ++  +     A+LE  +  D  +EG+   V   
Sbjct: 1019 EKLNEYKR---ETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEVKVKLG 1074

Query: 1295 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
            K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1355 KNAQFIVISLRNNMF 1369
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 107/210 (50%), Gaps = 22/210 (10%)

Query: 1191 DLQNYVDSVNVDVEILEEYAKRLAEHKRR----KVDLNEAVGERD----AMREKLGELKK 1242
            DL   ++SVN ++  L    KR +E+ R+    K++LNE   E D    +++  + +LK+
Sbjct: 972  DLFQELNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLKQ 1031

Query: 1243 RRFDEFMQGFGIISMTLKEMYQMITMGGNAELEL------------VDSLDPFSEGVTFS 1290
            ++       F  +S     +++ +   G A+L +             +S +    G++ S
Sbjct: 1032 QKVTAVDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISIS 1091

Query: 1291 VM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1348
            V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA+
Sbjct: 1092 VSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVAD 1151

Query: 1349 YIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
             IK  + NAQFI  + R +M ++A +   +
Sbjct: 1152 VIKSLSGNAQFICTTFRTDMLQVADKFFRV 1181

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 83/165 (50%), Gaps = 10/165 (6%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I+++V++ FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGTT-RIDEEKPTLVVTRKAFKNNSSK 249
              LIH      ++ S SVE+ F+   + +  P G   R ++E    +  R+        
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFRDPGHRMILPSGVVPRENDE----IFIRRTVGLKKDD 114

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
           Y VND+    ++V ++L+  G  + +   ++ QG +  +   + K
Sbjct: 115 YQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDK 159

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 188/411 (45%), Gaps = 54/411 (13%)

Query: 998  NTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEA 1057
            + Q  L + S+ +  L  N D++  TL S  K + +Q++L  ++ E  D     +A +++
Sbjct: 811  DIQNKLYMTSEALEGLTNNIDSLNATLNS--KLIPQQKELKAKLAETGDSF---IAGLKS 865

Query: 1058 GFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNN 1117
                   +K  ++++LE  N  L  I +E++ +       + ++  ++L+         N
Sbjct: 866  EVQSMLIVKTTLDNQLEISNEELSGIQEEIKNMSE-----RKKNSEKSLE-------KAN 913

Query: 1118 SKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENGLPRVSEAEL 1177
            S+  + L++  T   DA +                 ++ EV     E  N    +S  EL
Sbjct: 914  SQQASLLKKLETFQKDAEKSMVKKTTLAARREELQQKIREVGLLAEEALNSFNNLSSGEL 973

Query: 1178 KSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKL 1237
                ++ L +  ED+    +      E  +++ ++  E + R  +L+E+   + +++  +
Sbjct: 974  ----LQRLNSVNEDISGLSNVNKRAFENFKKFGEKRTELEERAEELDES---KSSIQNLI 1026

Query: 1238 GELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAEL---------------ELVD---- 1278
              LK+++ +     F  +S    ++++ +   G A+L               E V+    
Sbjct: 1027 TRLKRQKVNAVDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDG 1086

Query: 1279 ---------SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1327
                     S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P
Sbjct: 1087 DENDESRSKSVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAP 1146

Query: 1328 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
             Y+ DEIDAALD +  + VA+ IKE ++NAQFI  + R++M E+A +   +
Sbjct: 1147 FYLFDEIDAALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV 1197

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 146/715 (20%), Positives = 302/715 (42%), Gaps = 87/715 (12%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
              LIH      ++ S SVE+ F    + +  P G   I   +   V  R+        Y
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFHDPSHRIILPSG---IPPRENDEVFVRRTVGLKKDDY 115

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXI 310
            +ND+    ++V ++L+  G  + +   ++ QG +  +   + +               +
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAKDR-------ERLHLLEEV 168

Query: 311 TGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSL--ETGKDXXXXXXXXXXXX 368
            G   ++ ++   L++++       E E +   + QE   L  +  +             
Sbjct: 169 VGAKSFEVKLRASLKKMD-------ETEKKRAQIAQEMEELVGKLKEMEEEQKELERYNS 221

Query: 369 XXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAKR 428
                K+ Q+ ++  D +L   +++  +L G  +       + +KE+D  ++   QV+K 
Sbjct: 222 LERNRKVFQFTLY--DRELNDVINQIERLDGDYNATVHSSGDYIKELDQREEMISQVSKE 279

Query: 429 IE----TLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEAN 484
           ++    +L I+E   L Q +  + +   +  ++ ++N K    E  ++ +   +   E N
Sbjct: 280 LQQLESSLKIKESTELQQSKDKNSE---LSTELANLNVKITDLESQIQLHDEQVKIDETN 336

Query: 485 LR----ELRQSQLDYEK---ELQDLNQELITERAKLEDVKISLKEKTVNISAG------- 530
           L+     ++Q+Q   EK     Q+LN+E    + KL +++   +E+ + +  G       
Sbjct: 337 LQIINEAVQQNQRQLEKVEPRFQELNKEETGLKLKLAELR--ERERDLLLKKGKYADFRT 394

Query: 531 -------IAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARG 583
                  + Q  KDL      L++ +  ++L  SE   +++  A I++ I++L + I   
Sbjct: 395 KEERDSWVEQEIKDLRNKLDNLKEVKQNVELERSE---IRNKLAAIDEQIDELTDSIQGP 451

Query: 584 GEEKLAKEKVIRELKQEESDVTAEVHTAG------AECSSASARLKKMHEILIAQRQRTL 637
           G         + EL   ++++    H  G       E      RL+ + E      +R+ 
Sbjct: 452 G--------ALAELNDLDTELNNTKHLYGQKIDERKELWRTEQRLQSLLEATTNDVKRS- 502

Query: 638 DARAAFSSAQNKSTVLTALTKLQKSGRI--SGFHGRLGDLGVIDEKY-DVAISTACPRLE 694
           +     + +++ +  + ++ ++ +  ++      G LG+L  +++KY   A       L 
Sbjct: 503 EGEVTETMSRDLANGIKSVKEIAEKLKLPDGCVFGTLGELIKVNDKYKKCAEVVGGNSLF 562

Query: 695 DIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPEN-VPRLFDLVKP--K 751
            IVV++ E     I+ L + K G   F+ L+  R +    I  P N       L+K    
Sbjct: 563 HIVVDTDETASLIIQELYRMKGGRVTFLPLN--RVYSDPNITYPPNEQASCTPLIKKIRY 620

Query: 752 DDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRV--VSLDGKLIDISGTMSGG 804
           D +F  A   V   T+  + L+   R+A   KRFR+  ++LDG   D  G ++GG
Sbjct: 621 DARFEKAVKQVFGKTIVVRDLSTGARLA---KRFRLNAITLDGDRADKKGALTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 1282 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1339
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1340 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
             +  + VAN +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV 1197

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 77/159 (48%), Gaps = 11/159 (6%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I +++++ FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIH-NSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTL------VVTRKAFKNN 246
              LIH  +    ++ SCSVE+ F     +PD    +      +      V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 247 SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
              Y +ND+    +++ ++L+  G  + +   ++ QG++
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKI 155

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 1277 VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1334
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1335 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1372
            DAALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 77/166 (46%), Gaps = 2/166 (1%)

Query: 129 RNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANK 188
           R    + I  +++Q FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + 
Sbjct: 20  REIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSS 79

Query: 189 MRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSS 248
           ++++    LIH      ++ S  VE+ F    D+   T+ I   +  +V  R+       
Sbjct: 80  LKREERQGLIHQG--TGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKD 137

Query: 249 KYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
           +Y VN K  + ++++++ +  G    +   ++ QG +  +   + K
Sbjct: 138 EYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDK 183

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 2/119 (1%)

Query: 1281 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1338
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1339 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397
            D +  + VAN IKE + NAQFI  + R++M  +A     +     ++  A +   D +N
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAIN 1216

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 159/718 (22%), Positives = 303/718 (42%), Gaps = 90/718 (12%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGT-TRIDEEKPTLVVTRKAFKNNSSK 249
              LIH      ++ S SVE+ F    + +  P G  +R D+E    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXX 309
           Y +ND+     ++ ++L+  G  +++   ++ QG++  +   + K               
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-------ERLQLLED 168

Query: 310 ITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLET--GKDXXXXXXXXXXX 367
           + G   ++ +++  L+++E       E E +   +++E   L +   +            
Sbjct: 169 VVGAKSFEVKLKASLKKME-------ETEQKKTQINKEMDELNSKLSEMEQEREELEKYN 221

Query: 368 XXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYS--ETLKEVDSLKDESKQV 425
                 K+ Q+ ++  D ++   +++  KL G  D  N  YS  + ++E+D  +D  +QV
Sbjct: 222 ELERNRKIYQFTLY--DREMNEVINQMEKLDG--DYNNTVYSSEQYIQELDKREDMIEQV 277

Query: 426 AKRIETLAIEEKALLAQKRGLDQQRVAIEEK-----IKSVNQKTNKAEKLLKSNQHSLNA 480
           +K +  +    +A L  K   D Q+  + E      + +V+ K    +  ++SN    N 
Sbjct: 278 SKNLSNI----EASLKIKNTTDLQQAKLRESEISQDLTNVSVKIKDVQLQIESNSEQRNL 333

Query: 481 TEANLRE------LRQSQLDYEKELQDLNQELITERA--KLEDVKISLKEKTVNISAGIA 532
             + L E      L+Q +L    ++    QEL  E A  KL+   +  K++ +    G  
Sbjct: 334 DGSTLEEVESKIKLKQQKL---SKILPRFQELTKEEAMYKLQLASLQQKQRDLVFKKGEY 390

Query: 533 QYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGE--EKLAK 590
              K  E  D  +    +EI+  +S +  L D  +++  D   LK E+++  E  E+LA 
Sbjct: 391 ARFKSKEERDAWI---YSEIEELKSSMQSLNDLGSKLQMDRTSLKEELSKIDEEIEELAD 447

Query: 591 EKVIRELKQEESDVTAEV----------HTAGAECSSASARLKKMHEILIA---QRQRTL 637
                ++K +  D  +E+               E      +L+ + E +++   Q QR +
Sbjct: 448 SINGPDIKGQLEDFDSELIKLKQKLNESLDTRKELWRKEQKLQTVLETILSDVNQNQRNV 507

Query: 638 DARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPR----- 692
           +   + S A     V     KL+ S       G LG+L  +++KY      AC       
Sbjct: 508 NETMSRSLANGIINVKEITEKLKISPE--SVFGTLGELIKVNDKY-----KACAEVIGGN 560

Query: 693 -LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLR-----KFHTGKIQTPENVPRLFD 746
            L  IVV++ E     +  L + K G   FI L+KL      KF +      +  P L  
Sbjct: 561 SLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLSLDADVKFPSNSTTQIQFTP-LIK 619

Query: 747 LVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGG 804
            +K +  +F  A   V   T+  + L Q  ++A  K +   ++LDG   D  G ++GG
Sbjct: 620 KIKYQ-PRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1286 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            + VA  IKE + NAQFI  + R +M ++A +   +
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV 1200

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 2/97 (2%)

Query: 1278 DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1335
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1336 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1372
            AALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 71/156 (45%), Gaps = 10/156 (6%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I  +V+Q FK+Y     V      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPT----LVVTRKAFKNNSSK 249
              LIH      ++ S  VE+ F     +P G   I    P     +V  R+       +
Sbjct: 61  RQGLIHQG--TGSVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
           Y VN K  + ++++++ +  G    +   ++ QG +
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRI 150

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 669 HGRLGDLGVIDEKYD-VAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKL 727
           HG LG+L  ++EKY   A +     L  +VV++ E     +E L   K G   FI L+++
Sbjct: 536 HGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRI 595

Query: 728 RKFHTGKIQTPEN-----VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGK 782
               +  +  P+N      P ++ +   K  +F  A   V   T+  + +   +++A   
Sbjct: 596 A--DSNPVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLA--- 648

Query: 783 KRFRV--VSLDGKLIDISGTMSGG 804
           K F +  V+LDG   D  G ++GG
Sbjct: 649 KSFNLDAVTLDGDRTDKRGLITGG 672

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 1280 LDPFSEGVTFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1337
            L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1338 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1375
            LD +  + VAN IK+ +KNAQFI  + R +M  +A + 
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF 1192

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 73/156 (46%), Gaps = 10/156 (6%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDE---EKPT-LVVTRKAFKNNSSK 249
              LIH      ++ S SVE+ F     +PD    +      +P   V  R+        
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
           Y +ND+    +++ ++L+  G  +     ++ QG +
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRI 150

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 1275 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1332
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1333 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   +
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 80/164 (48%), Gaps = 6/164 (3%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHF---QYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
              LIH      ++ S SVE+ F   ++ +  P G   +  E    +  R+        Y
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
            +ND+     +V ++L+  G  + +   ++ QG++ ++   + K
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDK 161

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 152/710 (21%), Positives = 293/710 (41%), Gaps = 74/710 (10%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGT-TRIDEEKPTLVVTRKAFKNNSSK 249
              LIH      ++ S SVE+ F    + +  P G  +R D+E    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXX 309
           Y +ND+     ++ ++L+  G  + +   ++ QG++  +   + K               
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDK-------ERLQLLED 168

Query: 310 ITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLET--GKDXXXXXXXXXXX 367
           + G   ++ +++  L+++E       E E +   + +E   L +   +            
Sbjct: 169 VVGAKSFEVKLKASLKKME-------ETEQKKIQISKEMDELNSKLSEMEQEREELEKYN 221

Query: 368 XXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAK 427
                 K+ Q+ ++  D +L   +++  +L G  +       + ++E+D  +D   QV+K
Sbjct: 222 ELERNRKIYQFTLY--DRELNDVINQMERLDGDYNNTVHSSEQYIQELDKREDMIGQVSK 279

Query: 428 RIETLAIEEKALLAQKRGLDQQRV---AIEEKIKSVNQKTNKAEKLLKSNQHSLNATEAN 484
            +    IE    +     L Q ++    I + + ++N K    +  ++SN    N   A 
Sbjct: 280 NLSN--IEASLKIKNTTDLPQAKLRESEISQNLTNINVKIKDVQLQIESNGEQRNLDGAT 337

Query: 485 LRE----LRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEK---- 536
           L+E    ++Q Q    K L    QEL  E A  +    SL++K  ++     +Y +    
Sbjct: 338 LKEVKSIIKQRQQKLSKILPRY-QELTKEEAMYKLHLASLQQKQRDLIFKKGEYARFKSK 396

Query: 537 -DLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGE--EKLAKEKV 593
            +   W        +EI+  ES +  L +  +++  D   LK + ++  E  E LA    
Sbjct: 397 EERNAW------IYSEIEELESSMQNLNELGSKLQMDRTSLKEQYSKLDEEIEDLADSIN 450

Query: 594 IRELKQEESDVTAEVHT----------AGAECSSASARLKKMHEILIA---QRQRTLDAR 640
             ++K +  D  +E+               E      +L+ + E L++   Q QR ++  
Sbjct: 451 GPDIKGQLEDFDSELINLKQRLNESLDTRKELWRKEQKLQTILETLLSDVNQNQRNVNET 510

Query: 641 AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYD-VAISTACPRLEDIVVE 699
            + S A     V     KL+ S       G LG+L  +++KY   A       L  IVV+
Sbjct: 511 MSRSLANGIINVKEITEKLKISP--ESVFGTLGELIKVNDKYKACAEVVGGNSLFHIVVD 568

Query: 700 SVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVP---RLFDLVK--PKDDK 754
           + E     +  L + K G   FI L++L  F    ++ P N     +   L+K      +
Sbjct: 569 TEETATLIMNELYRMKGGRVTFIPLNRL--FLDSDVKFPSNTTTQIQFTPLIKKIKYQPR 626

Query: 755 FIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGG 804
           F  A   V   T+  + L Q  ++A  K +   ++LDG   D  G ++GG
Sbjct: 627 FEKAVKHVFGKTIVVKELGQGLKLA-KKHKLNAITLDGDRADKRGLLTGG 675

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1286 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            + VA  IKE + +AQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 155/719 (21%), Positives = 301/719 (41%), Gaps = 95/719 (13%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I +++++ FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGTT-RIDEEKPTLVVTRKAFKNNSSK 249
              LIH      ++ S SVE+ F    + +  P G   R ++E    V+ R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXX 309
           Y +ND+     +V ++L+  G  +++   ++ QG +  +   + K               
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDK-------ERLQLLED 167

Query: 310 ITGTAKYKPQIETILQEIEVLNESCIEKENRFHIV-DQEKSSLETGKDXXXXXXXXXXXX 368
           + G   ++ ++   L+++E        ++ R  IV + E+ + +  +             
Sbjct: 168 VVGAKSFEVKLRASLKKMEQT------EQKRAQIVKEMEELNDKLSEMEEERKELEVFNN 221

Query: 369 XXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAKR 428
                K  Q+ ++  D +L   +++  K+    +       + + E+D  +D  +Q+ K 
Sbjct: 222 LERNRKAFQFTLY--DRELNDVINQIEKMDDVYNVTLHSSHDYITELDKREDMVEQINKN 279

Query: 429 IETL----AIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEAN 484
           ++ L     I+E A L+Q R    +   +   I ++N K    ++ + S     +    N
Sbjct: 280 LQNLESSIKIKETAELSQARSKHNE---LSNAIANLNVKIRDLQRQVVSYDEQSDLNRKN 336

Query: 485 LR------ELRQSQL-DYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKD 537
           L       E +Q+QL       + L++E ++ + +L               AG+ + ++D
Sbjct: 337 LAIINEAIEAKQAQLAKISPRFESLSKEEVSYKLEL---------------AGLQEKQRD 381

Query: 538 LEPWDGQ---LQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVI 594
           L    G+    Q      +  E EL  L +T A       Q+ NE     E+  A E+ I
Sbjct: 382 LLLMKGKYSHFQTVEERNEWIEGELRSLNETLANTTHLKSQIDNERNELHEKLNATEEQI 441

Query: 595 RELKQ---------EESDVTAEVHTAGA----------ECSSASARLKKMHEIL---IAQ 632
           +EL+          E  D+  +V+   A          E   +  +L+ + E L   +  
Sbjct: 442 QELEDSVRGPGVVAEIEDIEKKVNDLKAEYVEKINERKELWRSEQKLQTISETLLDTVKN 501

Query: 633 RQRTLDARAAFSSAQNKSTVLTALTKLQ-KSGRISGFHGRLGDLGVIDEKYDVAISTACP 691
            +R++    A S A   ++V     KL+   GR+    G LG+L  ++EKY +       
Sbjct: 502 SERSVSETMAKSLANGIASVREITEKLRLPEGRV---FGTLGELIKVNEKYKMCAEVVGG 558

Query: 692 R-LEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENV-PRLFDLVK 749
             L  IVV++ E     I+ L + + G   F+ L+++  ++   I  P N       L+K
Sbjct: 559 NSLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRI--YNDPNITYPPNAQSSCTPLIK 616

Query: 750 PKDDKFIPAFYSVLRD----TLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGG 804
               KF   F SV+++    T+  + LA  +++A   K    ++LDG   D SG ++GG
Sbjct: 617 KI--KFDAQFESVVKNVFGKTIVVRDLAAGSKIAKHYK-LDAITLDGDRADKSGLLTGG 672

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1286 GVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            + VA  IK  + NAQFI  + R +M ++A +   +
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV 1193

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 119/237 (50%), Gaps = 29/237 (12%)

Query: 1177 LKSLDVEDLGAQIEDLQNYVDSV-NVDVEILEEYAK---RLAEHKRRKVDLNEAVGERDA 1232
             K+L  EDL  ++ +    +  + N++    E Y K   + +E + R  +L+++   + +
Sbjct: 968  FKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDDS---KQS 1024

Query: 1233 MREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELV--------DSLDPFS 1284
            +++ + +LK+++ +   + F  +S     +++ I   G A L +         D+ + F+
Sbjct: 1025 IQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFT 1084

Query: 1285 ---------EGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1333
                     EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DE
Sbjct: 1085 QSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDE 1144

Query: 1334 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASL 1390
            IDAALD +    VA  I + + NAQFI  + R++M + A +    Y+ +   K +S+
Sbjct: 1145 IDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKF---YRVKYENKQSSV 1198

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 12/167 (7%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I +++++ FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHF---QYVVDEPDGTT---RIDEEKPTLVVTRKAFKNNS 247
              LIH      ++ S SVE+ F   ++ +  P G       DE     V  R+      
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDE-----VRIRRTVGLKK 114

Query: 248 SKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPK 294
             Y VND+     ++ ++L+  G  + +   ++ QG + ++   + K
Sbjct: 115 DDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDK 161

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 2/95 (2%)

Query: 1280 LDPFSEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1337
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1338 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1372
            LD +  + VA  I++ + NAQFI  + R +M E+A
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVA 1193

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 76/156 (48%), Gaps = 9/156 (5%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I ++V++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQ---YVVDEPDGTT-RIDEEKPTLVVTRKAFKNNSSK 249
              LIH       + S SVE+ F    + +  P G   R ++E    V  R+        
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFHDPNHKIILPSGVVPRENDE----VYIRRTVGLKKDD 115

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
           Y +ND+     +V ++L+  G  +++   ++ QG++
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKI 151

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 110/223 (49%), Gaps = 34/223 (15%)

Query: 1184 DLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKR 1243
            D+  +I  L+N       + +  +E  K L+E   R  +L+E+   +D++++ + +LK++
Sbjct: 983  DMNTEISGLKNVNKRAFENFKKFDEKRKDLSE---RASELDES---KDSIQDLIVKLKQQ 1036

Query: 1244 RFDEFMQGFGIISMTLKEMYQMITMGGNAELEL---------VDSLDP------------ 1282
            + +     F  +S   + +++ +   G A+L +         +DS+D             
Sbjct: 1037 KVNAVDSTFQKVSENFEAVFERLVPRGIAKLVIHRRDDTKDQMDSIDDDMDVASSERTSS 1096

Query: 1283 -----FSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1335
                    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEID
Sbjct: 1097 KDGDIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEID 1156

Query: 1336 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            AALD +  + VA  IKE +KNAQFI  + R +M ++A +   +
Sbjct: 1157 AALDKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV 1199

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1286 GVTFSVMPPKK--SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            GV+ SV    K     ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            + VA+ IK  + NAQFI  + R +M ++A +   +
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 73/162 (45%), Gaps = 22/162 (13%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I K++++ FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHF----------QYVVDEPDGTTRIDEEKPTLVVTRKAF 243
              LIH      ++ S SVE+ F            V   PD T  I          R+  
Sbjct: 61  RQGLIHQG--SGSVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSI----------RRTV 108

Query: 244 KNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
                 Y +ND+    +++ ++++  G  + +   ++ QG +
Sbjct: 109 GLKKDDYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRI 150

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1286 GVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            + VA  +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 1278 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1335
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1336 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   +
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV 1195

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 162/736 (22%), Positives = 297/736 (40%), Gaps = 132/736 (17%)

Query: 134 LCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 193
           + I K+++  FK+Y  +  +  F +  + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 194 LSDLIHNSEVHPNLKSCSVEVHF-----QYVVDEPD--GTTRIDEEKPTLVVTRKAFKNN 246
              LI+      ++ S  VE+ F     + ++  PD  G  RI          R+     
Sbjct: 61  RRSLIYQG--TSSVMSGYVEIVFHDAENRTLLGIPDSNGAIRI----------RRTVGLK 108

Query: 247 SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXX 306
             +Y +N+K S+ ++V +LL+  G    +   ++ QG + ++   + +            
Sbjct: 109 KDEYMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDR-------ERLQL 161

Query: 307 XXXITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDXXXXXXXXXX 366
              + G   ++ +++  LQ ++        ++NR  I  + +   +   +          
Sbjct: 162 LEEVVGAKSFERKLKESLQRMDAT------EKNREKIRIELQEVEDKLNELNEEREELET 215

Query: 367 XXXXXRS-KMIQYKIWQNDI------------KLTSTLDKSSKLKGQLDQE-------NE 406
                RS KM Q+ ++  ++            +  +TL  S +   +LD+        N+
Sbjct: 216 YNELDRSRKMFQFTLYDRELNEITNLIEKLDGEYNNTLVLSEQYIEELDKREILIESLNK 275

Query: 407 KYSET-----LKEVDSL---KDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIK 458
           K ++T     +KE   L   KD   +V+KR+  L ++ + L  Q + + QQ V   E + 
Sbjct: 276 KLNQTNSELKIKESTELQQAKDADAEVSKRLADLHVKNEDLKLQCQTIQQQSVTDSEMLS 335

Query: 459 SVNQKT-----------------NKAEKLLKSNQHSLNATEANLRELRQSQLDYE-KELQ 500
           S+N +                   KAE  +K+N  SL   + +L   R     ++ K+ +
Sbjct: 336 SINAQIEAKELQLKKFEPRFDELTKAESEMKANFISLQQRQRDLLSKRGKYAKFKNKDER 395

Query: 501 D--LNQELITERAKLEDVKI---SLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLA 555
           D  LNQE++     L   K    SL+E+   I+A IA         D Q+ +    +Q  
Sbjct: 396 DSWLNQEILVLEEALASSKASRESLEEERAKIAADIA-------ALDEQIVELMDYVQ-- 446

Query: 556 ESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAEC 615
                        I  ++E L+NE+    +  L+K    + L + E  + +   T   E 
Sbjct: 447 ----------GPGITAELEDLQNEVISMKKTYLSKIDERKGLWRTEQKLQSVFETLVEEV 496

Query: 616 SSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDL 675
             +   L +     I  R   +  R       N + ++  L   + S       G LG+L
Sbjct: 497 KRSEGNLNE-----IMDRNLAIGLR-------NVTEIVQRLNLPEGS-----VFGPLGEL 539

Query: 676 GVIDEKYD-VAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGK 734
             + EKY   A       L  +VV++       ++ L  +K G   F+ L+++  +    
Sbjct: 540 IKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI--YVDPN 597

Query: 735 IQTPE----NVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRV--V 788
           IQ P     N   L   +K  D KF  A   V   T+  + L Q +++A   K+F +  V
Sbjct: 598 IQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFNLNSV 653

Query: 789 SLDGKLIDISGTMSGG 804
           +LDG   D  G ++GG
Sbjct: 654 TLDGDKADNKGVLTGG 669

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 81/152 (53%), Gaps = 5/152 (3%)

Query: 1240 LKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS-- 1297
            LK+++ +   + F  +S    ++++ +   G  EL +      +S GV+  V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1298 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1357
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1358 -QFIVISLRNNMFELAQQLVGIYKTQNMTKSA 1388
             QFI+ + R++M E+A  ++ + K  N   S 
Sbjct: 1074 TQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 141/646 (21%), Positives = 273/646 (42%), Gaps = 87/646 (13%)

Query: 209 SCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKK 268
           S SVEV F    ++    T +  +    V  R+        Y +ND+     ++ ++L+ 
Sbjct: 2   SASVEVIFDNNDEQMSLPTGVKPKPNNEVSIRRTIGLKKDDYQINDRNITRGDMIRMLES 61

Query: 269 EGIDLDHKRFLILQGEVENIAQMRPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIE 328
            G  + +   ++ QG++  +   + K               + G   ++ +++  L +++
Sbjct: 62  VGFSMSNPYNIVPQGKIIALTNAKDKE-------RLLLLEEVVGAKSFENKLQASLLKMD 114

Query: 329 -------VLNESCIEKENRFHIVDQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIW 381
                   +N+   E EN+ + ++QEK  LE   +                 K+IQ+ ++
Sbjct: 115 ETEQKRFQINKEMKELENKLNEMEQEKIELEKYNN------------LEKNKKVIQFNLY 162

Query: 382 QNDIKLTSTLDKSSKLKGQLDQ---ENEKYSETLKEVDSLKDESKQVAKRIET-LAIEEK 437
             D +L   +++  KL  + +     +EKY + L + + + ++ K     IE  L I+ +
Sbjct: 163 --DRELNDIINQIEKLDIEYNSILISSEKYLQELDKRELIIEQLKMKLNHIEDELKIKNQ 220

Query: 438 ALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEANLR----------- 486
           +   +   L+  + AI +KI +   K  + E  +K+N+  L     NL+           
Sbjct: 221 SEFEE---LNNTKDAISQKITNYQIKIKEFENKIKTNKSQLKINNQNLKLLDELINEKQL 277

Query: 487 ELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQ 546
           EL + +  YE EL ++NQ+L  E  KL+D     +EK + I         ++E  +  +Q
Sbjct: 278 ELNEIKPQYE-ELNNVNQDLKFEINKLKD-----QEKILIIKNNKYSQFANIEERNEWIQ 331

Query: 547 QKRAEIQ------------LAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVI 594
           ++   +             L + E+ L ++ +  IN+ I+ L   I    E  +  +++ 
Sbjct: 332 EEINNLNLNLTTLNNTCKGLEDEEMDLTREFD-EINQKIQDLNTSI---NESTITIDEIE 387

Query: 595 RELKQEESDVTAEVHTAGAECSSASARLKKMHEI---LIAQRQRTLDARAAFSSAQNKST 651
            E+K      T E+     E      +L  + E     I + +R+++    +S +Q  S 
Sbjct: 388 HEIKDLNEMYTKEIDKR-KELWREENKLDTVLETNLDSINRIERSINENIDYSLSQGISN 446

Query: 652 VLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAIS-TACPRLEDIVVESVECGQQCIEY 710
           V   + KL      +  +G LG+L  + EKY   +   A   L +I+V++ E   Q +  
Sbjct: 447 VKEIVNKLNIPE--TSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNE 504

Query: 711 LRKNKLGYARFILLDKLRKFHTGKIQTP----ENVPRLFDLVKPKDDKFIPAFYSVLRDT 766
           L + + G   FI L+++   +   I  P     N   L   +K  D KF     +V   T
Sbjct: 505 LIRMQNGRVTFIPLNRIE--NGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKT 561

Query: 767 LAAQSLAQANRVAYGKKRFRV--VSLDGKLIDISGTMSGGGSHVVR 810
           +  + L   NR+    K F++  ++LDG  ID  G +SGG  ++ R
Sbjct: 562 IVVKDLQLGNRLC---KEFKLQAITLDGDRIDSKGVVSGGYFNINR 604

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 1279 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1336
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1337 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1378
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +   +
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
            Ashbya gossypii AGR236W
          Length = 1170

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 6/96 (6%)

Query: 1298 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKT--QNMTKSASL 1390
            +QFIV+SL+  MF  A +   ++KT  Q+ T + S+
Sbjct: 1137 SQFIVVSLKEGMFNNANR---VFKTRFQDGTSAVSV 1169

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 128/315 (40%), Gaps = 48/315 (15%)

Query: 527 ISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEE 586
           ++ GI+        ++ QL   +A  +L E+E+S+ K  N RI      L+ E+A     
Sbjct: 385 LTTGISSTGATDGGYNSQLAAAKA--KLGEAEISI-KKANMRI----AMLQKELA----- 432

Query: 587 KLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMH---EILIAQRQRTLDARAAF 643
             + E +++  K++  +   +V   G E       L K     E++   R+R  + +   
Sbjct: 433 --SSEPLLQRAKKDNEEQIMQVKQRGQEIEKLKVSLNKSGFNPELMKTLRRRENELKNNL 490

Query: 644 SSAQNKSTVL-----------TALTKLQKSGRISGFHGRLGDLGVIDEKYDVAIS---TA 689
               N +  L           T+ TK      + G   ++  LG   + +D A +    A
Sbjct: 491 QKLSNDTEYLRRKVANLEFNYTSPTKDFNPQSVKGVAAQVFTLG--KDNFDSANALQVCA 548

Query: 690 CPRLEDIVVESVECGQQCIE--YLRKNKLGYARFILLDKL-------RKFHTGKIQTPEN 740
             RL +I+V++ +   Q +E   LRK        I L+K+             K   P  
Sbjct: 549 GGRLFNIIVDNEKTASQLLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKIAPGK 604

Query: 741 VPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKK-RFRVVSLDGKLIDISG 799
           V    +L+  ++D    A   +   +L       A ++ +  + R R ++LDG + D  G
Sbjct: 605 VELALNLIGYEED-VSKAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDPEG 663

Query: 800 TMSGGGSHVVRGLMR 814
           T+SGG S+    L++
Sbjct: 664 TLSGGSSNNTNSLLK 678

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%)

Query: 1301 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1360
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1361 VISLRNNMFELA 1372
              + R +M  +A
Sbjct: 1177 CTTFRTDMINVA 1188

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 9/152 (5%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFG-FRANKMRQDRL 194
           I  +++  FK+Y  R VV  F    + VVG NGSGKSN   ++ FV     +N  R+DR 
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTL-VVTRKAFKNNSSKYYVN 253
             +   +     + S  VE+ F    D+P+          T  V  R+       +Y +N
Sbjct: 64  GFIYQGA---GQVMSAFVEIIF----DDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMIN 116

Query: 254 DKESNYTEVTQLLKKEGIDLDHKRFLILQGEV 285
           DK S   +V ++L+  G    +   ++ QG +
Sbjct: 117 DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRI 148

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 82/163 (50%), Gaps = 16/163 (9%)

Query: 135 CINKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 192
            I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 193 RLSDLIHNSEVHPNLKSCSVEVHFQYVVDEP--DGTTRIDEEKPTLVVTRKAFKNNS-SK 249
           R+ D I N E        S+E+  +   + P  +G   +D E  T+ +TR+  K+ S S+
Sbjct: 92  RVEDFIKNGE-----DRGSIEITLK---NSPKVEGMPGVDSEADTIKITRELIKSKSKSR 143

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           Y +ND+  +  +V  L+ K  I LD+    + Q  VE  A+++
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLK 186

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1360 IVIS 1363
             +I+
Sbjct: 1039 FLIT 1042

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 80/164 (48%), Gaps = 18/164 (10%)

Query: 135 CINKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 192
           CI K+ LQDF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 193 RLSDLIHN----SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSS 248
           ++ D I N    S +   LK+ S +VH    ++  D T +I     T ++TR   +   S
Sbjct: 98  KVEDFIKNGQDVSRIEITLKN-SPKVHDIENINAHDETIKI-----TRIITRSKRR---S 148

Query: 249 KYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            Y +ND + +   V  L+ +  I LD+    + Q  VE  A+++
Sbjct: 149 DYLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 ISLRNNMFELAQQLVGIYKTQNM 1384
            I+         + L G+Y  + M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 195
           + +L L +F +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 196 DLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDK 255
           D    S +     S  ++V   ++  E  GTT     K + V+TR   K  +S YYV+  
Sbjct: 115 D----SFIKNGADSARIDV---WLAGEDPGTTL----KVSRVLTRNHKK--ASLYYVDGV 161

Query: 256 ESNYTEVTQLLK-KEGIDLDHKRFLILQGEVENIAQMRP 293
           E++   V QL+  +  I LD+    + Q  V+  A++RP
Sbjct: 162 ETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 100/444 (22%), Positives = 177/444 (39%), Gaps = 97/444 (21%)

Query: 947  MEIGGSEL-------QIQNSKVTSTIQRMEILTXXX-------XXXXXXXXXXENELKKS 992
            +EIG + L       + Q  ++TST+QR E                       E ELK+ 
Sbjct: 654  VEIGSTNLYQQSVLTEQQRRELTSTVQRFEGQIKEKREQLDEISARKSKLQHREQELKRE 713

Query: 993  AKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRL 1052
             + +GN   + +      +SL E     ++ LE  +K  D + D++     K+ QL+ ++
Sbjct: 714  GQRIGNKLSEFNRLRSHYSSLGEKLAATKRKLE--QKRHDSRTDVT----PKIAQLEAQI 767

Query: 1053 AQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRD----VTRTLQL 1108
            AQ     T      + +N KL+           + + LE+D+   ++R+    ++  +  
Sbjct: 768  AQNLVDQTGKIRQMVRLNTKLQ---------AAQTQSLEADIGFFEVRNRQAALSEVIGA 818

Query: 1109 LDEGESTNNSKMPNELQEKRTEGADATRQXXXXXXXXXXXXXXNDEVMEVDEKPHELENG 1168
             +E E+T    +  E +EKR +                      +++   D+   +  N 
Sbjct: 819  FNEQETT----LTREYREKRDQ--------IETMRNTAEYKLWVEQIKGYDDALKDQLNE 866

Query: 1169 LPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVD---VEILEEYAKRLAEHKRRKVDLNE 1225
            L    E++    + E +G Q+E L++ +  +N D   + IL+E  ++LA+ K R   L  
Sbjct: 867  LAEKYESQ-GDFNTEYIGEQVERLESEIRMINHDESSIAILQEVERKLADVKAR---LPA 922

Query: 1226 AVGERDA----MREKLGELKKR----------RFDEFMQGFG---IISMTLKEMYQ---- 1264
             V + DA    M     EL+ R          RF       G    I ++   +YQ    
Sbjct: 923  MVRKLDAATASMSTMQAELEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEM 982

Query: 1265 --MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1322
              M+    NA L+ +DS                         SGGE+ +S++  + AL +
Sbjct: 983  KIMVKFRDNAPLKRLDS----------------------HTQSGGERAVSTVLYIIALQE 1020

Query: 1323 YKPTPLYVMDEIDAALDFRNVSIV 1346
            +   P  V+DEI+  +D RN  IV
Sbjct: 1021 FTSAPFRVVDEINQGMDQRNERIV 1044

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 79/163 (48%), Gaps = 18/163 (11%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I K+ LQDF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 194 LSDLIHN----SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSK 249
           + D I N    S++   LK+       +Y +D  D T +I     T ++TR   +   S 
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEY-IDARDETIKI-----TRIITRSKRR---SD 149

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           Y +ND + + + V  L+ +  I LD+    + Q  VE  A+++
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 IS 1363
            I+
Sbjct: 1047 IT 1048

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 79/165 (47%), Gaps = 24/165 (14%)

Query: 136 INKLVLQDFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 192
           I  L L++F +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 193 RLSDLIHNSE----VHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKN-NS 247
           ++ D I N E    +   LK    E   +YV    DGTT+         VTR   +N  +
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKR-DPEAEDRYVAS--DGTTK---------VTRVLHRNRKA 150

Query: 248 SKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           S+Y++N +    + V +L+ +  I LD+    + Q  VE  A+++
Sbjct: 151 SEYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1362 IS 1363
            ++
Sbjct: 1049 VT 1050

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 80/163 (49%), Gaps = 18/163 (11%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I K+ LQDF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 194 LSDLIHN----SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSK 249
           + D I N    S +   LK+ S ++H    ++  D T ++     T ++TR   +   S 
Sbjct: 99  VEDFIKNGQDTSRIEITLKN-SPKIHDIEFINTHDETIKV-----TRIITRSKRR---SD 149

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           Y +ND++ +   V  L+ +  I LD+    + Q  VE  A+++
Sbjct: 150 YLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 IS 1363
            I+
Sbjct: 1047 IT 1048

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 20/164 (12%)

Query: 138 KLVLQDFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 194
           KL L +F +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 195 SDLIHNSE----VHPNLKSCSVEVHFQY-VVDEPDGTTRIDEEKPTLVVTRKAFKNNSSK 249
            + I N      +   LK+ S  +H  + +++  D    +   K  L + +K      SK
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV---KRVLSMEKK-----KSK 169

Query: 250 YYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
           YY+N+K      V  +++   I LD+    + Q  VE  A+++P
Sbjct: 170 YYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP 213

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1255 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SG 1306
            IS     ++  +   G  EL+  DS + +        +  K  +R+ + L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1307 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1361
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1362 ISLRNNMF 1369
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 15/160 (9%)

Query: 136 INKLVLQDFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 192
           I KL L++F +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 193 RLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYV 252
           R+   I N E         +EV  +    +P  T        T  V+R  +    S+YY+
Sbjct: 125 RVDSFIKNGE-----NRGLIEVTLK---RDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYL 176

Query: 253 NDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           ND+  +   V  L+ +  I LD+    + Q  VE  A+++
Sbjct: 177 NDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1362 IS 1363
            ++
Sbjct: 1072 VT 1073

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1282 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1341
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1342 NVSIVANYIKERTKN---AQFIVIS 1363
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (48%), Gaps = 18/158 (11%)

Query: 141 LQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 198
           LQDF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 199 HN----SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVND 254
            N    S +   LK+ S +V+    V+  D T +I     T ++TR   +   S Y +ND
Sbjct: 104 KNGQDVSRIEITLKN-SPKVNDIENVNAHDETIKI-----TRIITRSKRR---SDYLIND 154

Query: 255 KESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            E + + V  L+ +  I LD+    + Q  VE  A+++
Sbjct: 155 CEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 IS 1363
            I+
Sbjct: 1047 IT 1048

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 16/166 (9%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 194
           I K+ LQ+F +Y  R        S + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 38  IVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 195 SDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEE-----KPTLVVTRKAFKNNS-- 247
            D I N E      +  +E+  +   D  +  + ++ +     K  L VTR   ++ +  
Sbjct: 96  DDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC 150

Query: 248 -SKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            S Y++NDK      +  L+K   I LD+    + Q  VE  A+++
Sbjct: 151 KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1362 IS 1363
            I+
Sbjct: 1050 IT 1051

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1289 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1348
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1349 YIKERTKN---AQFIVIS 1363
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDR 193
           I K+VL +F  +   ++ +GP     + +VG NGSGKS ++ ++    G RA +  R + 
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 194 LSDLI----HNSEVHPNLKSCSVEVHFQ 217
           L DLI    H++++  +L + +   ++Q
Sbjct: 132 LKDLIREGCHSTKIRLHLDNLNHGAYYQ 159

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 20/159 (12%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I KL LQ+  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVN 253
           + + I N E    + +  +  H       P+   +I     T ++TR   K   S+YY++
Sbjct: 94  IDNFIKNGENTAQIDTF-LRGHM------PNEVIKI-----TRIMTRNKKK---SEYYID 138

Query: 254 DKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           D  S  T V +L  +  I LD+    + Q  VE+ A+++
Sbjct: 139 DSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLK 177

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1362 IS 1363
            I+
Sbjct: 1035 IT 1036

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 106 IKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVG 165
           IK+SP++         YD  Q+        I K+ +++F +Y    V      SF+ ++G
Sbjct: 36  IKLSPIQ---------YDDYQAG------SIIKIKMKNFMTYG--LVEYQLCPSFNMIIG 78

Query: 166 PNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPD 224
           PNGSGKS V+ ++      + +   R D ++  I N +      S  +E+  +Y  D   
Sbjct: 79  PNGSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGKT-----SGKIEITLKY-SDRIK 132

Query: 225 GTTRIDEEKPTLVVTRK-AFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQG 283
               ++  + T+ + R+ +     S Y +N+   N  +V  ++ K  I LD+    + Q 
Sbjct: 133 NVKGVNPNRETVTIKREISIDAKKSNYKINNTVVNEKDVRDIVSKLNIQLDNLCQYLPQE 192

Query: 284 EVENIAQMR 292
            +++ A+++
Sbjct: 193 RLKDFARLK 201

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1362 IS 1363
            ++
Sbjct: 1055 VT 1056

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar to
            uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
            Structural maintenance of chromosomes (SMC) protein
            interacts with Rhc18p and Nse1p to form a large complex
            S. pombe homolog forms a heterodimer with S. pombe Rad18p
            that is involved in DNA repair
          Length = 1099

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 96/220 (43%), Gaps = 32/220 (14%)

Query: 1179 SLDVEDLGAQIEDLQNYVDSVNVD---VEILEEYAKRLAEHKRRKVD-LNEAVGERDAMR 1234
            S  ++ +   I+ L + +  VN D   + IL++  K L +  R   + L      RD+++
Sbjct: 867  SFGLQHITDLIDKLDSEISMVNHDESAIMILQQAEKELKKLSRSLPNQLTHLANIRDSVK 926

Query: 1235 EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDP--FSEGVTFSVM 1292
            EK   L+ R  DE +Q    +S     ++  +   G   LE      P  FSE     +M
Sbjct: 927  EKRDVLEPR-LDEVVQR---VSQRFARLFVGVGSAGAVNLE-----KPTLFSEW-KLEIM 976

Query: 1293 PPKKSWRNITNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1347
               +    +  L     SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV 
Sbjct: 977  VKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVH 1036

Query: 1348 NYIKERT---KNAQFIVISLRNNMFELAQQLVGIYKTQNM 1384
              + E       +Q+ +I+         + L G+Y  + M
Sbjct: 1037 KAMVENACAENTSQYFLIT--------PKLLTGLYYHEKM 1068

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 90/417 (21%), Positives = 163/417 (39%), Gaps = 98/417 (23%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYV----------------------VDEPDGTTRIDE 231
           + D I N E         +E+  + V                      VD   G  ++D 
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCG--QLDL 161

Query: 232 EKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQM 291
            K T ++ R   K   S YY+NDK  +   V  L+K   I LD+    + Q  VE  A++
Sbjct: 162 IKFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARL 218

Query: 292 RPKAXXXXXXXXXXXXXXITGTAKYKPQIETILQEIEVLN--ESCIE-----KENRFHIV 344
           +                 +       P +  IL+E++VL   E  +E     K+ R+  +
Sbjct: 219 K------------SDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTEL 266

Query: 345 DQEKSSLETGKDXXXXXXXXXXXXXXXRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQE 404
             E++ LE                    +K++ Y      + +    +K  K KG     
Sbjct: 267 CNERTKLEASV-QSLKEFENKKLEIEYHNKLLPY------VMIKDHREKLQKFKGDY--- 316

Query: 405 NEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKT 464
                              ++AKR        + L+  K+   + ++ IEE +  + +  
Sbjct: 317 -------------------EIAKR------NLRDLMKDKKPFVKTKLEIEENLNEIAEDK 351

Query: 465 NKAEKLLKSNQHSLNATEANLRELR------QSQLD-YEKELQDLNQELITERAKLE 514
              E  L+S++ +L+ T  NL  +R      QSQ+  Y+   + L Q++++ +++LE
Sbjct: 352 RTNETALESSKDALSKTVENLNAIRESIVKKQSQISYYQSRTKKLQQQILSTKSELE 408

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1362 IS 1363
            I+
Sbjct: 1074 IT 1075

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1360 IVISLRNNMFELAQQLVGIYKTQNM 1384
             +I+         + L G+Y  + M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 138 KLVLQDFKSYAGRQVVGPF--HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 194
           KL +++F +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 195 SDLIHNSE----VHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
            D I N E    V   LK    EV    +V   D   +I     T  ++R       S Y
Sbjct: 104 EDFIKNGEEKGLVEVTLKK-PAEVEHSPIVKSHDQVIKI-----TRHLSR---SKRDSDY 154

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRP 293
            +ND E   + V  ++ +  I LD+    + Q  V + A   P
Sbjct: 155 QINDIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 110 PVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGS 169
           P +K RL++  + D EQ Q  +    I K+ L +F +Y+  +       S + ++GPNGS
Sbjct: 24  PARK-RLKITAI-DTEQFQPGS----IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGS 75

Query: 170 GKSNVIDSMLFVFGFRANKM-RQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTR 228
           GKS  + ++      +   + R  +L D I N E         VEV  + V +    T  
Sbjct: 76  GKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGE-----DQSVVEVTLKNVPESDFNTDT 130

Query: 229 IDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENI 288
           I      L+ T         +Y +N      T +   +KK  I LD+    + Q  VE  
Sbjct: 131 I------LIKTTINRGKKKPEYAINGSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEF 184

Query: 289 AQMR 292
           A+++
Sbjct: 185 ARLK 188

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1362 IS 1363
            I+
Sbjct: 1044 IT 1045

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 90/189 (47%), Gaps = 24/189 (12%)

Query: 1189 IEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKR---RF 1245
            I  L+  +  +N D   ++   + L++ K  +  L   V    ++R K+  ++     R 
Sbjct: 875  IAKLETEIQIINHDESAIKILKQTLSDIKYLQEKLPGQVKRLSSIRRKMWSIRSELEPRL 934

Query: 1246 DEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL- 1304
            DE ++    IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  L 
Sbjct: 935  DEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAELK 984

Query: 1305 -------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TK 1355
                   SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E    K
Sbjct: 985  KLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENACAK 1044

Query: 1356 N-AQFIVIS 1363
            N +Q+ +I+
Sbjct: 1045 NTSQYFLIT 1053

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (43%), Gaps = 20/164 (12%)

Query: 136 INKLVLQDFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 192
           I KL L +F +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 193 RLSDLIHN----SEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSS 248
           ++ D I N    S +   +K+      +  +     G+  +   K  ++  +K       
Sbjct: 102 KVEDFIKNGTEESVIELTVKNSKAVSGYSMI----GGSDEVINIKTVIMKAKK-----KC 152

Query: 249 KYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            YY+N +     +V  L+    I LD+    + Q  VE  A+++
Sbjct: 153 IYYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1351 KERTK---NAQFIVIS 1363
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 36.6 bits (83), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I KL L +F  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 194 LSDLI 198
           L DLI
Sbjct: 137 LKDLI 141

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 107/219 (48%), Gaps = 33/219 (15%)

Query: 444 RGLDQQRVAIEEKIKSV-------NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYE 496
           R L + ++ +E+KIK V       N + N  +K L     SL  T   L      Q++  
Sbjct: 778 RLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRL----DSLTTTNDKL------QVELN 827

Query: 497 KELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAE 556
           KEL  +N     +R K+ D++ +L + T N S+ + + ++D E    +L++K+ EI    
Sbjct: 828 KELTKIN----IQRLKISDLEKTLSQNT-NGSSSLPRVDQDFEKLKNELKEKQLEINQYR 882

Query: 557 SELSLLKDTNARINKDIEQLKNEI--ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAE 614
             L+L ++T  R+ KD+ + +  +  A  G+E+L ++  + EL QE S + + +    A+
Sbjct: 883 DLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQ--LAELTQECSSMNSLLQKQKAK 940

Query: 615 CSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVL 653
           C           +I+  +   T + + + SS +NK T L
Sbjct: 941 CEDD-------QKIIQDKATETENLKNSLSSLENKITTL 972

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1272 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFA 1319
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1320 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1363
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1357 -AQFIVISLRN--NMFELAQQLVGIYKTQNMTKSASLKNND 1394
              Q I+I+ ++   + E+    V I+K ++  +  +  N D
Sbjct: 1074 RTQTIIITPQDIGKITEIDSTGVKIHKMKDPQRQNNSNNTD 1114

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1353
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1354 TKNAQFIVISLRN--NMFELAQQLVGIYKTQN 1383
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1362 IS 1363
            I+
Sbjct: 1072 IT 1073

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 16/162 (9%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR- 193
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 194 LSDLIHNSEVHPNLKSC---SVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKY 250
           + D I N E H  ++     S  +H    V E   T  I     T ++TR   K   S+Y
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITI-----TRILTRSKKK---SEY 174

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            +ND       V +L+    I LD+    + Q  VE  A+++
Sbjct: 175 KINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1302 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1361
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1362 ISL 1364
            IS+
Sbjct: 655  ISI 657

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1296 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1355
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1356 N---AQFIVIS 1363
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 68/162 (41%), Gaps = 14/162 (8%)

Query: 135 CINKLVLQDFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 191
            I  + L +F +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 192 DRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFK-NNSSKY 250
            R+ D I N          ++E+  +   +   G   I  E   + V     K      Y
Sbjct: 101 KRVEDFIKNGTA-----ESTIEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRKCAY 154

Query: 251 YVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
           Y+N +  +  ++  L+    I LD+    + Q  VE  A+++
Sbjct: 155 YINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1360 IVISLRNNM 1368
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--FRNV---SIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  +   ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1360 IVIS 1363
             +I+
Sbjct: 1058 FLIT 1061

 Score = 36.6 bits (83), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 34/181 (18%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYVVDEPD------GTT--RIDEE---KPTLVVTRKA 242
           + D I N +      +  +E+  +   D+P+      G++  RI      K  L +TR  
Sbjct: 95  VEDFIKNGQ-----DTSKIEIVLK---DDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNL 146

Query: 243 FKNN----------SSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292
            K            + +Y +N   +  + V  L+ K  I LD+    + Q  VE  A++R
Sbjct: 147 EKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLR 206

Query: 293 P 293
           P
Sbjct: 207 P 207

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 508 TERAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNA 567
            E+   E+  IS +     I A + Q  +D +P+  +    + E   AE EL  LK+T +
Sbjct: 768 VEKKNQENAVISYQGALQEIEAKLEQIGQDAQPYKNKFDLTKVEQTTAEQELVELKNTIS 827

Query: 568 RINKDIEQLKNEIARGGEEK----LAKEKVIRELKQEESDVTAEVHTAGAECSSASA 620
             +  +++L+++I    E+K      +E ++ ++++ E  + +++  A   CS   A
Sbjct: 828 TRDSRVQKLEDDIEYYSEKKKDLERKRESILSQMEEFEQGIQSQIRNAEVYCSRDQA 884

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1283 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1341 RNVSI----VANYIKERTKNAQFIV 1361
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 1283 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1332
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1333 EIDAALD 1339
            E D  +D
Sbjct: 1036 EFDVFMD 1042

>YNL247W Chr14 (182875..185178) [2304 bp, 767 aa] {ON}
           Cysteinyl-tRNA synthetase; may interact with ribosomes,
           based on co-purification experiments
          Length = 767

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 10/163 (6%)

Query: 541 WDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQE 600
           W+ QL  K + I     E+   +++     K I  LKN+ A  G        + +EL  +
Sbjct: 459 WNNQLDFKESLIH----EVKSFENSMNNFFKTIRALKNDAASAGHISKKFSPLEKELLAD 514

Query: 601 ESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQ 660
             +  ++VH+A  +  S    LK + E++         A AA         ++   + + 
Sbjct: 515 FVESESKVHSAFCDNLSTPVALKTLSELVTKSNTYITTAGAALKI----EPLIAICSYIT 570

Query: 661 KSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVEC 703
           K  RI GF  R  +LG   +    +   +   LED V+  V+C
Sbjct: 571 KILRIIGFPSRPDNLGWAAQA--GSNDGSLGSLEDTVMPYVKC 611

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1327 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1377
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1378 IYKTQNMTKSA 1388
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1283 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1342
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1343 VSIVANYIKERT 1354
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 136 INKLVLQDFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 193
           + K++L++F  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 194 LSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVN 253
           L DLI          S S ++   Y+ +   G+ + D    T+++ R   ++    + + 
Sbjct: 129 LKDLIREG-------SYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 254 DKES 257
            KE 
Sbjct: 181 TKEG 184

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Smik_10.427 Chr10 complement(662836..664956) [2121 bp, 706 aa] {ON}
            YJR134C (REAL)
          Length = 706

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 60/113 (53%), Gaps = 23/113 (20%)

Query: 992  SAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDE------QQDLSHEMNEKL 1045
            SA +V     +L     E++S K++ +N+   L   EK+ DE      + D  +E+NE+ 
Sbjct: 593  SAHLVNKLSTELKRLEGELSSSKDSYNNL---LREKEKANDEILRLMEENDKFNEVNEQK 649

Query: 1046 DQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLK 1098
            D+L +R+ QM++              KLE    LLG  T++V +LE+D+++LK
Sbjct: 650  DELLKRVEQMQS--------------KLETSLQLLGEKTEQVEELENDVSDLK 688

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 90/200 (45%), Gaps = 44/200 (22%)

Query: 412 LKEVDSLKDESKQVAK-RIETLAIEEKAL------LAQKRGLDQQRVAIE---------- 454
           L+E++SL+ ES Q  K ++E  + +++AL        +K  L+QQ+ A+E          
Sbjct: 84  LQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVARLL 143

Query: 455 -EKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKE--------------L 499
            EKI  ++    +A+ L++ N           R LRQ  LD E E              L
Sbjct: 144 NEKISELSSFKQEADDLMQEN-----------RRLRQQTLDLESESRVSKSEDLQRKAEL 192

Query: 500 QDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESEL 559
             L+QEL   R+  E ++  L +K    +A     +  L     +L+    E+Q +    
Sbjct: 193 HRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTN 252

Query: 560 SLLKDTNARINKDIE-QLKN 578
             L++ NARI  D+E QL+N
Sbjct: 253 KSLREHNARITNDLETQLRN 272

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
            Ashbya gossypii AER044W
          Length = 1102

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 1299 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTI 1047

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 136 INKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 194
           I K++L++F  +    V      + + +VG NGSGKS ++ +++   G +A++  R   L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 195 SDLI 198
            +LI
Sbjct: 131 KELI 134

>Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa]
           {ON} YPR049C (REAL)
          Length = 1180

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%)

Query: 544 QLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQEESD 603
           Q+Q+  + ++    ++  L++ N + +KDI ++K  I+    EK A  + +  L QE + 
Sbjct: 702 QVQELESNVEDLLQQIRFLREENIQKSKDISEMKKNISDSEVEKKAYRETLNNLNQELAR 761

Query: 604 VTAEVHTAGAECSSASARLKKMHEILIAQ 632
           +T E  +   E  + +A  KK    +IAQ
Sbjct: 762 LTNEEQSHETEVFALNATFKKQLNDIIAQ 790

>SAKL0H08294g Chr8 (713096..714484) [1389 bp, 462 aa] {ON} similar to
            uniprot|P38934 Saccharomyces cerevisiae YOR198C BFR1
            Component of mRNP complexes associated with polyribosomes
            implicated in secretion and nuclear segregation multicopy
            suppressor of BFA (Brefeldin A) sensitivity
          Length = 462

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 59/115 (51%), Gaps = 2/115 (1%)

Query: 1002 DLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTE 1061
            D+ +  +++ +L      V   ++++ K + EQ  +S ++ +   +L Q L  +    +E
Sbjct: 17   DVSVRDKKLETLNAQLKKVDAEIQTIRKQI-EQHQVSSDVQQSRSKLHQDLKDIIKTQSE 75

Query: 1062 FKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNL-KIRDVTRTLQLLDEGEST 1115
             KS + +I+DK++ L+A +   T EV +     NN   + D+   L ++D G S+
Sbjct: 76   LKSRRQQIHDKIKSLDASIKRKTNEVNEKLGKKNNFSSVADIKDRLAVIDSGISS 130

>AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL250W (RAD50)
          Length = 1296

 Score = 33.5 bits (75), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 89/195 (45%), Gaps = 14/195 (7%)

Query: 405 NEKYSETLKEVDSLKDESKQVAKRI-------ETLAIEEKALLAQKRGLDQQRVAIEEKI 457
           N+++ + L ++DSL      +  +I       E L ++ + L+             EE I
Sbjct: 260 NQQFQQVLSKIDSLGHSRDSIGNQIQRLQDSIEPLDMDREKLVDLLENFSSSLAEKEEAI 319

Query: 458 KSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKE---LQDLNQELITERAKLE 514
             +  +   A+  L+SN+ +  +  +    L+  Q +YEK    L +L  +L +E    E
Sbjct: 320 NRMEIEAAAADDELQSNKATYESLLSESAVLKSKQKEYEKNRDLLTELTNQLASEGINTE 379

Query: 515 D----VKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARIN 570
           D    ++  +++    IS    +++K+L     +L  K+ E+   E +LS  KD  A++N
Sbjct: 380 DSLGCIESMIQKAETKISDLRLKHQKELNEAQERLSGKQNELIREEQKLSYTKDDRAKLN 439

Query: 571 KDIEQLKNEIARGGE 585
             +  LK ++AR  E
Sbjct: 440 DQLMTLKQKLARISE 454

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 87/167 (52%), Gaps = 22/167 (13%)

Query: 399  GQLDQENEKYS---ETL-KEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIE 454
            G L ++NE  S   ETL K  D LK E   V+KR E L I +K ++ + +  D+Q   ++
Sbjct: 1628 GNLKEKNESLSEENETLSKSADQLKSE---VSKRDEALKISKK-VIDEYKVKDEQLSKLQ 1683

Query: 455  EKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLE 514
             ++  VN++ + +++ ++  Q  +   E N ++   ++ D E +++ L +E+   +AKLE
Sbjct: 1684 SQLAQVNKEYSDSKQAMEDLQKRIGDAEENTKQFNNTKKDDEDKIKQLEKEVEDMKAKLE 1743

Query: 515  DVKISLKEKTV-NISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELS 560
                 L E +V N    I++ EK +E           EI LAE E++
Sbjct: 1744 -----LSESSVANDQLKISELEKIIED--------NKEILLAEKEVN 1777

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
           plaque spindle pole body (SPB) component, ortholog of
           human kendrin; involved in connecting nuclear
           microtubules to SPB; interacts with Tub4p-complex and
           calmodulin; phosphorylated by Mps1p in cell
           cycle-dependent manner
          Length = 944

 Score = 33.1 bits (74), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 10/93 (10%)

Query: 494 DYEKELQDLNQEL--ITERAK-----LEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQ 546
           +YEK+L+ L +++    E AK     +E++KI + E +  +S   +   KD++  D Q+ 
Sbjct: 548 NYEKQLESLRKDIEEYKESAKDSEDKIEELKIRIAENSAKVSEKRS---KDIKQKDEQIS 604

Query: 547 QKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579
                ++L E E+S LK    R  KD  QLK+E
Sbjct: 605 DLTQNLKLQEDEISSLKSIIDRYKKDFNQLKSE 637

>Kpol_1039.28 s1039 (88670..89869) [1200 bp, 399 aa] {ON}
           (88670..89869) [1200 nt, 400 aa]
          Length = 399

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 177 SMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVE 213
           +M F FGF +N    D L D I +  +    KSC++E
Sbjct: 26  AMSFSFGFTSNDFSDDELEDSIPSQNISGQTKSCTIE 62

>TDEL0C04190 Chr3 (748567..748881) [315 bp, 104 aa] {ON} Anc_2.203
           YNL086W
          Length = 104

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 833 QLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKL 876
           +LENE+   + SF  +S    E+E ++ KL  R+ EI+L+  KL
Sbjct: 57  KLENEVLYDKSSFDDSSHKLNELEKRMNKLIKRMNEIKLRSEKL 100

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 32.7 bits (73), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1283 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1342
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1343 VSIVANYIKERTKNAQFIVISL 1364
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar to
           uniprot|P47166 Saccharomyces cerevisiae YJR134c SGM1
          Length = 611

 Score = 32.3 bits (72), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 9/133 (6%)

Query: 375 MIQYKIWQNDIKLTSTLDKS--SKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETL 432
            I+YK  Q +   T+T D S    +KG+    +E+ ++  K+++  + +     K +  L
Sbjct: 79  FIEYKTKQKNASTTTTGDSSVFKLIKGK----DEEIAQLTKKLEDRRKQDTANEKLLSKL 134

Query: 433 AIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKS---NQHSLNATEANLRELR 489
             + + L      L ++     ++I ++ QK + +EK+L+    N H +   E++ ++LR
Sbjct: 135 TADNEKLNKNNDNLSKKLNESNQEISNLQQKYSLSEKMLEESTKNSHDVQVLESSNKQLR 194

Query: 490 QSQLDYEKELQDL 502
           QS +D EK +QDL
Sbjct: 195 QSIIDKEKTIQDL 207

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
            Ashbya gossypii ADL149W
          Length = 1362

 Score = 32.7 bits (73), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 82/185 (44%), Gaps = 26/185 (14%)

Query: 415  VDSLKDESK-------QVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKA 467
            +D+  DE +       ++ K+ E+L +E + L AQ R   Q    +   IKS  Q+ N+ 
Sbjct: 1115 IDNFGDEERSRLGKYDELEKQFESLKVEHEKLKAQDR---QSLNEVHVDIKSHTQRMNEV 1171

Query: 468  EKLLKSNQ---HSLNATEANLRELRQSQLDYEK------ELQDLNQELITERAKLEDVKI 518
               LKS Q    S++     +R L + QL  +K      ++Q  N E+ T   +L     
Sbjct: 1172 LSHLKSQQGDDKSMDHGFDGVRGLEKHQLIIDKLSKQVEDVQKENMEITTLHEELLHNYE 1231

Query: 519  SLKEKTVNISAG-------IAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINK 571
            SL++   +ISA        I   EK+ +     +      +QL++ EL  LK  N ++ +
Sbjct: 1232 SLQKDYDSISAELLTKQNEINYLEKNYKSSLSSVTNSSKALQLSQHELEKLKQENVKLRE 1291

Query: 572  DIEQL 576
             IE  
Sbjct: 1292 QIEDF 1296

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,078,392
Number of extensions: 5752750
Number of successful extensions: 39739
Number of sequences better than 10.0: 1499
Number of HSP's gapped: 36441
Number of HSP's successfully gapped: 3660
Length of query: 1399
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1277
Effective length of database: 39,492,147
Effective search space: 50431471719
Effective search space used: 50431471719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)