Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038508.258ON41941921590.0
ZYRO0C01738g8.258ON41442016370.0
Smik_12.1448.258ON43843915920.0
KAFR0B027008.258ON42042215850.0
NCAS0B049908.258ON42042215780.0
Kpol_543.368.258ON42742815750.0
YLR085C (ARP6)8.258ON43843915610.0
Skud_12.1538.258ON43844015480.0
Suva_10.1698.258ON43843915410.0
KNAG0G020108.258ON42442215130.0
NDAI0B019608.258ON43944015100.0
SAKL0H17138g8.258ON41942015010.0
TBLA0H014608.258ON44244314690.0
KLTH0G13772g8.258ON42042114660.0
CAGL0L12166g8.258ON42141914360.0
Kwal_56.238328.258ON41942014260.0
AGR091W8.258ON41041513890.0
Ecym_43128.258ON41141513890.0
TPHA0A018308.258ON42142313870.0
KLLA0F19063g8.258ON41542213700.0
NCAS0C037008.23ON3754202894e-28
TBLA0C004408.23ON3754202884e-28
SAKL0B00968g8.23ON3754202885e-28
KLLA0D05357g8.23ON3754202886e-28
ABR222W8.23ON3764172886e-28
TDEL0C004708.23ON3754202868e-28
CAGL0K12694g8.23ON3754202868e-28
Suva_6.188.23ON3754202868e-28
Smik_6.398.23ON3754202868e-28
YFL039C (ACT1)8.23ON3754202868e-28
TPHA0D002508.23ON3754202868e-28
KNAG0L002508.23ON3754202869e-28
KAFR0D009408.23ON3754202869e-28
NDAI0G030408.23ON3754202851e-27
ZYRO0F02772g8.23ON3754272842e-27
KLTH0G18832g8.23ON3754202832e-27
Kpol_1058.158.23ON3754202823e-27
Ecym_15208.23ON3764202824e-27
Skud_6.318.23ON3603682665e-25
Kwal_14.11098.23ON3603682621e-24
NDAI0G029003.161ON3914312524e-23
KLTH0F06490g3.161ON3913852421e-21
Ecym_63852.117ON3774142383e-21
ZYRO0G05676g2.117ON3814152365e-21
SAKL0E11814g2.117ON3794172341e-20
AFR051W2.117ON4054142342e-20
KLLA0E22925g2.117ON3804152303e-20
NCAS0C035503.161ON3923662304e-20
TBLA0F008703.161ON3913662288e-20
NDAI0B044602.117ON3814192261e-19
Suva_4.2203.161ON3913662261e-19
YDL029W (ARP2)3.161ON3914312261e-19
SAKL0C07370g3.161ON3913662252e-19
TDEL0D046103.161ON3913662242e-19
ZYRO0B04928g3.161ON3913662233e-19
Smik_4.2063.161ON3913662233e-19
KNAG0K01130na 1ON3934332233e-19
KLLA0C03850g3.161ON3913662233e-19
CAGL0K01595g3.161ON3913662215e-19
Skud_4.2223.161ON3914312216e-19
Kwal_33.141773.161ON3373182189e-19
ADR316W3.161ON3913862181e-18
Ecym_52373.161ON3913662172e-18
TPHA0I013002.117ON3794152128e-18
Kpol_479.253.161ON3913662111e-17
NCAS0B071302.117ON3814242102e-17
TDEL0B048102.117ON3734152083e-17
KAFR0C01040na 1ON3373182038e-17
TPHA0A009203.161ON3913662003e-16
Kpol_1023.188.23ON3193341965e-16
KLTH0B05940g2.117ON3834161942e-15
YHR129C (ARP1)2.117ON3844111942e-15
Suva_15.3262.117ON3844131932e-15
Skud_8.1902.117ON3844171881e-14
Smik_8.2102.117ON3844181871e-14
Kwal_33.146422.117ON3834151801e-13
TBLA0B010702.117ON3834301738e-13
CAGL0H09042g2.117ON3874201683e-12
KNAG0B001701.514ON4534191667e-12
SAKL0D12804g1.514ON4564171668e-12
KAFR0D037001.514ON4494181641e-11
KNAG0H036502.117ON3874181631e-11
Ecym_32852.248ON7461611642e-11
ZYRO0G01936g1.514ON4613841623e-11
TDEL0F004701.514ON4614261613e-11
NDAI0A039701.514ON4624251604e-11
TBLA0D036801.514ON4584251604e-11
KAFR0F005902.117ON3864191595e-11
KLTH0C02508g1.514ON4514171595e-11
Kwal_23.48482.248ON7451351599e-11
KLLA0B13904g1.514ON4562491579e-11
TPHA0O010401.514ON4582511571e-10
NCAS0A122701.514ON4542511561e-10
ADL253C2.248ON7511361562e-10
AFR419C1.514ON4552471542e-10
TPHA0C031602.248ON7551301552e-10
CAGL0F00517g1.514ON4542511533e-10
Suva_12.1541.514ON4494221533e-10
YJR065C (ARP3)1.514ON4493831524e-10
Kwal_27.99581.514ON4453841515e-10
Ecym_31531.514ON4582521507e-10
Skud_10.2891.514ON4492511507e-10
Smik_10.3551.514ON4492511507e-10
YNL059C (ARP5)2.248ON7551341501e-09
TDEL0C041402.248ON7491491482e-09
KNAG0I018602.248ON7531371463e-09
Kpol_1056.161.514ON4602521453e-09
NDAI0D010602.248ON7531391454e-09
KLLA0F03421g2.248ON7471351421e-08
SAKL0E08602g2.248ON7471391411e-08
Kpol_282.41.287ON5011061382e-08
Suva_14.2812.248ON7551341383e-08
Skud_14.2722.248ON7551361383e-08
Smik_14.2672.248ON7551341374e-08
TBLA0E038602.248ON7591341365e-08
KAFR0J011602.248ON7511341348e-08
AFR105C1.287ON4791051312e-07
KLTH0G09482g2.248ON7451361312e-07
ZYRO0A01584g2.248ON7481361312e-07
NDAI0G055801.287ON5152211293e-07
Kpol_1003.162.248ON7491331303e-07
KLLA0D02288g1.287ON5201051251e-06
TPHA0I010301.287ON5031061222e-06
Ecym_63301.287ON4801051213e-06
KLTH0H09702g1.287ON4811051213e-06
Kwal_14.23771.287ON4811121161e-05
ZYRO0G21428g1.287ON4831051133e-05
Suva_6.1541.287ON4892171133e-05
KNAG0B019201.287ON5052391133e-05
SAKL0D05874g1.287ON4971051124e-05
Skud_10.1321.287ON488891115e-05
NCAS0B060601.287ON497891105e-05
CAGL0J10054g2.248ON7541331115e-05
YJL081C (ARP4)1.287ON4892221106e-05
TBLA0D053601.287ON5961251098e-05
Smik_10.1611.287ON4892201071e-04
KAFR0A015601.287ON4851051071e-04
TDEL0D015501.287ON480891062e-04
NCAS0G030502.248ON7431201053e-04
CAGL0M03201g1.287ON4931061035e-04
SAKL0F13772g7.448ON4222901000.001
Kpol_1036.153.124ON303085800.30
KLTH0C05324g7.448ON399253770.64
NDAI0A002001.11ON33026741.1
ZYRO0E08558g3.524ON37059741.2
KNAG0G027508.713ON407129741.3
Kwal_47.180068.50ON618123751.3
TBLA0H028002.593ON48442731.8
Kwal_27.105527.448ON351264722.3
Ecym_35681.484ON51280722.7
CAGL0M04499g8.348ON46976679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03850
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   836   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   635   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   617   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   615   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   612   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   611   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   605   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   600   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   598   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   587   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   586   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   582   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   570   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   569   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   557   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   553   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   539   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   539   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   538   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   532   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   115   4e-28
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   115   4e-28
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   115   5e-28
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   115   6e-28
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   115   6e-28
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   114   8e-28
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   114   8e-28
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   114   8e-28
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   114   8e-28
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   114   8e-28
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   114   8e-28
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   114   9e-28
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   114   9e-28
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   114   1e-27
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   114   2e-27
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   113   2e-27
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   113   3e-27
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   113   4e-27
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   107   5e-25
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   105   1e-24
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   101   4e-23
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    98   1e-21
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    96   3e-21
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    96   5e-21
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    95   1e-20
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    95   2e-20
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    93   3e-20
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    93   4e-20
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    92   8e-20
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    92   1e-19
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    92   1e-19
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    92   1e-19
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    91   2e-19
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    91   2e-19
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    91   3e-19
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    91   3e-19
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    91   3e-19
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    91   3e-19
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    90   5e-19
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    90   6e-19
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    89   9e-19
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    89   1e-18
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    88   2e-18
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    86   8e-18
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    86   1e-17
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    86   2e-17
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    85   3e-17
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    83   8e-17
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    82   3e-16
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    80   5e-16
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    79   2e-15
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    79   2e-15
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    79   2e-15
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    77   1e-14
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    77   1e-14
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    74   1e-13
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    71   8e-13
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    69   3e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    69   7e-12
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    69   8e-12
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    68   1e-11
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    67   1e-11
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    68   2e-11
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    67   3e-11
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    67   3e-11
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     66   4e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    66   4e-11
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    66   5e-11
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    66   5e-11
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    66   9e-11
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    65   9e-11
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    65   1e-10
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    65   1e-10
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    65   2e-10
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    64   2e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    64   2e-10
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    64   3e-10
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    64   3e-10
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    63   4e-10
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    63   5e-10
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    62   7e-10
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    62   7e-10
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    62   7e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    62   1e-09
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    62   2e-09
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    61   3e-09
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    60   3e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    60   4e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    59   1e-08
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    59   1e-08
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    58   2e-08
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    58   3e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    58   3e-08
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    57   4e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    57   5e-08
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    56   8e-08
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    55   2e-07
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    55   2e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    55   2e-07
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    54   3e-07
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    55   3e-07
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    53   1e-06
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    52   2e-06
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    51   3e-06
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    51   3e-06
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    49   1e-05
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    48   3e-05
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    48   3e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    48   3e-05
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    48   4e-05
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    47   5e-05
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    47   5e-05
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    47   5e-05
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    47   6e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    47   8e-05
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    46   1e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    46   1e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    45   2e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    45   3e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    44   5e-04
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    43   0.001
Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {...    35   0.30 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    34   0.64 
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         33   1.1  
ZYRO0E08558g Chr5 complement(685474..686586) [1113 bp, 370 aa] {...    33   1.2  
KNAG0G02750 Chr7 (611571..612794) [1224 bp, 407 aa] {ON} Anc_8.7...    33   1.3  
Kwal_47.18006 s47 complement(643091..644947) [1857 bp, 618 aa] {...    33   1.3  
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    33   1.8  
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    32   2.3  
Ecym_3568 Chr3 (1077825..1079363) [1539 bp, 512 aa] {ON} similar...    32   2.7  
CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highl...    30   9.7  

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/419 (95%), Positives = 402/419 (95%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           EEYEFDSLLKAPISGFMPFSKHTENTKVI                 YEPFQMVIDSGFNC
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNC 180

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300
           VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300

Query: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360
           EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD
Sbjct: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360

Query: 361 WSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           WSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI
Sbjct: 361 WSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/420 (71%), Positives = 350/420 (83%), Gaps = 7/420 (1%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           MES P+VVDNGSYE+KFG      P RA NALARDKFG+ YLSNQI  IKDISSV F+RP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE+GQLTSWEL+S +WDYCFFNP+EF+GFDLKDSKGQHL+ SETCMT+PELSKNMDQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           EEYEF S+ K+PI+GF PF + +    +                  YEPFQ+VID GFNC
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPS----IAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWVVP+IKG+P+YKAVKKLD+GGRF+NGLLKETLSFRHYNVMDETILVNNIKE CLF+SP
Sbjct: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSP 236

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300
           VSYF+SF  K+QTAVEYVLPDFQT+FLGYV D K P  +D+QTV L+DELFSVPETFFHP
Sbjct: 237 VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHP 296

Query: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360
           EI QLLKPGIIETILESLS++PE LRPLM+ NI+CTGGNFNLP+F  RLATELQRQLPTD
Sbjct: 297 EIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTD 356

Query: 361 WSAKIYLPQ-PKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           W+  ++LP  PK  EL GW SM++F ++ LY  ARV+R+EY+EHGV+W T++RFGYQNW+
Sbjct: 357 WTCTVHLPSGPK--ELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 351/439 (79%), Gaps = 21/439 (4%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME+ P+V+DNGSYE+KFG ST  +PFRALNALA+DKFG +YLSN I  IKDISSV+F+RP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLT WEL+SC+WDYCFFNP EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSK-----------HTENTKVIXXXXXXXXX------XXXXX 163
           EEYEFDSL K+P++ F+PF+K             E+  ++                    
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 164 XXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223
              Y  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRK---NPPSKD 280
           ETILVNNIKEKCLF+SPVSYFDSF  KD+ A+EYVLPDFQT+FLGYV +R+   +P ++D
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340
           AQT+TL DELF++PETFFHPEIAQ+ KPGI+E ILESLS++PE +RPLMV NI+CTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400
           NLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS F+ST  Y+ ARV+R+EY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPE-SDCALFGWEVMSQFSSTASYRNARVTREEY 419

Query: 401 YEHGVEWTTKNRFGYQNWI 419
           YEHG +W TK+RFGYQNWI
Sbjct: 420 YEHGSDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/422 (66%), Positives = 351/422 (83%), Gaps = 5/422 (1%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME  P+V+DNGSY VKFG ++   P+ ALNA+A DK+ A+YLSNQI  IKDISSVS KRP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           H  GQLTSWE+Q+ +WDYC +NP+EF+GF++ D+K +HLI SETCMTLPEL KNMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           EEYEF SL+K+P++G+MPF ++T++ ++I                 Y  FQ+V+DSGFNC
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKD-QIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNC 179

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TW++P+IKG+P+YKAVKKLD+GGRF+NGLLKETLSFRHYNVMDETILVNNIKEKCLF+SP
Sbjct: 180 TWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSP 239

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVA---DRKNPPSKDAQTVTLRDELFSVPETF 297
            SYFDSF  KD T+ EYVLPDFQT+FLGYV    ++  P  +D+Q++TL+DELF+VPETF
Sbjct: 240 ASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETF 299

Query: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357
           FHPEI+Q+LKPG++ETILESLS++PE +RPLMVSNI+C GGNFNLPHF  R+A ELQRQL
Sbjct: 300 FHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQL 359

Query: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417
           PTDW  +I + +  S EL+GW +MS+FASTD+YKA RV+R+EYYEHG++W TK+RFGYQN
Sbjct: 360 PTDWKCRITISKGNS-ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQN 418

Query: 418 WI 419
           W+
Sbjct: 419 WV 420

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/422 (67%), Positives = 342/422 (81%), Gaps = 5/422 (1%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           MES P+ +DNGSYE+KFG +  S P+RA+NA A DK+  TYLSNQI  IKDI+SV+F+RP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLTSWEL+S +WDY  FNP+EF GFDL D KG+HLIASETCMTLPELSKNMDQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXX---XXXXXXXXXXXXYEPFQMVIDSG 177
           EEYEFDS  K+ I+GF+ F+   +NTK+I                    Y  +Q+VIDSG
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADD-KNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179

Query: 178 FNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLF 237
           FNCTW++P+IKGVP+YKAVKKLD+GGRF++GLLKETLSFRHY+VMDETILVNNIKE CLF
Sbjct: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239

Query: 238 MSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETF 297
           +SP SYFDSF  K++TAVEYVLP+FQTTFLG+V D+  P  ++ QT+ L DELFSVPETF
Sbjct: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299

Query: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357
           FHPEIA++LKPG++ETILESLS+VPE LRPL+V N++CTGGNFNLPHF  RL +ELQRQL
Sbjct: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359

Query: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417
           PTDW  +  +P  K CEL GW +M+ FAST+ Y+  RV+R+EYYEHG +W TKNRFGYQN
Sbjct: 360 PTDWICRTSVPT-KECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQN 418

Query: 418 WI 419
           WI
Sbjct: 419 WI 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/428 (66%), Positives = 345/428 (80%), Gaps = 10/428 (2%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME  P+V+DNGSYEVKFGYS    P RALNALA+DK+GA YLSNQ+N IKDISSV+ +RP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQL SWEL+  VWDYCFFNP+EF  F+LK++KG HL+ SETCMTLPELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVI------XXXXXXXXXXXXXXXXXYEPFQMVI 174
           EEYEF+SL K+P++GF+PF    +N K+I                       Y  F +VI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 175 DSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEK 234
           DSGFNCTW++PIIKGVP+YKAVKK+++GGRF+NGL KET+S+RHY+V DETILVNNIKEK
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 235 CLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS--KDAQTVTLRDELFS 292
           CLFMSP SY DSF  KD+ +V+YVLPDFQT+F+GYV D+K+     +++Q +TL DELFS
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 293 VPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATE 352
           VPET FHPE+A+LLKPGI+ETILESLS+VPE +RPL+V+NI+C GGNFN+P+F  RLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 353 LQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQEYYEHGVEWTTKN 411
           LQRQLPTDW   IY+P+ K CEL GW SMS FA +TD+YK AR+SR+EYYEHG +WTTK 
Sbjct: 361 LQRQLPTDWVCNIYIPE-KDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419

Query: 412 RFGYQNWI 419
           RFGYQNWI
Sbjct: 420 RFGYQNWI 427

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 347/439 (79%), Gaps = 21/439 (4%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME+ P+V+DNGSYE+KFG ST  +PFRALNALA+DKFG +YLSN I  IKDISS++F+RP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLT WEL+SC+WDYC FNP+EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSK-----------HTENTKVIX------XXXXXXXXXXXXX 163
           EEYEFDSL K+P++ F+PF+K             E+  ++                    
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 164 XXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223
              Y  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKN---PPSKD 280
           ETILVNNIKE+CLF+SPVSYFDSF  KD+ A+EYVLPDFQT+FLGYV + +    P  +D
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340
           AQ +TL DELF++PETFFHPEI+Q+ KPGI+E ILESLS++PE +RPLMV NI+CTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400
           NLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS FA TD Y+ ARV+R+EY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPE-GDCALFGWEVMSQFAKTDSYRKARVTREEY 419

Query: 401 YEHGVEWTTKNRFGYQNWI 419
           YEHG +W TK+RFGYQNWI
Sbjct: 420 YEHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/440 (63%), Positives = 342/440 (77%), Gaps = 23/440 (5%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME  P+V+DNGSYE+KF  ST   PFRALNALA+DKFG +YLSN I  IKDISS++F+RP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLT WEL+SC+WDYCFFNP+EF GFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKH------------------TENTKVIXXXXXXXXXXXXX 162
           EEYEFDSL K+P++ F+PF+K                   T N+  I             
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSG-ITTFTSRECGSAQN 179

Query: 163 XXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM 222
               Y  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+M
Sbjct: 180 SDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239

Query: 223 DETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRK---NPPSK 279
           DETILVNN+KEKCLF+SPVSYFDSF  KD+ A+EYVLPDFQT+F+GYV + +   +P  +
Sbjct: 240 DETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPE 299

Query: 280 DAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGN 339
           DAQT+ L DELF++PETFFHPEI+Q+ KPGI+E ILESLS++PE +RPLMV NI+CTGGN
Sbjct: 300 DAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGN 359

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQE 399
           FNLP+F +RLA ELQRQLPTDW+  + +P    C L GW  MS FA T+ Y+ ARV+R E
Sbjct: 360 FNLPNFAQRLAAELQRQLPTDWTCHVSVPI-GDCALFGWEVMSQFAKTESYRRARVTRDE 418

Query: 400 YYEHGVEWTTKNRFGYQNWI 419
           YYEHG +W TK RFGYQNWI
Sbjct: 419 YYEHGPDWCTKQRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/439 (63%), Positives = 344/439 (78%), Gaps = 21/439 (4%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME+ P+V+DNGSYE+KFG ST   PFRALNALA+DKFG +YLSN I  IKDISSV+F+RP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLT WEL+SC+WDYC FNP+EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSK-----------HTENTKVIXXXXXXXXXXX------XXX 163
           EEYEFDSL K+P++ F+PF+K             E+  V                     
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 164 XXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223
              Y  FQ+VIDSGF+CTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVA---DRKNPPSKD 280
           ETILVNNIKEKCLF+SP SYFDSF  K++  +EYVLPDFQT+F+GYV    +  +P   D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340
           AQ++TL DELF++PETFFHPEI+Q++KPGI+E ILESLS++PE +RPLM+ NI+CTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400
           NLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS FA T+ Y+ ARV+R+EY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPE-GDCTLFGWEVMSQFAKTESYQRARVTREEY 419

Query: 401 YEHGVEWTTKNRFGYQNWI 419
           YEHG +W TK+RFGYQNWI
Sbjct: 420 YEHGPDWCTKHRFGYQNWI 438

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/422 (63%), Positives = 327/422 (77%), Gaps = 7/422 (1%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64
           P V+DNGSYE+KFG++    PFRA N +A+DK+GA+YLSN +  I+DISS + +RPHE G
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKD-SKGQHLIASETCMTLPELSKNMDQVVFEEY 123
           QL SWEL+ C+WDYC +NP+EFDGF L D ++ Q LI +ETC TLPELSKN DQVVFEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSLLKAPISGFMPFSKHTENTK---VIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           EF ++ K+P SGFMPF+    N     +                  Y  FQ+VIDSGFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWVVPIIKGVPFYKA+KK+D+GGRF+NGLLKETLSFRHYN+MDETIL+NNIKEKCLF+SP
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKD---AQTVTLRDELFSVPETF 297
           VSYFDSF  K Q AVEYVLPDFQT+FLGY+ D  N    D    QT+TL DE F+VPETF
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357
           FHPE+A +LKPG++ETILE++S+VPEPLRP++VSNI+C GGNF LPH   RL +ELQRQL
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417
           PTDW+ ++ +P    CELA W +M+ F+STD+YK  RV+R+EY EHG +W +K+RF YQN
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 418 WI 419
           WI
Sbjct: 423 WI 424

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/440 (60%), Positives = 342/440 (77%), Gaps = 22/440 (5%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           M+S PLV+DNGSYE+KFG S + +P+RALN  A DK+G+ YLSNQ+ +I+++S V+ +RP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLTSWEL+SC+WDYC +NP+EFDGF+L  S  +HLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKV--------------------IXXXXXXXXXXX 160
           EEYEFDSL KAP +G++PF    ++ KV                    +           
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 161 XXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN 220
                 Y+ +++VIDSGFNCTW++P+IKGVP+YKA+KKLD+GGRF+ GLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 221 VMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPP-SK 279
           +MDET+LVNNIKEKCLF+SP SYFDSF  K++T+VEY+LPD  +++LGY  + K+ P  +
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 280 DAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGN 339
            +Q V L DELFSVPETFFHPEI+++LKPGI+ETILESLS++PE LRPL+V+NI+CTGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQE 399
           FNLPHF  RLA ELQRQLPTDW+ +I +P+ K CEL  W SM  FA+TD YK  R+S++E
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISKEE 419

Query: 400 YYEHGVEWTTKNRFGYQNWI 419
           YYEHG +W TK++FGYQNW+
Sbjct: 420 YYEHGPDWLTKHKFGYQNWL 439

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/420 (63%), Positives = 331/420 (78%), Gaps = 2/420 (0%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           M+  P+++DNGSYEVKFG +T S PFRALNALARDK+G  +LSNQ++++KDIS+V F+RP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQLTSWELQSC+WDYC +NP+EF+ +++ ++KG+HL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLLKAPISGFMPFS-KHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFN 179
           EEYEF S  K P++GF+PF+ +  E+  +                  Y  FQ+VIDSGFN
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 180 CTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           CTWVVPI+KG+P+YKA+KKLD+GGRF+NG LKETLSFRHYNVMDETILVNNIKEKCLFMS
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 240 PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFH 299
           PVSYF+SF KK+ T  EYVLPDFQT+F GYV  +K    +D+QT+ L DELFS+PETFFH
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299

Query: 300 PEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPT 359
           PEIA LLKPGI+ETILES+S++PE +RPLMVSN + TGGNFN+ +F  RLATELQRQ PT
Sbjct: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359

Query: 360 DWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           DW   + +P      L GW SM  F+ T  Y+  RV+R+EYYEHGV+W TK RFGYQ W+
Sbjct: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 339/443 (76%), Gaps = 25/443 (5%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           M+  P+V+DNGSYE+KFG S +  PFRA+NA+A+DK+   YLSNQI  IKDISSV+F+RP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           +E GQLTSWEL+S +WDYCF+NP EFDGF L+D+  +HL+ SETC++LPE S+N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXX-----------------------XXXX 157
           EEY + S+ K+P++GF+PF+  T++   I                               
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 158 XXXXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFR 217
                    Y+ FQ++IDSGFNCTW++P+IKG+P+YKA+KK+D+GGRF+ GLLKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 218 HYNVMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADR-KNP 276
           HYNV DETILVNNIKEKCLF++P SY +SF  K++TAVEYVLPDF TTF+GY+ D  K  
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 277 PSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCT 336
              +AQ +TL+DELFSV ET FHPEI+++LKPGIIETI+ESLS++PE +RPLMV+NI+C 
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 337 GGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVS 396
           GGNFNLP+F +RL +ELQRQLPTDW+  +Y+P+  + EL GW +M+ F+ TD Y+ AR++
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDA-ELFGWKAMAQFSDTDSYRKARIT 419

Query: 397 RQEYYEHGVEWTTKNRFGYQNWI 419
           R+EY EHGVEW TK+RFGYQNWI
Sbjct: 420 REEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 327/421 (77%), Gaps = 3/421 (0%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME  P+V+DNGSYE+KFG +++++PF ALN++A+DK+G  +LSNQ+  IKDISSV+F RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           H+ GQL SWEL+S +WDYC FNP+EFDG+ L  +K +HLIASE+CMTLPELSKNMDQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXX--XXXXXYEPFQMVIDSGF 178
           EEYE+DSL KAP+  F+PF+   + T ++                   Y  +++VIDSGF
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFM 238
           NCTWVVP+IKGVP+YKAVKKLD+GGRF+NG L+E LSFRHYNVMDETILVN+IKEKCLFM
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 239 SPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFF 298
           SP SYFDSF  + +TA EYVLPDF T+F GY+        +D+QT+ L+DELF+VPETFF
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300

Query: 299 HPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP 358
           HPEIA LL PGIIE ILES+S++PE LRPL+V N++ TGGNFN+P+F  RLATELQRQ P
Sbjct: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCP 360

Query: 359 TDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNW 418
           TDWS ++ +P      L GW  M  F+ T  Y+ +RVSR+EYYEHGV+W T  RFGYQ W
Sbjct: 361 TDWSCRVSVPT-GDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAW 419

Query: 419 I 419
           +
Sbjct: 420 L 420

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 322/419 (76%), Gaps = 5/419 (1%)

Query: 4   EPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEY 63
           + +V+DNGSY+VKFG ++  +P  ALNALA+DK+G T+LSNQ+  IKDISSV F+RPHE 
Sbjct: 5   QAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHEL 64

Query: 64  GQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEY 123
           GQLTSWEL+SC+WDYC +NP+EF G D +  + +H++ SETCMTLPELSKN DQV+FEEY
Sbjct: 65  GQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEY 123

Query: 124 EFDSLLKAPISGFMPFSKHTENTKVIXXXX---XXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           E DSL KAP + ++PF    EN K I                    Y  F +VIDSGFNC
Sbjct: 124 EVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNC 183

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWV+PI+KGVP+YKAVKKLD+GGRF+NGLLKET+SFRHYNVMDE+ILVNNIKE+CL++ P
Sbjct: 184 TWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDP 243

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300
           VSYF++F  K +  +++VLPDFQT+F GYV D K     +AQ +TL DE FSVPE FFHP
Sbjct: 244 VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHP 303

Query: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360
           EI+Q LKPGIIET+LES+ ++PE LRPLM SNI+C GGNFNLP F +RL +ELQRQLPTD
Sbjct: 304 EISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTD 363

Query: 361 WSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           W  +  +       L GW +M+ FA TD YK ARV++++Y+EHG++WTTK RFGYQNW+
Sbjct: 364 WVCRAKISSGDKS-LTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/420 (60%), Positives = 324/420 (77%), Gaps = 2/420 (0%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           ME  PL++DNGSYE+KFG  +  +P RALN++A+DK+G  +LSNQ+  IKDISSV F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           HE GQL SWEL++ +WDYC FNP++F+G+ +  +KG+HLI SE+CMT+PELSKNMDQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTK-VIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFN 179
           EEYEF+++ KAP+  F+PF+   ++T  ++                 Y  FQ+VIDSGFN
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 180 CTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           C+W+VP+IKGVP+YKAVKKLD+GGRF+NG L+E LSFRHYNVMDETILVN+IKE CLFMS
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 240 PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFH 299
           P +YF+SF  + +TA EYVLPDF T+F GY+         ++QT+ L+DELF+VPETFFH
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300

Query: 300 PEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPT 359
           PEIA LL  GI+ETILES+S++PE +RPLMV NI+ TGGNFN+P+F  RLATELQRQ PT
Sbjct: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360

Query: 360 DWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           DWS ++ LP+  +  L GW  M  F+ T+ Y  +RV+RQEYYEHGV+W T  RFGYQ W+
Sbjct: 361 DWSCRVSLPKGDAG-LYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/415 (60%), Positives = 317/415 (76%), Gaps = 8/415 (1%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64
           PL+++NGSYE+KFG +    P+RA N L RD++G  +LSNQ++QI+DIS    +RP E G
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYE 124
           QL SWEL+  +WDYC FNP+EF G++LKDSK   LIASETCMT+PE+SKNMDQVVFEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVV 184
           F S++K P++ F+PF +  +   V                  Y  FQ+V+DSGFNCTWV+
Sbjct: 123 FGSMMKCPVAQFVPFDRARDYDIV------GGAGEVVEAKSGYNNFQLVVDSGFNCTWVM 176

Query: 185 PIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYF 244
           P+IKGVP+YKA KKLD+GGRF+NGLLKET+SFRHYNVMDETIL+NNIKE+C FM PVSYF
Sbjct: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYF 236

Query: 245 DSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIAQ 304
           DSF +K++T VEY+LPDFQT+ +GYV   K    K +Q + L DELF+VPETFFHPEI+ 
Sbjct: 237 DSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISN 296

Query: 305 LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAK 364
           +LKPG++ETILE +S+VPE LRPL+VSNI+  GGNFN+ +F  RLATELQRQ PTDW  +
Sbjct: 297 ILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVR 356

Query: 365 IYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           ++ P+  +  L GW SM  F+ TD YK +RV+R EY EHG +W TK+RFGY+ WI
Sbjct: 357 VHQPKLDAA-LQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/415 (60%), Positives = 318/415 (76%), Gaps = 7/415 (1%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64
           P+++DNGSYE+KFG S+   P+RALN LARDK+G  +LSNQ+ QI+++S+   +RP E G
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYE 124
           QL SWEL+  +WDYC FN +EF  +DLKDSK   LI SETCM++PE+SK+MDQVVFEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVV 184
           F SL+K P++ ++PF    +                      Y  FQ+V+DSGFNCTWV+
Sbjct: 123 FGSLMKCPVAQYIPFDNMAD-----YKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177

Query: 185 PIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYF 244
           P+IKGVP+YKAVKKLD+GGRF+ GLLKET+SFRHYN+MDETIL NNIKE+C FM PVSYF
Sbjct: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYF 237

Query: 245 DSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIAQ 304
           DSF KK +T ++YVLPDFQT+ +GYV   K    +D+QT+ L DELF++PETFFHPEIA 
Sbjct: 238 DSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIAN 297

Query: 305 LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAK 364
           +LKPG+IET+LES+S++PE +RPLMVSNI   GGNFN+ +F  RLATELQRQ PTDWS +
Sbjct: 298 ILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVR 357

Query: 365 IYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
           ++LP+  + EL GW +M  F++TD YK  RV+R EY EHGV+W TK RFGY+ WI
Sbjct: 358 VHLPKGDT-ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/423 (59%), Positives = 322/423 (76%), Gaps = 6/423 (1%)

Query: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60
           M   PL++DNGSYE+KFGYS    PF ALNALA+DK+   YLSNQIN IKDISSVS KRP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120
           H+ GQL SWEL+  +WDYCF+N ++F GF++ +    HL+ +ET MTLPELS+N DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNC 180
           EEY FDSL KAP + F+PF K+ +N+  I                 Y+ F +VIDSG+NC
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNS-FIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNC 179

Query: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           +W++P+IKGVP+YKAVKK+D+GGRF+NGLLKET+S+RHY+V DE++LVNNIKE C+F+SP
Sbjct: 180 SWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISP 239

Query: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS--KDAQTVTLRDELFSVPETFF 298
           VSY +SF KK  T VEYVLPDFQT+F+GYV D K   +  + +Q++ L DELFSVPE FF
Sbjct: 240 VSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFF 299

Query: 299 HPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP 358
           HPE+A +LKPGIIETILESL ++PE LR LMV+NI+CTGGNFN+P+F  R+ TELQ+Q+ 
Sbjct: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359

Query: 359 TDWSAKIYLPQPKSCELAGWCSMSAFAST--DLYKAARVSRQEYYEHGVEWTTKNRFGYQ 416
           T+W   + +P+  + EL  W +M +F     +LYK  RV++QEY EHG EWTTK RFGYQ
Sbjct: 360 TEWVCDVSIPKA-NAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQ 418

Query: 417 NWI 419
           NW+
Sbjct: 419 NWL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 319/422 (75%), Gaps = 13/422 (3%)

Query: 3   SEP-LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH 61
           SEP LV+DNGSYE+KFG S   QP RALN L +DK+   +LSNQ  +++DIS    +RPH
Sbjct: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPH 61

Query: 62  EYGQLTSWELQSCVWDYCFFNPNEFDGFDL---KDSKGQHLIASETCMTLPELSKNMDQV 118
           E GQL SWEL+S VWDYCF+N ++F  ++L    D+K  HL+ SET MT+PELSKNMDQV
Sbjct: 62  ELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FEEY+F S+ K P++ ++PF +       +                 Y+ FQ+VIDSGF
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSS-------YKDFQLVIDSGF 173

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFM 238
           NCTW VPIIKGVP+YKA+KKLD+GGRF+ GLL+ET+SFRHYNVM+ETILVNNIKE+C F+
Sbjct: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFV 233

Query: 239 SPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVAD-RKNPPSKDAQTVTLRDELFSVPETF 297
            P SYF SF  K  T VEYVLPDFQT+FLGYV    K   + DAQT+ L DE+FSVPETF
Sbjct: 234 PPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETF 293

Query: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357
           FHPEIAQ+LKPGI+ETILE +++ PE +RPL+V+NI+CTGGNFN+P+F ERL TELQRQ 
Sbjct: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353

Query: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417
           P DWS K++ PQ K   L GW SM  FA++D +++ARV+R+EY EHG++W TKNRFGYQ 
Sbjct: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQ 413

Query: 418 WI 419
           W+
Sbjct: 414 WL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 106/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP I  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  115 bits (288), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 180/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +   + I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVS-IQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMEVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  115 bits (288), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 178/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +   + I   +        T +                  
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVS-IQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA +              A  K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAAQSS------------AIEKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  115 bits (288), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 177/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKNNREKMTQILFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR I   L + L+ R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA +              A  K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTASQSS------------AVEKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  115 bits (288), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 103/417 (24%), Positives = 174/417 (41%), Gaps = 68/417 (16%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQINQIK 50
           E   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++    +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKR 63

Query: 51  DISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLP 109
            I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M   
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 114

Query: 110 ELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEP 169
              + M Q++FE +   +     I   +        T +                     
Sbjct: 115 SNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI--------------------- 152

Query: 170 FQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDETIL 227
              V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E  +
Sbjct: 153 ---VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREI 209

Query: 228 VNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLR 287
           V +IKEK  +++       F ++ QTA +              A  K+    D Q +T+ 
Sbjct: 210 VRDIKEKLCYVAL-----DFEQEMQTAAQSS------------AIEKSYELPDGQVITIG 252

Query: 288 DELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
           +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P   E
Sbjct: 253 NERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 312

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
           R+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 313 RMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  114 bits (286), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  114 bits (286), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  114 bits (285), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 180/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAS-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG+   P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  114 bits (284), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 105/427 (24%), Positives = 177/427 (41%), Gaps = 84/427 (19%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVE-------YVLPDFQTTFLGYVADRKNPP 277
             +V +IKEK  +++       F ++ QTA +       Y LPD                
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAAQSSSVEKSYELPD---------------- 244

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTG 337
               Q +T+ +E F  PE  FHP +  L   G+ +T   S+      +R  +  NI+ +G
Sbjct: 245 ---GQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSG 301

Query: 338 GNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSR 397
           G    P   ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+
Sbjct: 302 GTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISK 359

Query: 398 QEYYEHG 404
           QEY E G
Sbjct: 360 QEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  113 bits (283), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 177/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +   + I   +        T +                  
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVS-IQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G      + ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA +              A  K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAAQSS------------AIEKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 178/420 (42%), Gaps = 70/420 (16%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDE 224
                 V+DSG   T VVPI  G      + ++DL GR +   L + LS R Y+     E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 308

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 309 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  113 bits (282), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 174/420 (41%), Gaps = 74/420 (17%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGAT---------YLSNQINQIK 50
           E   LV+DNGS   K G++    P RA+  + + R +             Y+ ++    +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKR 63

Query: 51  DISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLP 109
            I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M   
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 114

Query: 110 ELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEP 169
              + M Q++FE +   +   + I   +        T +                     
Sbjct: 115 SNREKMTQIMFETFNVPAFYVS-IQAVLSLYSSGRTTGI--------------------- 152

Query: 170 FQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN--VMDETIL 227
              V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R Y+     E  +
Sbjct: 153 ---VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREI 209

Query: 228 VNNIKEKCLFMSPVSYFDSFAKKDQT-AVE--YVLPDFQTTFLGYVADRKNPPSKDAQTV 284
           V +IKEK  +++ + Y        Q+ A+E  Y LPD                    Q +
Sbjct: 210 VRDIKEKLCYVA-LDYDQEMQTAAQSSAIEKSYELPD-------------------GQVI 249

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +GG    P 
Sbjct: 250 TIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG 309

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHG 404
             ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S+QEY E G
Sbjct: 310 IAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  107 bits (266), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 157/368 (42%), Gaps = 56/368 (15%)

Query: 40  TYLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH- 98
           +Y+ ++    + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LIASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXX 158
           ++ +E  M      + M Q++FE +   +   + I   +        T +          
Sbjct: 88  VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVS-IQAVLSLYSSGRTTGI---------- 136

Query: 159 XXXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
                         V+DSG   T VVPI  G     A+ ++DL GR +   L + LS R 
Sbjct: 137 --------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERG 182

Query: 219 YN--VMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNP 276
           Y+     E  +V +IKEK  +++       F ++ QTA        Q++ +      K+ 
Sbjct: 183 YSFSTTAEREIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSY 225

Query: 277 PSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCT 336
              D Q +T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +
Sbjct: 226 ELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS 285

Query: 337 GGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVS 396
           GG    P   ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S
Sbjct: 286 GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWIS 343

Query: 397 RQEYYEHG 404
           +QEY E G
Sbjct: 344 KQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 154/368 (41%), Gaps = 56/368 (15%)

Query: 40  TYLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH- 98
           +Y+ ++    + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LIASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXX 158
           ++ +E  M      + M Q++FE +   +   + I   +        T +          
Sbjct: 88  VLLTEAPMNPKSNREKMTQILFETFNVPAFYVS-IQAVLSLYSSGRTTGI---------- 136

Query: 159 XXXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
                         V+DSG   T VVPI  G      + ++DL GR +   L + LS R 
Sbjct: 137 --------------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERG 182

Query: 219 YN--VMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNP 276
           Y+     E  +V +IKEK  +++       F ++ QTA +              A  K+ 
Sbjct: 183 YSFSTTAEREIVRDIKEKLCYVAL-----DFEQEMQTAAQSS------------AIEKSY 225

Query: 277 PSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCT 336
              D Q +T+ +E F  PE  FHP +  L   GI +T   S+      +R  +  NI+ +
Sbjct: 226 ELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMS 285

Query: 337 GGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVS 396
           GG    P   ER+  E+    P+    KI  P  +   +  W   S  AS   ++   +S
Sbjct: 286 GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWIS 343

Query: 397 RQEYYEHG 404
           +QEY E G
Sbjct: 344 KQEYDESG 351

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 106/431 (24%), Positives = 175/431 (40%), Gaps = 74/431 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FFN        L ++ G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQ-----RQLPTDWSA----KIYLPQPKSCELAGWCSMSAFASTDLYKAAR-VSRQE 399
             EL+     R L  D S     K+ +  P   +   +   +  AS    K    +S+QE
Sbjct: 317 EKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQE 376

Query: 400 YYEHGVEWTTK 410
           +YE G     K
Sbjct: 377 WYEGGAAAMAK 387

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 156/385 (40%), Gaps = 68/385 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   +N +  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY F+     D   L  + G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD +   +G                    E
Sbjct: 216 KEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------SE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQRQLPTDWSAKIYLPQPKSCE 374
             EL +QL   W  ++    P   E
Sbjct: 317 EKEL-KQL---WFTRVLRNDPSRLE 337

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 93/414 (22%), Positives = 174/414 (42%), Gaps = 67/414 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +  +  +K       G T++ NQ  +++ +
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL 66

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P E+G + +W     +W Y F          L++ +   ++ +E  +      
Sbjct: 67  --LKLRHPVEHGIVKNWSDMEHIWSYVFNK-----SLQLQNVEDHPILITEAPLNPRNNR 119

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +++FE +   +L    I   +        T                          
Sbjct: 120 ERMCELLFESFNVPALY-VSIQAVLSLYASGRTTGC------------------------ 154

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +++++D+ GR    F+  LL++T      +  +  + V
Sbjct: 155 VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-V 213

Query: 229 NNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
             IKEK  +++     D   ++   ++    P++ T F       K P   D +T+ L  
Sbjct: 214 RIIKEKACYVAK----DPHIEEQNFSIN---PNY-TKF-------KLP---DGKTIDLGQ 255

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E F  PE  F PE+       + +   +S+  V   LR L+ SN+L +GG   LP F +R
Sbjct: 256 EKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDR 315

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           L +EL+    +D   KI +  P   + + W   S  +    +K   V+R E+ E
Sbjct: 316 LLSELKSL--SDSQTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTRAEWEE 367

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 98/415 (23%), Positives = 164/415 (39%), Gaps = 68/415 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFG--------ATYLSNQINQIKDIS 53
           S+P+V+DNGS  +K GYS   +P F   + +   + G         T++ N   + + I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +  + P ++G + +W     +WDY F      D   LKD     ++ +E  +       
Sbjct: 69  -LQLRHPVDHGVVKNWNDMELIWDYMFK-----DKLKLKDVDEHPVLITEAPLNPVSNRD 122

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M  ++FE +   +L             +  N  V+                       V
Sbjct: 123 EMCDLLFESFGVQAL-------------YVANPAVLSLYASGKISG------------CV 157

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL---SFRHYNVMDETILVNN 230
           +D G   +  VP+ +G     A+K++DLGGR +   L+  L   +        E  LV  
Sbjct: 158 LDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRM 217

Query: 231 IKEKCLFMS---PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLR 287
           IKEK  +++    +       + DQ  +++ LPD                    + +TL 
Sbjct: 218 IKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD-------------------GKFITLS 258

Query: 288 DELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            + F VPE  F P +       I E I +S+S +   LRP M S+IL +GG   L  F  
Sbjct: 259 KDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGN 318

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           RL  EL +        KI+ P  +  +   W   S  A    ++   V++ ++ E
Sbjct: 319 RLVQELDKLNQAQSRVKIWAPPER--KYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 94/417 (22%), Positives = 177/417 (42%), Gaps = 71/417 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQPF----------RALNALARDKFGATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P           +    +A    G  ++ NQ  +++ +
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL 68

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P E+G + +W     +W++ F          L + +   ++A+E  +   +  
Sbjct: 69  --LKLRYPLEHGIVKNWSDMELIWNHVFHK-----SLQLNNIEEHPVLATEAPLNPLKNR 121

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +++FE +   ++  + I   +        T                          
Sbjct: 122 EAMCEMLFETFNVPAVYVS-IQAVLSLYASGRTTGC------------------------ 156

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +++++D+ GR    F+  LL++T      +  +  I V
Sbjct: 157 VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-V 215

Query: 229 NNIKEKCLFMS--PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTL 286
             IKEK  +++  P++       ++QT   Y L    T F       K P   D + + L
Sbjct: 216 RIIKEKACYVARDPLT-------EEQT---YHLTPTSTIF-------KLP---DGKVLDL 255

Query: 287 RDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFP 346
           ++E F  PE  F P++       I E   +S+S V   LRP ++SNI+ +GG    P F 
Sbjct: 256 KNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFG 315

Query: 347 ERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
           +RL TEL+         KI+ P  +  + + W   S  +    +K   V++ E+ E+
Sbjct: 316 DRLLTELRNLSEPQTKIKIFAPPER--KYSTWIGGSILSGLSTFKKIWVTKSEWQEN 370

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/414 (22%), Positives = 171/414 (41%), Gaps = 67/414 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +     +K       G T++ NQ  +++ +
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL 94

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P ++G +T+W     VW Y F          L++ +    + +E  +   +  
Sbjct: 95  --LKLRYPLQHGIVTNWADMEQVWGYVFNK-----SLQLQNVEDHPNLVTEAPLNPHKNR 147

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +++FE +   +L  + +   +        T                          
Sbjct: 148 EKMCELLFESFNVPALYVS-VQAVLSLYASGRTTGC------------------------ 182

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +++++D+ GR    F+  LL++T      +  +  I V
Sbjct: 183 VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-V 241

Query: 229 NNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
             IKEK  F++          KD    E   P    +F  +    K P   D +T+ L  
Sbjct: 242 RTIKEKACFVT----------KDPKLEEQNFP-MNPSFSKF----KLP---DGKTIELGQ 283

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E +  PE  F PE+       + +   +S+  V   LR L+ SNIL +GG   LP F +R
Sbjct: 284 ERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDR 343

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           L  EL+    +    KI+ P  +  + + W   S  +    +K   V++ E+ E
Sbjct: 344 LLKELKSLSGSRTKIKIFAPPER--KYSTWIGGSILSGLSTFKKLWVTKSEWEE 395

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/415 (22%), Positives = 172/415 (41%), Gaps = 67/415 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP---------FRALNALARDKF-GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+    +P             + +   +F G T++ NQ  +I+ +
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL 69

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P E+G +T W     +W + F       G  L   +   ++ +E  +   +  
Sbjct: 70  --LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNR 122

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +++FE +   ++    I   +        T                          
Sbjct: 123 EQMCELLFETFSVPAVY-VSIQAVLSLYASGRTTGC------------------------ 157

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM----DETILV 228
           V+DSG  C+  VP+  G     A++++D+ GR I+ LL + L  +   V      E  +V
Sbjct: 158 VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGVSLLSSSEREIV 216

Query: 229 NNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
             IKEK  +++            +    Y +   QT F       + P   D + + L +
Sbjct: 217 RIIKEKACYIA--------LDPKEEEKNYTMHGKQTMF-------RLP---DGKQIELDN 258

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E F  PE  F+P++       + E + ES+  V   LR  + SNI+ +GG   +P F +R
Sbjct: 259 EKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDR 318

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
           +  EL  +L  +   KI +  P   + + W   S  +    +K   V+++E+ E+
Sbjct: 319 VLKEL--KLSCEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN 371

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 151/366 (41%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E + +++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 146/366 (39%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A         +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FFN        L  + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE Y+F  +  A I   +       ++ V                        V
Sbjct: 121 RMCEVMFERYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+   ++ T +  EY LPD                    + + +  E
Sbjct: 216 KEKVCYVSYDLNLDTKLARETTTLVQEYELPD-------------------GRIIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P++  +  PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 ERELKQ 322

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 98/419 (23%), Positives = 174/419 (41%), Gaps = 73/419 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKFGAT--------YLSNQINQIK 50
           ++P+V+DNGS  +K G+S   +P    +        DK   T        Y+ N+   I+
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIR 68

Query: 51  DISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPE 110
            +  +  + P   G + +W+    +W +  FN    D  ++++ +   L+ +E  +T+ +
Sbjct: 69  GL--LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEK 121

Query: 111 LSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPF 170
               M + +FE +   SL  A  S    ++  + NT                        
Sbjct: 122 QRHIMCERLFETFNIPSLYVANPSVLSLYA--SGNTT----------------------- 156

Query: 171 QMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLL----KETLSFRHYNVMDETI 226
             V+D G       PI +G     +++K+++GGR I   L    +++     Y+  +E  
Sbjct: 157 GCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKE 215

Query: 227 LVNNIKEKCLFMSP---VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQT 283
           +V  IKEK  ++S     S    + ++D+ + ++ LPD                    + 
Sbjct: 216 IVRTIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLPD-------------------GKE 256

Query: 284 VTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLP 343
           +TL  E F  PE  F+P++  L    +     ES+S V   LRP + SNIL TGG+    
Sbjct: 257 LTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFK 316

Query: 344 HFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
            F  RL  +LQ    T+  AKI +  P   +   W   S       +K   V++ ++ E
Sbjct: 317 GFGSRLLGDLQEL--TNNRAKIKILAPPERKYTSWIGGSILTGLSTFKNLWVTKSDWEE 373

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 151/366 (41%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L+ +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 102/431 (23%), Positives = 172/431 (39%), Gaps = 74/431 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+   ++ TA+   Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQ-----RQLPTDWSA----KIYLPQPKSCELAGWCSMSAFASTDLYKAAR-VSRQE 399
             EL+     R L  D S     K+ +  P   +   +   +  AS    K    +S+QE
Sbjct: 317 EKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQE 376

Query: 400 YYEHGVEWTTK 410
           + E G    TK
Sbjct: 377 WQESGPSAMTK 387

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 149/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY F+     +   L  + G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      K+LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD +   +G                    E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------SE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   ++ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 147/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P     + + R    A   +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     D   L  +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----DQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD +   +G                    E
Sbjct: 216 KEKVCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------QE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + + G+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 150/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A    +    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W+    +WDY F+N  +F       + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 LMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+   ++ T +   Y LPD                    + + +  E
Sbjct: 216 KEKLSYVSYDLNLDTKLARETTVLVENYELPD-------------------GRVIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P++  + +PGI E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 149/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+   ++ TA+   Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 106/433 (24%), Positives = 173/433 (39%), Gaps = 76/433 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLS--NQINQIKDI--------- 52
           P+V+D G+  VK G +  + P F   + + R    A   S  +    IKDI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 53  -SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPEL 111
            S +    P E G +  W     +WD+ FF     +   L  + G  ++ +E  M   + 
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAFF-----EKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
            + M QV+FE+Y+F  +  A I   +       ++ V                       
Sbjct: 121 REMMCQVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV----------------------- 156

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVN 229
            V+DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 157 -VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 215

Query: 230 NIKEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLR 287
            IKEK  ++S    FD+  A++  T VE Y LPD                    + + + 
Sbjct: 216 QIKEKLSYVSYDLDFDTKLARETTTLVENYELPD-------------------GRIIKVG 256

Query: 288 DELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            E F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P 
Sbjct: 257 QERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGLPS 316

Query: 348 RLATELQ-----RQLPTDWSA----KIYLPQPKSCELAGWCSMSAFASTDLYKAAR-VSR 397
           RL  EL+     R L  D S     K+ +  P   +   +   +  A+    K    +S+
Sbjct: 317 RLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSK 376

Query: 398 QEYYEHGVEWTTK 410
           QE+ E G +   K
Sbjct: 377 QEWEESGAQAMAK 389

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 148/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A    +    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L  + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFF-----EQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F     A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGTYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    + + +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGPE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 147/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQ-IKDI----------S 53
           P+V+D G+  VK G +  + P     ++             IN+ +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FFN        L  + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    + + +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRIIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + + GI E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 101/431 (23%), Positives = 171/431 (39%), Gaps = 74/431 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+   ++ T +   Y LPD                    +T+ +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTVLVESYELPD-------------------GRTIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQ-----RQLPTDWSA----KIYLPQPKSCELAGWCSMSAFASTDLYKAAR-VSRQE 399
             EL+     R L  D S     K+ +  P   +   +   +  AS    K    +S+QE
Sbjct: 317 EKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQE 376

Query: 400 YYEHGVEWTTK 410
           + E G    TK
Sbjct: 377 WQESGPAAMTK 387

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 88.6 bits (218), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 133/318 (41%), Gaps = 55/318 (17%)

Query: 42  LSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIA 101
           + ++ + ++    +S+  P E G + +W     +WDY F+     D   L  + G  ++ 
Sbjct: 2   IGDEASAVRSYLQISY--PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVML 54

Query: 102 SETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXX 161
           +E  M   +  + M +V+FE+Y+F  +  A I   +       ++ V             
Sbjct: 55  TEPPMNPVKNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------- 100

Query: 162 XXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY-- 219
                      V+DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  
Sbjct: 101 -----------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149

Query: 220 NVMDETILVNNIKEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPP 277
           N   +   V  IKEK  ++S     D+  A++  T VE Y LPD +   +G         
Sbjct: 150 NRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG--------- 200

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTG 337
                      E F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +G
Sbjct: 201 ----------SERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250

Query: 338 GNFNLPHFPERLATELQR 355
           G+   P  P RL  EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 153/386 (39%), Gaps = 68/386 (17%)

Query: 4   EPLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI---------- 52
           +P+V+D G+  VK G +  + P +   + + R    A   +N    +KDI          
Sbjct: 5   KPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVR 64

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
           S +    P E G +  W     +WDY F+     +   L  + G  ++ +E  M      
Sbjct: 65  SYLQISYPMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNR 119

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +V+FE+Y+F  +    I   +       ++ V                        
Sbjct: 120 EQMCEVMFEKYDFGGVYVG-IQAVLALYAQGLSSGV------------------------ 154

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNN 230
           V+DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQ 214

Query: 231 IKEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
           IKEK  ++S     D+  A++  T VE Y LPD                    + + +  
Sbjct: 215 IKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD-------------------GRVIKVGS 255

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E F  PE  F P +  + +PGI E +  ++      +   +   I+ +GG+   P  P R
Sbjct: 256 ERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLPSR 315

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCE 374
           L  EL +QL   W  ++    P   E
Sbjct: 316 LEKEL-KQL---WFTRVLKNDPTRLE 337

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 147/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY F+     D   +  + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A +  T VE Y LPD                    + + +  E
Sbjct: 216 KEKLCYVSYDLDLDTKLAHETTTLVETYELPD-------------------GRVIKVGSE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  + + GI E +  ++      +   +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 82/415 (19%), Positives = 167/415 (40%), Gaps = 67/415 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP--FRALNALARDKFGAT---------YLSNQINQIKD 51
           ++P+V+DNG+  +K G+    +P  F+  N +   KF            Y+ N+  + + 
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRG 66

Query: 52  ISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPEL 111
           +  +  + P E+G++  W+    VW +   +       +++  +   ++ +E  +   + 
Sbjct: 67  L--LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKN 119

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
            ++M +++FE +   ++             H EN  V+                      
Sbjct: 120 REHMCEILFESFNIPAI-------------HVENPAVLALYSGGRTTG------------ 154

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNI 231
            VID G      VPI +G     +++++D+GGR I     E L F+    +  ++  +N 
Sbjct: 155 CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNE 210

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSK----DAQTVTLR 287
           KE               +  +    YV  D       Y+ D ++  SK    D +++++ 
Sbjct: 211 KE-------------IVRTIKERACYVADDISKEEHKYILDSESNSSKFKLPDGKSLSIG 257

Query: 288 DELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
           +  F   E  F+P +       + E + ++LS V   LRP++  +++  GG   LP F  
Sbjct: 258 NVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGN 317

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           R+  EL  Q+ T    K+ +      +   W   S  A    ++   V++  + E
Sbjct: 318 RILKEL--QILTKQDTKLRIIASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 148/366 (40%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY F+     +   L  + G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           +DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    + + +  E
Sbjct: 216 KEKLCYVSYDLDLDTRLARETTTLVEKYELPD-------------------GRIIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F  PE  F P +  +   G+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 257 RFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/424 (21%), Positives = 168/424 (39%), Gaps = 82/424 (19%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP---------------FRALNALARDKFGATYLSNQIN 47
           ++P+V+DNGS  +K G+S  ++P                   NA++ +    TY+ N+  
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDL--TYIGNRAQ 65

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
           + + +  +  + P   G + +W+    +W + F +  + + FD      +H L+ +E  +
Sbjct: 66  KSRGL--LRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD------EHPLLITEAPL 117

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
              +    M +V FE+++F ++  A  S    ++                          
Sbjct: 118 NPEKNRDKMCEVFFEKFDFAAVYIANPSTLSLYASGRTTG-------------------- 157

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD--- 223
                 V+D G      VPI +G     +++++D+GGR +   L+     R Y  +    
Sbjct: 158 -----CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYS 210

Query: 224 --ETILVNNIKEKCLFMSPVSYFD---SFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS 278
             E  +V N+KEK  ++S     D   S    ++   ++ LPD                 
Sbjct: 211 SSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD----------------- 253

Query: 279 KDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGG 338
              + + L    F  PE  F P+I  L    + +   ES+S V   LRP + S+I+  GG
Sbjct: 254 --GKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGG 311

Query: 339 NFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQ 398
           +     F +RL  ELQ +       KI  P  +  +   W   S       +K   +++ 
Sbjct: 312 STMFRGFGDRLLKELQIRTGNKNLIKIIAPPER--KYTSWIGGSILTGLSTFKQLWMTKA 369

Query: 399 EYYE 402
           E+ E
Sbjct: 370 EWQE 373

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/415 (22%), Positives = 158/415 (38%), Gaps = 65/415 (15%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQPFRALNALARDK------FGA----TYLSNQINQIKDI 52
           ++P+V+DNGS  VK G+    +P     +L  D        G     +++ N+  +++ +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL 68

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  K P E G ++ W+    +W +  F     D   L       L+ +E  +      
Sbjct: 69  --LKLKHPMERGVVSDWDDMELLWSHILF-----DSLQLTSGMEHPLLITEAPLNPESNK 121

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M +V FE +   ++    I G +        T                          
Sbjct: 122 EKMLEVFFETFNIPAIC-VSIPGVLSLYASGRTTGC------------------------ 156

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNV----MDETILV 228
           V+D G      VP+ +G     ++K+++LGG  +   L+  L  +   V      E  LV
Sbjct: 157 VVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLR-KESGVWLFSSGERELV 215

Query: 229 NNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
             +KEK  ++S          KD+    +      T F       K P   D   +TL  
Sbjct: 216 RTMKEKSCYVSLNQL------KDEEKFTFEPGKMNTNF-------KLP---DGNMLTLSK 259

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
             F  PE  F P+I    +P + E  L+S+  V   LRP ++S I  +GG      F +R
Sbjct: 260 SRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDR 319

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
              EL  Q+ T   + I +  P   +   W   S  A    ++    ++ ++ EH
Sbjct: 320 FLQEL--QISTCKKSNIRILAPPERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 131/318 (41%), Gaps = 55/318 (17%)

Query: 42  LSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIA 101
           +  + ++++    +S+  P E G + +W     +WDY F+     +   L D+    ++ 
Sbjct: 2   IGGEASEVRSYLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPDTSNGKILL 54

Query: 102 SETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXX 161
           +E  M   +  + M +V+FE+Y F  +  A I   +       ++ V             
Sbjct: 55  TEPPMNPIKNREKMCEVMFEKYNFGGVYVA-IQAVLALYAQGLSSGV------------- 100

Query: 162 XXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY-- 219
                      V+DSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  
Sbjct: 101 -----------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAF 149

Query: 220 NVMDETILVNNIKEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPP 277
           N   +   V  IKEK  ++S     D+  A++  T VE Y LPD                
Sbjct: 150 NRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------------- 193

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTG 337
               + + +  E F  PE  F P +  + + G+ E +  ++      +R  +   I+ +G
Sbjct: 194 ---GRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSG 250

Query: 338 GNFNLPHFPERLATELQR 355
           G+   P  P RL  EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 145/366 (39%), Gaps = 64/366 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGATYLSNQINQIKDI----------S 53
           P+V+D G+  VK G +  + P     + + R    A    N    +KD+          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113
            +    P E G + +W     +WDY F+     +   L  + G  ++ +E  +   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMV 173
            M +V+FE+Y+F  +  A I   +       ++ V                        V
Sbjct: 121 KMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------V 155

Query: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231
           IDSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           KEK  ++S     D+  A++  T VE Y LPD                    + + +  E
Sbjct: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPD-------------------GRVIKVGQE 256

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            F   E  F P +  +   G+ E +  ++      +R  +   I+ +GG+   P  P R+
Sbjct: 257 RFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRI 316

Query: 350 ATELQR 355
             EL++
Sbjct: 317 EKELKQ 322

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 142/334 (42%), Gaps = 68/334 (20%)

Query: 1   MESE--PLVVDNGSYEVKFGYSTTSQPFRAL--NALARDKFGA---------TYLSNQIN 47
           M+SE   LV+DNGS   K G++    P RA+  + + R +            +Y+ ++  
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  QIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCM 106
             + I  ++ + P E+G +T+W+    +W + F+N       +L+ +  +H ++ +E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXX 166
                 + M Q++FE +   +     I   +        T +                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY-VSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 YEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDE 224
                 V+DSG   T VVPI  G      + ++DL GR +   L + LS R Y  +   E
Sbjct: 152 ------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAE 205

Query: 225 TILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V +IKEK  +++       F ++ QTA        Q++ +      K+    D Q +
Sbjct: 206 REIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI-----EKSYELPDGQVI 248

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESL 318
           T+ +E F  PE  FHP +  L   GI +T   S+
Sbjct: 249 TIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/416 (21%), Positives = 169/416 (40%), Gaps = 65/416 (15%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKFGATYLS-------NQINQIKD 51
           ++P+V+DNGS  +K G+S   QP    +  +     +K  A  L+       N+  +++ 
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRG 68

Query: 52  ISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPEL 111
           +  + +  P E+G +  W     +W + F+N        L + +   ++ +E  +   + 
Sbjct: 69  LLKLHY--PLEHGVVQDWPGLEQLWTHVFYNS-----LKLANIEEHPMLITEAPLNPMKN 121

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
              M +++FE +   ++    I   +        T                         
Sbjct: 122 RNKMCEMLFETFGSPAVY-VSIQAVLALYAGGRTTGC----------------------- 157

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETIL 227
            VID G  C   VP+  G     A++++D+ GR    F+  LL+++      +  +  I 
Sbjct: 158 -VIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI- 215

Query: 228 VNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLR 287
           V  IKEK  F++          ++Q        + +T F       K P   D + +TL 
Sbjct: 216 VRMIKEKACFVA-----TDVGNEEQNYEGANSAELETRF-------KLP---DGKILTLG 260

Query: 288 DELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            E F  PE  F P +       I E   +S+S V   LR  + S+I+ +GG+     F +
Sbjct: 261 AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGD 320

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
           RL +E+++    +   KI+ P  +  + + W   S  A    ++   V+R E+ E+
Sbjct: 321 RLLSEIRKTSEPNTKIKIFAPPER--KYSTWIGGSILAGLSTFEKLWVTRAEWQEN 374

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/411 (20%), Positives = 165/411 (40%), Gaps = 59/411 (14%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +     DK       G T++ N   +++ +
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL 71

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P ++G +  W+    +W Y     NE     L++     L+ +E  M   +  
Sbjct: 72  --LKLRYPIKHGVVEDWDSMELIWSYVL---NEV--LQLQNIGEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M QV+FE ++  +L             +  N  V+                       
Sbjct: 125 EQMAQVLFETFDVSAL-------------YVSNPAVLSLYASGRTTG------------C 159

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIK 232
           V+D G      VPI  G     ++ ++D+GG  I     E L F+       ++  ++ +
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQFQLRKSAGVSLFSSSER 215

Query: 233 EKCLFMS-PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELF 291
           E    M   V Y     KK++        D  +TF       K P   D + + + ++ +
Sbjct: 216 EIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTF-------KLP---DGRCIEVGNDRY 265

Query: 292 SVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLAT 351
             PE  F P+I  L   G+ +  ++S+  V   LR  ++S+I+ +GG   L  F +R+  
Sbjct: 266 RAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLW 325

Query: 352 ELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           +L+    T  ++KI +  P   +   W   S       ++     + ++ E
Sbjct: 326 DLEAL--TKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 89/413 (21%), Positives = 166/413 (40%), Gaps = 63/413 (15%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +     DK       G T++ N+  +++ +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL 71

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             + +  P E+G +  W+    +W +     NE     L++ +   L+ +E  M   +  
Sbjct: 72  LRLQY--PIEHGVVEDWDSMELIWAHIL---NEV--LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M QV+FE +   +L             +  N  V+                       
Sbjct: 125 EVMAQVLFETFNLPAL-------------YVSNPAVLSLYASGRTTG------------C 159

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM---DETILVN 229
           VID G      VPI  G     ++ ++D+GGR I   L+  L       +    E  +V 
Sbjct: 160 VIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREIVR 219

Query: 230 NIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
            IKEK      V Y  +  KK++        D  + F       K P   D + + + ++
Sbjct: 220 TIKEK------VCYLATDIKKEENTYMQESQDLTSVF-------KLP---DGKCIEIGND 263

Query: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
            +  PE  F P+I      G+ +  ++S+  V   LR  ++S+I+ +GG   L  F +R+
Sbjct: 264 RYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRM 323

Query: 350 ATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
             +L+    T  ++KI +  P   +   W   S       ++     + ++ E
Sbjct: 324 LHDLEA--FTKGTSKIKIIAPPERKYTTWVGGSILTGLSTFQRLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 88/417 (21%), Positives = 164/417 (39%), Gaps = 71/417 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +  +  +K       G T++ N+  +++ +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P  +G +  W+    +W Y     NE     L++ +   L+ +E  M   +  
Sbjct: 72  --LRLRYPMTHGVVEDWDSMELIWSYML---NEV--LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           + M QV+FE +   +L             +  N  V+                       
Sbjct: 125 EVMAQVLFETFNLPAL-------------YISNPAVLSLYASGRTTG------------C 159

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM-------DET 225
           V+D G      VPI  G     ++ ++D+GGR I     E L F+             E 
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSSEL 215

Query: 226 ILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVT 285
            +V  IKEK      V Y     KK++        D  + F       K P   D + + 
Sbjct: 216 EVVRMIKEK------VCYLAKNIKKEEDRYLQGHHDLGSVF-------KLP---DGKCIE 259

Query: 286 LRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHF 345
           + ++ +  PE  F P+I      G+ +  ++S+  V   LR  ++S+I+ +GG   L  F
Sbjct: 260 IGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGF 319

Query: 346 PERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
            ER+  +L+    +  + KI +  P   +   W   S       ++     + ++ E
Sbjct: 320 GERMLHDLEAL--SKGTCKIKIIAPPERKYTTWVGGSILTGLSTFQKLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/418 (20%), Positives = 168/418 (40%), Gaps = 73/418 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S   +P    +  +     DK       G T++ N+  +++ +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
             +  + P ++G +  W+    +W Y     NE     L++ +   L+ +E  M   +  
Sbjct: 72  --LRLRYPMKHGVVEDWDSMELIWSYVL---NEV--LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFDSL-LKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
           + + QV+FE +   ++ +  P    +  S  T                            
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASGRTTGC------------------------- 159

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI----- 226
            V+D G      VPI  G     ++ ++D+GG    G + E L F+       ++     
Sbjct: 160 -VVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSE 214

Query: 227 --LVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTV 284
             +V  IKEK      V Y    AKK++        D  + F       K P   D +++
Sbjct: 215 REIVRTIKEK------VCYLAKDAKKEEDKYLQGTQDLISAF-------KLP---DGKSI 258

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
            + ++ +  PE  F P+I      G+    ++S+  V   LR  ++S+++ +GG   L  
Sbjct: 259 EVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKG 318

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           F +R+  +L+    T  ++KI +  P   +   W   S       ++     + ++ E
Sbjct: 319 FGDRMLHDLEAL--TKGTSKIKIIAPPERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 90/415 (21%), Positives = 169/415 (40%), Gaps = 63/415 (15%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKFGATYLSNQINQI-----KDIS 53
           ++P+V+DNGS  +K G+S   +P    +  +     DK  A  LS++   +     K   
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRG 68

Query: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLPELS 112
            +  + P E+G +  W     +W + F++  + +        G H ++ +E  +   E  
Sbjct: 69  LLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNI------GDHPMLVTEAPLNPLENR 122

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
             M ++++E +   ++    I   +        T                          
Sbjct: 123 DKMCEMLYETFNVPAVY-VSIQAVLALYAGGRTTGC------------------------ 157

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETILV 228
           VID G  C   VP+  G     A++++D+ GR    F+  LL++++     +  +  I V
Sbjct: 158 VIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-V 216

Query: 229 NNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRD 288
             IKEK  +++P       A ++Q        +  T F       K P   D + ++L  
Sbjct: 217 RMIKEKACYVAP-----EVAAEEQKYASSRGSEELTKF-------KLP---DGKILSLGA 261

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E F  PE  F P++       I +   +S+S V   LR  + S+++ +GG+     F +R
Sbjct: 262 EKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDR 321

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
           L  EL+ +   +   KI+ P  +   +  W   S  A    ++   V+R E+ E+
Sbjct: 322 LLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFEKIWVTRSEWQEN 374

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 85/430 (19%), Positives = 171/430 (39%), Gaps = 77/430 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF------GATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+    +P    +  +     DK          ++ N   + + +
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL 70

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLPEL 111
             +  + P ++G + +WE    VWD+ F +  +          G+H L+ +E  +     
Sbjct: 71  --LKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNL------GEHPLVVTEAPLNPKPN 122

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
            + M + +FE +   +L             +  N  V+                      
Sbjct: 123 REKMCETLFESFNIPAL-------------YIANPAVLSLYASGRTTG------------ 157

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM-----DETI 226
            V+++G      VPI +G     +++++D+GGR I   L+  L  R    M      E  
Sbjct: 158 CVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSSSEQE 215

Query: 227 LVNNIKEKCLFMSPVSYFDS---FAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQT 283
           +V  IKE   ++      +       +++ ++ + LPD +   +G        P +    
Sbjct: 216 IVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIG--------PGR---- 263

Query: 284 VTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLP 343
                  F  PE  F+P +       + + I++S+S V   LR  +++NI  +GG+    
Sbjct: 264 -------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQ 316

Query: 344 HFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEH 403
            F +RL TEL      D + K+ +  P   + + +   S  A+   ++   V++ ++   
Sbjct: 317 GFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILANLSTFRNMWVTKDQW--E 372

Query: 404 GVEWTTKNRF 413
           G     +N+F
Sbjct: 373 GDNRIIENKF 382

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/420 (19%), Positives = 162/420 (38%), Gaps = 76/420 (18%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQPF----------RALNALARDKFGATYLSNQINQIKDI 52
           ++P+++DNGS  +K G++ + QP            A  ++       TY+ N   + +  
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR-- 67

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLPEL 111
           +++  + P+    + SW+    +WDY   N  E +         +H ++ + +  T  + 
Sbjct: 68  ATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQ------EHPVVLTNSMSTSKKE 121

Query: 112 SKNMDQVVFEEYEFDSLL--KAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEP 169
            + M +V+FE++   ++   + PI       + T  +                       
Sbjct: 122 EEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCS----------------------- 158

Query: 170 FQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH---YNVMDETI 226
               +  G     +  +I G+    + +  + GG  +   + + L   H    N  +   
Sbjct: 159 ----VSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIE 214

Query: 227 LVNNIKEKCLFMSPVSYFDSFAKKDQTAV----EYVLPDFQTTFLGYVADRKNPPSKDAQ 282
           L+ +IKE+C  +S   Y +  A +  T+     +Y LPD                     
Sbjct: 215 LIRSIKERCCVLSKDFYNEIRAYELITSKTSNNKYRLPD-------------------GN 255

Query: 283 TVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNL 342
            + +  E F  PE  F+P+     +  + + I+ S+S      R  ++ +I+ +GG+  +
Sbjct: 256 IIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLI 315

Query: 343 PHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
             F ERL  E+++++  D + KI L  P       W   S  +     K    S+  Y E
Sbjct: 316 KGFGERLTKEIRKEI--DGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSKSAYRE 373

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 95/419 (22%), Positives = 167/419 (39%), Gaps = 71/419 (16%)

Query: 17  FGYSTTSQPFRAL-------NALARDKFGAT----YLSNQINQIKDISSVSFKRPHEYGQ 65
           FG ST++  F  L       N LA  K G      Y+ N+       +S S   P  +GQ
Sbjct: 66  FGNSTSATSFNNLSSQMLMSNNLA-GKRGTEDLDFYIGNEALIASQGASYSLSYPIRHGQ 124

Query: 66  LTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYEF 125
           + +W+     W+   F       +   + +    + +E  +  PE  + + ++ FE +  
Sbjct: 125 VENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIFFESFNC 178

Query: 126 DSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVVP 185
             L  A  +     +  T ++KV+                       VIDSG   T V+P
Sbjct: 179 AGLYIAVQAVLALAASWT-SSKVVDRSLTG----------------TVIDSGDGVTHVIP 221

Query: 186 IIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VS 242
           + +G     A+K + + GR I   ++  L  R     D ++     IK++  ++ P  V 
Sbjct: 222 VAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERIKQEYCYVCPDIVK 279

Query: 243 YFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEI 302
            F+ F +  +   +YV+              +N      + V +  E F  PE FF+PEI
Sbjct: 280 EFNKFDRDPEKFAQYVV--------------ENQEKTQKKVVDVGYERFLAPEIFFNPEI 325

Query: 303 AQ--LLKPGIIETIL-ESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPT 359
           A    L P  + TI+ +++   P  +R  + +NI+ +GG+     F  RL  +L+  +  
Sbjct: 326 ASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNN 383

Query: 360 DWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYYEHGVE 406
             +    L   KS  +            A W   S  A T  +K+   ++++Y E+G E
Sbjct: 384 RIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYEEYGPE 442

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 92/417 (22%), Positives = 164/417 (39%), Gaps = 67/417 (16%)

Query: 17  FGYSTTSQPFRALNALA------RDKFGAT----YLSNQINQIKDISSVSFKRPHEYGQL 66
           FG ST++  F +L A A        K G      Y+ N+        S S   P  +GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  TSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYEFD 126
            +W+     W+   F       +   + +    + +E  +  PE  + + ++ FE +   
Sbjct: 129 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 127 SLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVVPI 186
            L  A  +     +  T ++KV                        VIDSG   T V+P+
Sbjct: 183 GLYIAVQAVLALAASWT-SSKVTDRSLTG----------------TVIDSGDGVTHVIPV 225

Query: 187 IKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VSY 243
            +G     A+K + + GR I   ++  L  R    +D ++     IK++  ++ P  V  
Sbjct: 226 AEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRTAERIKQEYCYVCPDIVKE 283

Query: 244 FDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIA 303
           F+ F +      ++++              +N  S   + V +  E F  PE FF+PEIA
Sbjct: 284 FNKFDRDAGKFAQFIV--------------ENSESTKKKIVDVGYERFLAPEIFFNPEIA 329

Query: 304 Q--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDW 361
               L P +   + +++   P  +R  + +NI+ +GG+     F  RL  +L+  +    
Sbjct: 330 SSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRI 388

Query: 362 SAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYYEHGVE 406
           +    L   KS  +            A W   S  A T  +K+   ++Q+Y E+G E
Sbjct: 389 AQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCHTKQDYEEYGPE 445

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 91/418 (21%), Positives = 166/418 (39%), Gaps = 69/418 (16%)

Query: 17  FGYSTTSQPFRALNA---LARDKFGAT-------YLSNQINQIKDISSVSFKRPHEYGQL 66
           FG ST++  F +LNA   L+ +  G         Y+ N+        S S   P  +GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYEFD 126
            +W+     W+   F       +   + +    + +E  +  PE  + + ++ FE +   
Sbjct: 122 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 175

Query: 127 SLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVVPI 186
            L  A  +     +  T ++KV                        VIDSG   T V+P+
Sbjct: 176 GLYIAVQAVLALAASWT-SSKVTDRSLTG----------------TVIDSGDGVTHVIPV 218

Query: 187 IKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VSY 243
            +G     A+K + + GR I   ++  L  R     D ++     IK++  ++ P  V  
Sbjct: 219 AEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRTAERIKQEYCYVCPDIVKE 276

Query: 244 FDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIA 303
           F+ F +      ++++              +N      + V +  E F  PE FF+PEIA
Sbjct: 277 FNKFDRNPDKFAQFIV--------------ENQEKTQKKIVDVGYERFLAPEIFFNPEIA 322

Query: 304 Q--LLKPGIIETILE-SLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360
               L P  + TI++ ++   P  +R  + +NI+ +GG+     F  RL  +++  +   
Sbjct: 323 SSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDIKSIVNNR 380

Query: 361 WSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYYEHGVE 406
            +    L   KS  +            A W   S  A T  +K+   ++++Y E+G E
Sbjct: 381 IAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYEEYGPE 438

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/418 (19%), Positives = 174/418 (41%), Gaps = 69/418 (16%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQPF----------RALNALARDKFGATYLSNQINQIKDI 52
           ++P+V+DNGS  +K G+S    P           R    +       T++ N+  +++  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR-- 68

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH-LIASETCMTLPEL 111
             ++ +RP   G++T+W+    +W + F++  +    +     G H L+ +E  +   + 
Sbjct: 69  GLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGN--SQIGDHPLLITEAPLNSTKN 126

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
            + M ++++E + FD+L  A  +    ++                           +   
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATG-------------------------QTTG 161

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLL----KETLSFRHYNVMDETIL 227
            V++ G   +   P+ +G     +++++D+GGR I   L    +++     ++  ++ I 
Sbjct: 162 CVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI- 220

Query: 228 VNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS---KDAQTV 284
           V  IKEK  ++               A++Y   + +     ++ +R+N  +    D Q +
Sbjct: 221 VRTIKEKANYV---------------ALDYKFEEEKF----FIHERENTSTVKLPDGQEL 261

Query: 285 TLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPH 344
           T     +   E  F P++       + E +LES++ V   LR  ++ NI+ +GG   L  
Sbjct: 262 TFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKG 321

Query: 345 FPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
           F +R  +E ++ LP     KI     +S     W   S  +    ++   ++R+ Y E
Sbjct: 322 FDQRTMSETKKMLPKHTKVKIRSLAERS--YIAWIGGSILSGLYGFRNLWLTREMYEE 377

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 77/161 (47%), Gaps = 18/161 (11%)

Query: 274 KNPPSKDAQTVT------LRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVP----- 322
           + P S D++++       L  E   VPE  F P I  L + GI+E + E+L L       
Sbjct: 588 RGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNR 646

Query: 323 ---EPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWC 379
                +  +M  NI  TGGN  LP   ER+  E    LP   +  + L +  S  ++ W 
Sbjct: 647 RELSEISKMMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAEDPS--MSAWR 704

Query: 380 SMSAFA-STDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419
            M+ FA +T LY+ + ++++EY E G E+  ++  G   ++
Sbjct: 705 GMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 100/238 (42%), Gaps = 48/238 (20%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALAR--DKFGA---TYLSNQINQIKDISSVSFK 58
           P+ +D GSYEV+ GY     P     N LAR  D+  +   T++ N  N  + I + S K
Sbjct: 38  PIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQS-K 96

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKG--QHLIASETCMTLPELSKNMD 116
            P +   +T+W+    +  Y F +       D++ + G    ++ +E    L     N  
Sbjct: 97  SPFDGSMITNWDYVDDILAYTFHH------LDVRGNGGVPNPVLITERMAALQSQRSNWY 150

Query: 117 QVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDS 176
           +++FE Y    +     S F  + +H   T  I                        I+S
Sbjct: 151 ELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGI-----------------------AINS 187

Query: 177 GFNCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLLKETLSFRHYNVMDETILVNN 230
           G   T V+P++ G       K+++ GG+    ++NGLL  +L + ++     T LVNN
Sbjct: 188 GNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLL--SLKYPYF----PTKLVNN 239

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/384 (21%), Positives = 154/384 (40%), Gaps = 59/384 (15%)

Query: 41  YLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLI 100
           Y+ N+       ++ S   P  +GQ+ +W+     W+   F       +   + +    +
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 161

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXX 160
            +E  +  PE  + + ++ FE +    L  A  +     +  T ++KV+           
Sbjct: 162 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWT-SSKVVDRSLTG----- 215

Query: 161 XXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN 220
                       VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R   
Sbjct: 216 -----------TVIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERG 262

Query: 221 VMDETI-LVNNIKEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPP 277
            +D ++     IK++  ++ P  V  F+ F +  +   +YV+              +N  
Sbjct: 263 EVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVV--------------ENQD 308

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQ--LLKPGIIETIL-ESLSLVPEPLRPLMVSNIL 334
               + V +  E F  PE FF+PEIA    L P  + T+L +++   P  +R  + +NI+
Sbjct: 309 KTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGLYNNIV 366

Query: 335 CTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMS 382
            +GG+     F  RL  +L+  +    +    L   +S  +            A W   S
Sbjct: 367 LSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGS 426

Query: 383 AFASTDLYKAARVSRQEYYEHGVE 406
             A T  +K    ++++Y E+G E
Sbjct: 427 LLAQTPEFKGYCHTKKDYEEYGPE 450

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 170/426 (39%), Gaps = 70/426 (16%)

Query: 10  NGSYEVKFGYSTTSQPFRALN---ALARDKFGAT--------YLSNQINQIKDISSVSFK 58
           +GS    FG ST++  F +L+   AL  +             Y+ N+        S    
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSYGLS 125

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P  +GQ+ +W+     W+   F       +   + +    + +E  +  PE  + + ++
Sbjct: 126 YPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHCFLLTEPPLNPPENREQVAEI 179

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
            FE +    L  A  +     +  T ++KVI                       VIDSG 
Sbjct: 180 FFESFNCAGLYIAVQAVLALAASWT-SSKVIDRSLTG----------------TVIDSGD 222

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLF 237
             T V+P+ +G     A+K + + GR I   +++ L  R     D ++     IK++  +
Sbjct: 223 GVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERIKQEYCY 280

Query: 238 MSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPE 295
           + P  V  F+ F +  +   ++V+   + T       R+       + V +  E F  PE
Sbjct: 281 VCPDIVKEFNKFDRDSEKFAQFVVESQEKT-------RR-------KVVDVGCERFMAPE 326

Query: 296 TFFHPEIAQ--LLKPGIIETILE-SLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATE 352
            FF+PEIA    L P  + TI++ ++   P  +R  + +NI+ +GG+     F  RL  +
Sbjct: 327 IFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 384

Query: 353 LQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEY 400
           L+  +        YL   KS  +            A W   S  A T  +K+   ++++Y
Sbjct: 385 LKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDY 444

Query: 401 YEHGVE 406
            E G E
Sbjct: 445 EEIGPE 450

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 94/425 (22%), Positives = 170/425 (40%), Gaps = 69/425 (16%)

Query: 10  NGSYEVKFGYSTTSQPFRALNA---LARDKFGAT-------YLSNQINQIKDISSVSFKR 59
           N S    FG ST++  F  LN    L+ +  G         Y+ N+        S S   
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVV 119
           P  +GQ+ +W+     W+   F       +   + +    + +E  +  PE  + + ++ 
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIF 181

Query: 120 FEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFN 179
           FE +    L  A  +     +  T ++KV                        VIDSG  
Sbjct: 182 FESFNCAGLYIAVQAVLALAASWT-SSKVTDRSLTG----------------TVIDSGDG 224

Query: 180 CTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFM 238
            T V+P+ +G     A+K + + GR I   ++  L  R    +D ++     IK++  ++
Sbjct: 225 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERIKQEYCYV 282

Query: 239 SP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPET 296
            P  V  F+ F +      ++++ + + T       RK       + V +  E F  PE 
Sbjct: 283 CPDIVKEFNKFDRDGSKFAQFIVENQEQT-------RK-------KVVDVGYERFLAPEI 328

Query: 297 FFHPEIAQ--LLKPGIIETILE-SLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATEL 353
           FF+PEIA    L P  + T+++ ++   P  +R  + +NI+ +GG+     F  RL  +L
Sbjct: 329 FFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 386

Query: 354 QRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYY 401
           +  +    +    L   KS  +            A W   S  A T  +K+   ++++Y 
Sbjct: 387 KSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYE 446

Query: 402 EHGVE 406
           E+G E
Sbjct: 447 EYGPE 451

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 90/425 (21%), Positives = 166/425 (39%), Gaps = 68/425 (16%)

Query: 10  NGSYEVKFGYSTTSQPFRALNA----LARDKFGAT-------YLSNQINQIKDISSVSFK 58
           NGS    FG ST++  F  L      L+ +  G         Y+ N+        S S  
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYSLS 122

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P  +GQ+ +W+     W+   F       +   + +  + + +E  +  PE  + + ++
Sbjct: 123 YPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAEI 176

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
            FE +    L  A  +     +  T ++KVI                       VIDSG 
Sbjct: 177 FFESFNCAGLYIAVQAVLALAASWT-SSKVIDRSLTG----------------TVIDSGD 219

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLF 237
             T V+P+ +G     A+K + + GR I   ++  L  R     D ++     IK++  +
Sbjct: 220 GVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAERIKQEYCY 277

Query: 238 MSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPE 295
           + P  V  F+ F ++ +   ++++   + T                + V +  E F  PE
Sbjct: 278 VCPDIVKEFNKFDRQPEKFAQFIVESQEKT--------------KQKVVDVGYERFLAPE 323

Query: 296 TFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATEL 353
            FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  RL  ++
Sbjct: 324 IFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDM 382

Query: 354 QRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYY 401
           +  +    S    +   KS  +            A W   S  A T  ++    ++++Y 
Sbjct: 383 KSIVNARISQNEKMTGVKSSGVDVQVISHRKQRNAVWFGGSLLAQTAEFRGYCHTKRDYE 442

Query: 402 EHGVE 406
           E G E
Sbjct: 443 EIGPE 447

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/419 (19%), Positives = 161/419 (38%), Gaps = 74/419 (17%)

Query: 3   SEPLVVDNGSYEVKFGYSTTSQP----FRALNALARDKF-------GATYLSNQINQIKD 51
           ++P+V+DNG+  +K G++  ++P    +  +     DK          +++ N+  + + 
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRG 71

Query: 52  ISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPEL 111
           I  +  + P   G + +W+    +W Y F      D   L++     ++ +E  +     
Sbjct: 72  I--LKLRHPMLRGVVQNWDDMETIWQYVFD-----DTLYLENLNEHPILITEPPLNNMAN 124

Query: 112 SKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
            + M + +FE + F ++  + +S  +      + T                         
Sbjct: 125 RQKMCEALFEIFGFPAVYIS-VSPVLSLYASGQTTGC----------------------- 160

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFIN-----GLLKETLSFRHYNVMDETI 226
             +D G      +P+  G     +VKK+D+GG  I       +LK T  F + +   E  
Sbjct: 161 -AVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SERE 217

Query: 227 LVNNIKEKCLFMSPVSYFDS---FAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQT 283
           +V  IKEK  +++     ++      +++ A ++ LPD                    + 
Sbjct: 218 IVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD-------------------GKM 258

Query: 284 VTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLP 343
           + +    ++  E  F PE+       + E   +S+  V   LR  + SNI+ +GG    P
Sbjct: 259 LNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCP 318

Query: 344 HFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYE 402
            F  RL  ELQ    T +  KI +  P   +   W   S  +    +    V++  + E
Sbjct: 319 GFGSRLLKELQTL--TGYDTKIRIIAPPERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 90/417 (21%), Positives = 163/417 (39%), Gaps = 67/417 (16%)

Query: 17  FGYSTTSQPFRALNALA------RDKFGAT----YLSNQINQIKDISSVSFKRPHEYGQL 66
           FG ST++  F +L + A        K G      Y+ N+        S S   P  +GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYEFD 126
            +W+     W+   F       +   + +    + +E  +  PE  + + ++ FE +   
Sbjct: 124 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 177

Query: 127 SLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCTWVVPI 186
            L  A  +     +  T ++KV+                       VIDSG   T V+P+
Sbjct: 178 GLYIAVQAVLALAASWT-SSKVVDRSLTG----------------TVIDSGDGVTHVIPV 220

Query: 187 IKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VSY 243
            +G     A+K + + GR I   ++  L  R     D T+     IK++  ++    V  
Sbjct: 221 AEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERIKQEYCYVCSDIVKE 278

Query: 244 FDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIA 303
           F+ F +  Q   ++++              +N      + + +  E F  PE FF+PEIA
Sbjct: 279 FNKFDRDPQKFAQFIV--------------ENSEKTKRKVIDVGYERFLAPEIFFNPEIA 324

Query: 304 Q--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDW 361
               L P +   + +++   P  +R  + +NI+ +GG+     F  RL  +L+  +    
Sbjct: 325 SSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRI 383

Query: 362 SAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYYEHGVE 406
           +   +L   KS  +            A W   S  A T  +K+   ++Q+Y E G E
Sbjct: 384 ALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCHTKQDYEEIGPE 440

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 12/135 (8%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSL--------VPEPLRPLMVSNILCTGGNF 340
           E   VPE  F P +  L + GIIE I E+  L            +   + SN+  TGGN 
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFLTGGNM 667

Query: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTD-LYKAARVSRQE 399
            LP   ER+  E +  LP     ++ +     C L  W  M+  + TD L++   V+RQE
Sbjct: 668 RLPGMRERVVREFRGLLPI--GTELNVRMANDCALDAWRGMAKLSRTDSLFRDTYVTRQE 725

Query: 400 YYEHGVEWTTKNRFG 414
           Y+E+G ++  ++  G
Sbjct: 726 YHEYGPDYIKEHNLG 740

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 85/226 (37%), Gaps = 48/226 (21%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRAL-NALA--RDK---FGATYLSNQINQIKDISSVSFKR 59
           + +D GS EV+ GY    +P     N +A  RD+      T++ N  N    + S S + 
Sbjct: 39  IAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS-RS 97

Query: 60  PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVV 119
           P++   +T+W+    + +Y F +     G    D     +I +E    L     N  Q++
Sbjct: 98  PYDGALVTNWDYTEDIMEYTFHHL----GVKGTDGIPNPIIMTEKLGALHSQRDNWYQLL 153

Query: 120 FE-------EYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           FE        +  DSL          FS +  N                          +
Sbjct: 154 FECFGAPQVTFGLDSL----------FSFYANNDASASG--------------------L 183

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           VI SG   T ++P++ G       K+++ GGR     L   L+ ++
Sbjct: 184 VISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLLALKY 229

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 107/249 (42%), Gaps = 34/249 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +  +   ++++              +N      + V +  E
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIV--------------ENKERTTKKVVDVGYE 315

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + E++   P  +R  + +NI+ +GG+     F  
Sbjct: 316 RFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 374

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +L+  +    S    L   +S  +            A W   S  A T  +K+   
Sbjct: 375 RLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFKSYCH 434

Query: 396 SRQEYYEHG 404
           ++Q+Y E+G
Sbjct: 435 TKQDYEEYG 443

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 108/251 (43%), Gaps = 34/251 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F ++ +   ++++              +N      + + +  E
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFII--------------ENQDKTTKKVIDIGYE 317

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  
Sbjct: 318 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSR 376

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +++  +    +    L   KS  +            A W   S  A T  +K    
Sbjct: 377 RLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH 436

Query: 396 SRQEYYEHGVE 406
           ++++Y EHG E
Sbjct: 437 TKKDYEEHGPE 447

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 108/251 (43%), Gaps = 34/251 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +  +   ++V+              +N  S   + V +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVV--------------ENQESTRKKIVDVGYE 313

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  
Sbjct: 314 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 372

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +L+  +    +    L   KS  +            A W   S  A T  +K    
Sbjct: 373 RLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH 432

Query: 396 SRQEYYEHGVE 406
           ++++Y E+G E
Sbjct: 433 TKKDYDEYGPE 443

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (47%), Gaps = 14/136 (10%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE---TILESLSLVPEPLRPL------MVSNILCTGGN 339
           E   VPE  F P I  L + G++E   T+L  L       R L      M  N+  TGGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSRQ 398
             LP   ER+  E    LP     K+ L +  S  L+ W  M+ FAS    YK++ ++++
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTLAKDPS--LSAWKGMAKFASDPTSYKSSILTKR 729

Query: 399 EYYEHGVEWTTKNRFG 414
           EY E+G E+  ++  G
Sbjct: 730 EYEEYGPEYIKEHNLG 745

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 85/216 (39%), Gaps = 38/216 (17%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP---FRALNALARDKFGA---TYLSNQINQIKDISSVSFK 58
           P+ +D GSYEV+ GY    +P   F    A  RD+  +   T++         I + S +
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQS-R 100

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P +   +T+W+    +  Y F +     G  + ++    ++ +E   TL     N  ++
Sbjct: 101 SPFDGPMVTNWDYVDDMLAYTFHHLGVRGGGGVPNA----VVLTERLATLQSQRANWYEL 156

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           ++E Y    +     S F  + +    +                         +V+ SG 
Sbjct: 157 LYEAYNLQEVTFGIDSLFSFYGERGPGST-----------------------GLVVSSGN 193

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGR----FINGLL 210
             T VVP++ G       K+++ GG+    ++ GLL
Sbjct: 194 EDTCVVPVVDGRGVVSEAKRINWGGQQAVDYLTGLL 229

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 108/247 (43%), Gaps = 30/247 (12%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 232 KEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELF 291
           K++  ++ P      F K D+ A         T F  ++ + K    K  + V +  E F
Sbjct: 269 KQEYCYVCP-DIVKEFNKFDRDA---------TKFAQFIVENKEKTQK--KVVDVGYERF 316

Query: 292 SVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349
             PE FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  RL
Sbjct: 317 LAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRL 375

Query: 350 ATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSR 397
             +L+  +    +    L   KS  +            A W   S  A T  +K+   ++
Sbjct: 376 QRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYCHTK 435

Query: 398 QEYYEHG 404
           ++Y E+G
Sbjct: 436 KDYEEYG 442

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 10/130 (7%)

Query: 293 VPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLR---PLMVSNILCTGGNFNLPHF 345
           VPE  F P +    + GIIE     +L+     P  L      M  N+  TGG+  LP  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 346 PERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSRQEYYEHG 404
             R+  E    LP D  AK  +   K   L  W  M+ F+S D  +K++ +S++EY E+G
Sbjct: 682 KTRIVKEFTSFLPND--AKFSVNISKHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYG 739

Query: 405 VEWTTKNRFG 414
            E+  ++R G
Sbjct: 740 PEYIKEHRLG 749

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 110/251 (43%), Gaps = 34/251 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   +++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +      ++V+   + T       RK       + V +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT-------RK-------KIVDVGYE 313

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + E++   P  +R  + +NI+ +GG+     F  
Sbjct: 314 RFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 372

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +++  +    +    L   KS  +            A W   S  A T  +K+   
Sbjct: 373 RLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH 432

Query: 396 SRQEYYEHGVE 406
           ++++Y E+G E
Sbjct: 433 TKKDYDEYGPE 443

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 91/422 (21%), Positives = 165/422 (39%), Gaps = 66/422 (15%)

Query: 11  GSYEVKFGYSTTSQPFRALNA--LARDKFGAT-------YLSNQINQIKDISSVSFKRPH 61
           GS    FG ST++  F  +    L+ +  G         Y+ N+        S S   P 
Sbjct: 57  GSDTSYFGNSTSATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPI 116

Query: 62  EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFE 121
            +GQ+ +W+     W+   F       +   + +    + +E  +  PE  + + ++ FE
Sbjct: 117 RHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFE 170

Query: 122 EYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFNCT 181
            +    L  A  +     +  T ++KV                        VIDSG   T
Sbjct: 171 SFNCAGLYIAVQAVLALAASWT-SSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 182 WVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP 240
            V+P+ +G     A+K + + GR I   ++  L  R     D ++     IK++  ++ P
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEYCYVCP 271

Query: 241 --VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFF 298
             V  F+ F +      ++V+ + + T       R+       + V +  E F  PE FF
Sbjct: 272 DIVKEFNKFDRDPSKFAQFVVENQEKT-------RR-------KAVDIGYERFLAPEIFF 317

Query: 299 HPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQ 356
           +PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  RL  +L+  
Sbjct: 318 NPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSI 376

Query: 357 LPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARVSRQEYYEHG 404
           +    +    L   KS  +            A W   S  A T  +K    ++++Y E+G
Sbjct: 377 VNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYG 436

Query: 405 VE 406
            E
Sbjct: 437 PE 438

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 83/383 (21%), Positives = 151/383 (39%), Gaps = 57/383 (14%)

Query: 41  YLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLI 100
           Y+ N+        S S   P  +GQ+ +W+     W+   F       +   + +    +
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXX 160
            +E  +  PE  + + ++ FE +    L  A  +     +  T ++KV            
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWT-SSKVTDRSLTG----- 203

Query: 161 XXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN 220
                       VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R   
Sbjct: 204 -----------TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERG 250

Query: 221 VMDETI-LVNNIKEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPP 277
             D ++     IK++  ++ P  V  F+ F K      ++V+ + + T       R+   
Sbjct: 251 EADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKT-------RR--- 300

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILC 335
               + V +  E F  PE FF+PEIA    L P +   + +++   P  +R  + +NI+ 
Sbjct: 301 ----KVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 355

Query: 336 TGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSA 383
           +GG+     F  RL  +L+  +    +    L   KS  +            A W   S 
Sbjct: 356 SGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSL 415

Query: 384 FASTDLYKAARVSRQEYYEHGVE 406
            A T  +K    ++++Y E+G E
Sbjct: 416 LAQTAEFKGYCHTKKDYEEYGPE 438

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 81/384 (21%), Positives = 152/384 (39%), Gaps = 59/384 (15%)

Query: 41  YLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLI 100
           Y+ ++        S S   P  +GQ+ +W+     W+   F       +   + +  + +
Sbjct: 92  YIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFL 145

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXX 160
            +E  +  PE  + + ++ FE +    L  A  +     +  T ++KV+           
Sbjct: 146 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWT-SSKVVDRSLTG----- 199

Query: 161 XXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN 220
                       VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R   
Sbjct: 200 -----------TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERG 246

Query: 221 VMDETI-LVNNIKEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPP 277
             D T+     IK++  ++    V  F+ F +  +   ++++              +N  
Sbjct: 247 EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIV--------------ENSE 292

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIA--QLLKPGIIETIL-ESLSLVPEPLRPLMVSNIL 334
               + + +  E F  PE FF+PEIA    L P  + TI+ +++   P  +R  + +NI+
Sbjct: 293 KTRRKVIDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIV 350

Query: 335 CTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMS 382
            +GG+     F  RL  +L+  +    +   +L   KS  +            A W   S
Sbjct: 351 LSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGS 410

Query: 383 AFASTDLYKAARVSRQEYYEHGVE 406
             A T  ++    S+Q+Y E G E
Sbjct: 411 LLAETAEFRGYCHSKQDYEEIGPE 434

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 110/252 (43%), Gaps = 36/252 (14%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +      ++++              +N      + V +  E
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFII--------------ENQGKTQKKIVDVGYE 317

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILE-SLSLVPEPLRPLMVSNILCTGGNFNLPHFP 346
            F  PE FF+PEIA    L P  + TI++ ++   P  +R  + SNI+ +GG+     F 
Sbjct: 318 RFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFG 375

Query: 347 ERLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAAR 394
            RL  +L+  +    +    L   KS  +            A W   S  A T  +K+  
Sbjct: 376 RRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYC 435

Query: 395 VSRQEYYEHGVE 406
            ++++Y E+G E
Sbjct: 436 HTKRDYEEYGPE 447

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 110/251 (43%), Gaps = 34/251 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +      ++V+ + + T       R+       + V +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT-------RR-------KVVDIGYE 308

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +L+  + +  +    L   KS  +            A W   S  A T  +K    
Sbjct: 368 RLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 396 SRQEYYEHGVE 406
           ++++Y E+G E
Sbjct: 428 TKKDYEEYGPE 438

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 109/251 (43%), Gaps = 34/251 (13%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F +      ++V+ + + T       R+       + V +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT-------RR-------KVVDIGYE 308

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPE 347
            F  PE FF+PEIA    L P +   + +++   P  +R  + +NI+ +GG+     F  
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAARV 395
           RL  +L+  +    +    L   KS  +            A W   S  A T  +K    
Sbjct: 368 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 396 SRQEYYEHGVE 406
           ++++Y E+G E
Sbjct: 428 TKKDYEEYGPE 438

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P +    + GI E     +L+     P  L      MV+N+L TGGN  
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQEY 400
           +P   ER+  E    LPT  +  + +    S  L  W  M+A A + + Y+   +S++EY
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVNMSSDPS--LDAWKGMAALARNEEQYRKTVISKKEY 734

Query: 401 YEHGVEWTTKNRFG 414
            E+G E+  +++ G
Sbjct: 735 EEYGPEYIKEHKLG 748

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 85/220 (38%), Gaps = 33/220 (15%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALA--RDKF---GATYLSNQINQIKDISSVSFK 58
           P+ +D GS +++ G+   + P     NAL   RD+      T++ N     + + S S +
Sbjct: 39  PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-R 97

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P +   +T+W L   + DY F +     G    +     ++ +E   T+     N  Q+
Sbjct: 98  SPFDGPFVTNWNLTEEILDYTFHHL----GVVPDNGIPNPILLTERLATVQSQRTNWYQI 153

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FE Y    +     S F  ++ +    K                        +VI  G 
Sbjct: 154 LFETYNVPGVTFGIDSLFSFYNYNPSGNKT----------------------GLVISCGH 191

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
             T V+P++ G       K+++ GG      L + ++ ++
Sbjct: 192 EDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 68/149 (45%), Gaps = 10/149 (6%)

Query: 278 SKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MV 330
           S +   + L  E   VPE FF P +    + G+ E     +L      P  +  +   M 
Sbjct: 601 SHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMA 660

Query: 331 SNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL- 389
            N+  TGGN  +P   ER+  E    LP + S  + +    S  L  W  M+ +A  +  
Sbjct: 661 KNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNISSDPS--LDAWRGMAKYAQNETD 718

Query: 390 YKAARVSRQEYYEHGVEWTTKNRFGYQNW 418
           YK + +S++EY E+G ++  +++ G  N+
Sbjct: 719 YKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 10/137 (7%)

Query: 286 LRDELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCTGG 338
           L  E   VPE  F P IA   + GI E     +L+     P  L      MV+N+  TGG
Sbjct: 610 LNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWITGG 669

Query: 339 NFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSR 397
           N  +P    R+  E    LP      +++ +  S  L  W  M+  A+ +  YK   V+R
Sbjct: 670 NARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS--LDAWKGMAKLANNETDYKNTAVTR 727

Query: 398 QEYYEHGVEWTTKNRFG 414
           +EY E+G ++  +++ G
Sbjct: 728 KEYEEYGPDYIKEHKLG 744

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 94/245 (38%), Gaps = 41/245 (16%)

Query: 6   LVVDNGSYEVKFGYSTTSQP---FRALNALARDKFGA---TYLSNQINQIKDISSVSFKR 59
           + +D GSY ++ GY+  + P   F       RD+      T++ N     + I S S K 
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTIRSQS-KS 97

Query: 60  PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVV 119
           P +   LT+W+    + +Y F +     G    +     LI +E    L     +  Q++
Sbjct: 98  PFDGTLLTNWDYVEDMLEYTFHHL----GVSGNNGVSNPLIINERLACLQSQRNSWYQLL 153

Query: 120 FEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFN 179
           FE ++   +     S F  +   T+                           +VI+ G  
Sbjct: 154 FETFDLPEVSFGIDSLFSFYGNSTKEDG------------------------LVINCGNE 189

Query: 180 CTWVVPIIKGVPFYKAVKKLDLGG----RFINGLLKETLSFRHYNVMDETILVNNIKEKC 235
            T V+PI+ G       K+++ GG     F++ LL  TL + ++     T+    + E  
Sbjct: 190 ETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQYTQMYEDY 247

Query: 236 LFMSP 240
            + SP
Sbjct: 248 CYTSP 252

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 111/252 (44%), Gaps = 36/252 (14%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     A+K + + GR I   ++  L  R     D ++     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 232 KEKCLFMSP--VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289
           K++  ++ P  V  F+ F ++ +   ++++              +N      + V +  E
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFII--------------ENQDKTKQKVVDIGYE 319

Query: 290 LFSVPETFFHPEIAQ--LLKPGIIETILE-SLSLVPEPLRPLMVSNILCTGGNFNLPHFP 346
            F  PE FF+PEIA    L P  + T+++ ++   P  +R  + +NI+ +GG+     F 
Sbjct: 320 RFLAPEIFFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFS 377

Query: 347 ERLATELQRQLPTDWSAKIYLPQPKSCEL------------AGWCSMSAFASTDLYKAAR 394
            RL  +++  + +       +   KS  +            A W   S  A T  +K+  
Sbjct: 378 RRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYC 437

Query: 395 VSRQEYYEHGVE 406
            ++++Y E+G E
Sbjct: 438 HTKKDYEEYGPE 449

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 284 VTLRDELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCT 336
           + L  E   VPE  F P +  L + GI E     +L      P+ L  L   M +NI  T
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 337 GGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARV 395
           GGN  +P   ER+  E +  LP +    + +    + +   W  M+  A  +  YK   +
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMTSDPTFD--AWNGMAKLAQNETDYKKTII 728

Query: 396 SRQEYYEHGVEWTTKNRFG 414
           S++EY E+G E+  +++ G
Sbjct: 729 SKKEYEEYGPEYIKEHKLG 747

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE---TILE------SLSLVPEPLRPLMVSNILCTGGN 339
           E    PE  F P +  L + GI E    IL       S  L  + L   M SNI  TGGN
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD--MASNIFITGGN 668

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQE 399
             +P+  ER+  E    LP +    +   Q  +  L  W  M+ FA +D Y +  V++ E
Sbjct: 669 TKIPNLRERIVNEFTGFLPVNTPLNVNYAQ--NVSLDAWKGMAKFARSDTYSSTCVTKVE 726

Query: 400 YYEHGVEWTTKNRFG 414
           Y E G  +  +++ G
Sbjct: 727 YEEFGPNYIKEHKLG 741

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 89/220 (40%), Gaps = 34/220 (15%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDK-----FGATYLSNQINQIKDISSVSFK 58
           P+ +D GSYEV+ G+++   P       + R K        T++ N  +    + S S +
Sbjct: 41  PIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS-R 99

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P++   +T+WE    +  Y F +     G    D     +I +E   T+     N  Q+
Sbjct: 100 SPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMATVQAQRSNWYQL 155

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FE Y    +    I G   FS +  N+                     +   ++I+SG 
Sbjct: 156 LFECYGIPQVTFG-IDGL--FSFYANNSP--------------------DSTGLIINSGH 192

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
             T ++P+IKG       K++D GG      LK  LS ++
Sbjct: 193 EDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 66/139 (47%), Gaps = 20/139 (14%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE---TIL--------ESLSLVPEPLRPLMVSNILCTG 337
           E   VPE  F P +  L + GIIE   TI+          LS V +     M +N+  TG
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQE----MANNVFLTG 665

Query: 338 GNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA--STDLYKAARV 395
           GN  +P   +R+  E    LP      I +    + +   W  M+ FA  STD YK + V
Sbjct: 666 GNVRVPGLRDRIVREFTEFLPVGTKYNIKVASDPAID--AWKGMAKFAQSSTD-YKGSYV 722

Query: 396 SRQEYYEHGVEWTTKNRFG 414
           +++EY E+G ++  +++ G
Sbjct: 723 TKKEYEEYGPDYIKEHKLG 741

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 81/206 (39%), Gaps = 34/206 (16%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGA-----TYLSNQINQIKDISSVSFK 58
           P+ +D GS EV+ GY+  S P       L R +        T++ N  N  + + + S +
Sbjct: 38  PIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQS-R 96

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P +   +T+W+    + +Y F   N   G    D     ++ +E   TL     N  Q+
Sbjct: 97  SPFDGPMITNWDYVEDMMEYTF---NHL-GVVGHDGISNPILLTEKMATLQSQRSNWYQL 152

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FE +    L     S F  F+ +  ++                         +VI SG 
Sbjct: 153 MFECFGVPKLTFGIDSLFSYFANNQSDST-----------------------GLVISSGN 189

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGR 204
             T V+P++ G       K+++ GGR
Sbjct: 190 EDTNVIPVVCGKGILSEAKRINWGGR 215

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%)

Query: 308 PGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYL 367
           PGI++ I  S+      LR  +  NI+ TGG   +P F +RL  EL ++LP      +  
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 368 PQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            Q +  +   W   S  +S   +    V +QEY E G +   K+RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 86/235 (36%), Gaps = 54/235 (22%)

Query: 6   LVVDNGSYEVKFGYSTTSQP------------FRALNALARDKFGATYLSNQINQIKDI- 52
           +V+D GS+    GYS T  P             + + +   ++      SN  N+ K I 
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASN--NKSKKIF 74

Query: 53  --SSVSFKRPH-------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASE 103
              S+++ R         + G++  W+     WD+   N        L+ + G     +E
Sbjct: 75  GEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKN-----ALYLESNSGIPAFLTE 129

Query: 104 TCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXX 163
                 E  K   +V+ E  +F++   +P    + F+    N                  
Sbjct: 130 PIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNC----------------- 172

Query: 164 XXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
                   +V+D G +   V P+I G+   K+  +  + GRFIN  +KE L  R 
Sbjct: 173 --------LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 10/134 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P +    + GI E     +L+     P  L      MV+N+  TGGN  
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQEY 400
           +P   ER+  E    LP   +  + +    S  L  W  M+A A + + YK   +S++EY
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNMSSDPS--LDAWKGMAALAQNKEEYKKTVISKKEY 734

Query: 401 YEHGVEWTTKNRFG 414
            E+G ++  +++ G
Sbjct: 735 EEYGPDYIKEHKLG 748

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 87/220 (39%), Gaps = 33/220 (15%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALA--RDKF---GATYLSNQINQIKDISSVSFK 58
           P+ +D GS +++ G+   + P     N L   RD+      T++ N     + + S S +
Sbjct: 39  PIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-R 97

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P +   +T+W     + DY F +     G    +     ++ +E   T+     N  Q+
Sbjct: 98  SPFDGPFVTNWNFTEEIMDYTFHHL----GVSPNNGVRNPILLTERMATVQSQRANWYQI 153

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FE Y    +     S +  ++++T   K                        +VID G 
Sbjct: 154 MFETYNVPGVTFGIDSLYGFYNQNTSGNKT----------------------GLVIDCGH 191

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
             T V+P++ G       K+++ GGR     L + ++ ++
Sbjct: 192 EDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE---TIL------ESLSLVPEPLRPLMVSNILCTGGN 339
           E   VPE  F P +    + GI E   TIL      +   L    L   MV+NIL TGGN
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLD--MVNNILITGGN 674

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSRQ 398
             +P   ER+  E    LP   +  + +    S  L  W  M+A A     YK   +S++
Sbjct: 675 AKVPGLRERIVKEFTEFLPVGTNVAVNISSNPS--LDAWRGMAALARNKAEYKKTVISKE 732

Query: 399 EYYEHGVEWTTKNRFG 414
           EY E+G ++  +++ G
Sbjct: 733 EYEEYGPDYIKEHKLG 748

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P +    + GI E     +L+     P  L      M +N+  TGGN  
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFAST-DLYKAARVSRQEY 400
           +P   ER+  E    LP   +  I +    S  L  W  M+A A   + YK   +SR+EY
Sbjct: 677 VPGLKERIVKEFTGFLPVGTNININMSSDPS--LDAWKGMAALAQNEEEYKRTIISRKEY 734

Query: 401 YEHGVEWTTKNRFG 414
            E+G ++  +++ G
Sbjct: 735 EEYGPDYIKEHKLG 748

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIET----ILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P I    + GI E      L   +  P  L  +   M++N+  TGG+  
Sbjct: 622 ERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLTGGHAK 681

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFAS-TDLYKAARVSRQEY 400
           LP   ER+  E    LP      I +    S  L  W  M+  AS TD  K  +V++++Y
Sbjct: 682 LPGLKERIVKEYTEFLPVGTKMSINISNDPS--LDTWKGMAKLASNTDYLKKIQVTKKDY 739

Query: 401 YEHGVEWTTKNRFG 414
            E+G E+  ++  G
Sbjct: 740 EEYGPEYMMEHNLG 753

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 91/223 (40%), Gaps = 37/223 (16%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALA--RDKFGA---TYLSNQINQIKDISSVSFK 58
           P+ +D GSY VK GY+  S P     N L   RD+  A   T++ N  N  + +  +  K
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPL-RIQAK 96

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKG---QHLIASETCMTLPELSKNM 115
           RP++   + +WE    ++DY   +        ++ + G     +I +E    L     N 
Sbjct: 97  RPYDGLFIANWEYAEEIFDYTLHH------LGVQTTNGSISNPIILTEKMACLQSQRANW 150

Query: 116 DQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVID 175
            Q++FE ++  S     +     F  +  N                     +E   +VI+
Sbjct: 151 YQLLFETFDVPSATFG-LDSLYAFYNNCANP--------------------FESDGLVIN 189

Query: 176 SGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
            G   T +VPI++G       K+++ GGR     L   L+ ++
Sbjct: 190 CGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGI---IETILES-LSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P I    + GI    ETIL +     P  L      M  NI  TGG+  
Sbjct: 614 ERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLTGGHSK 673

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSRQEY 400
           LP   ER+  E    LP     K+ +   K+  L  W  M   A  +  YK + +S+++Y
Sbjct: 674 LPGLRERIVKEFTGFLPV--GTKLGVKMSKNPSLDAWYGMRKLAQNEADYKDSIISKKDY 731

Query: 401 YEHGVEWTTKNRFG 414
            E+G E+  +++ G
Sbjct: 732 EEYGAEYIKEHKLG 745

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 90/220 (40%), Gaps = 34/220 (15%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGA-----TYLSNQINQIKDISSVSFK 58
           P+ +D GSYEV+ GY+++S P     N L R +        T++ N +   + + S S K
Sbjct: 38  PIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS-K 96

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P +   + +W+    +  Y F   N   G    +S    LI +E   +L    KN  ++
Sbjct: 97  SPFDGSFIANWDYVEDIMQYTF---NHL-GVVGDNSVRNPLIINEPLGSLQSQRKNWYEL 152

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           +FE +   + +   I G   F  + E  +                        +VI+   
Sbjct: 153 LFECFHLPN-VSFGIDGMFGFYANNEGNQD----------------------GIVINCSN 189

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
             T V+P++ G       K+++ GGR     L + +S ++
Sbjct: 190 EETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + I  S+      LR  +  N++ TGG  +LP   +R++ EL R LP      +   
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
           Q +  +  GW   S  AS   +    V +QEY E G +   K+RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 82/219 (37%), Gaps = 42/219 (19%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH---- 61
           +V+D GS+    GYS T  P     A+    +G  Y   + +++    S+   R      
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSCYGK-YTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 62  ---EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
              + G++  WE     WD+   +   F+      + G   + +E      E  K   +V
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRSELRFE-----TNSGMPALLTEPIWNSEENRKKSLEV 126

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           + E  +F +    P +  + F+                            P  +V+D G 
Sbjct: 127 LLESMDFSACYLVPTATAVSFAMG-------------------------RPTCLVVDIGH 161

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFR 217
           + T V P++ G+   K+  +  + G  +N L++  L+ R
Sbjct: 162 DVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILES---------LSLVPEPLRPLMVSNILCTGGN 339
           E   VPE  F P +A L + G+ E I E+          S + E  + L  +N+  TGGN
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTE-ICETNFLKKFGSTRSQLSEGSKKL-AANVFLTGGN 666

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQ 398
             LP   ER+  E    LP   +  + +    + +   W  M+  + +   YK + ++R+
Sbjct: 667 MRLPGVRERIVREFTGMLPMGSNLNVRMASDSAVD--AWRGMAKLSQAGSQYKGSYITRK 724

Query: 399 EYYEHGVEWTTKNRFG 414
           EY E G ++  ++  G
Sbjct: 725 EYQELGADYIKEHNLG 740

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 83/213 (38%), Gaps = 48/213 (22%)

Query: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALA-----RDKFGATYLSNQINQIKDISSVSFK 58
           P+ +D GS EV+ G+    QP     N ++     R     T++ N  N    + S + K
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQA-K 96

Query: 59  RPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
            P++   +++W+    + +Y F +     G +  D     ++ +E   TL    +N  Q+
Sbjct: 97  SPYDGAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQRENWYQL 152

Query: 119 VFE-------EYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQ 171
           +FE        +  DSL          FS +  N                          
Sbjct: 153 LFECFGVPQVTFGIDSL----------FSFYANNDATASG-------------------- 182

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGR 204
           +VI+SG   T V+P++ G       K+++ GGR
Sbjct: 183 LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGR 215

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 14/136 (10%)

Query: 289 ELFSVPETFFHPEIA---QLLKPGIIETILESLSLVPEPLRPL------MVSNILCTGGN 339
           E   VPE  F P +    Q   P + ET+L  L       R L      M  N+  TGGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQ 398
             LP   ER+  E    LP+     I   Q  S  L  W  M+  A +T+ +K   +++Q
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIRKSQDPS--LDAWRGMAKLAQNTEDFKHGYITKQ 726

Query: 399 EYYEHGVEWTTKNRFG 414
           EY E+G E+  ++  G
Sbjct: 727 EYLEYGPEYIKEHNLG 742

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 38/221 (17%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGATYLSNQINQIKDISSVSFKRPH--- 61
           +V+D GSY    GYS +  P   + ++  + K  A   + +  ++    S+   RP    
Sbjct: 15  IVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARPDYEI 74

Query: 62  ----EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQ 117
               E G++  W+     WD+   N        LK + G  ++ +E      E  K   +
Sbjct: 75  KRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRKKSLE 129

Query: 118 VVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSG 177
           V+ E  +F++   +P+S  + F+                            P  +V+D G
Sbjct: 130 VLLEGMDFEACYLSPVSTCVSFAAG-------------------------RPNCLVVDIG 164

Query: 178 FNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
            + T V P+I G+   K+  +  + GR+IN L++  L  R 
Sbjct: 165 HDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 62/163 (38%), Gaps = 5/163 (3%)

Query: 251 DQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGI 310
           ++T  E       T     V +    P +D  T T ++E   V       +I      GI
Sbjct: 357 NKTTTETAASGESTNTSETVNENGKRPIEDTTTSTAKNEDSEVSSNGNGVDII-----GI 411

Query: 311 IETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQP 370
            + +  S+      LR  +  N++ TGG   +P   +RL  EL ++LP      +     
Sbjct: 412 ADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTGHL 471

Query: 371 KSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
           +  +   W   S   S   +    V ++EY E G +    +RF
Sbjct: 472 REKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 9/133 (6%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE----TILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P +    + G+ E     +L+     P  L      M +NI  +GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYY 401
           +P    R+  E    LP     K+ +       L  W  M+ +A ++ Y  + ++++EY 
Sbjct: 673 VPGLKNRIVKEFTSFLPV--GTKLSVNMSSDPLLDSWKGMAKWAKSEDYNKSFITKKEYE 730

Query: 402 EHGVEWTTKNRFG 414
           E+G E+  +++ G
Sbjct: 731 EYGPEYIKEHKMG 743

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           GI++ I +S+      LR  +  N++ TGG   +P   +R+  EL + LP      +   
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             +  +  GW   S  AS   +    V R+EY E G E   K+RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/220 (19%), Positives = 81/220 (36%), Gaps = 41/220 (18%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH---- 61
           +V+D GS+    GYS T  P     ++    +G         +I +   + F R      
Sbjct: 17  IVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 62  ---EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
              E   +  W+     W+Y      +F+      +KG  ++ +E         K   ++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYALNTDLKFES-----NKGTPVLLTEPIWNSEASRKKSLEI 127

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           + E  EF++   A  S  + F+                            P  +V+D G 
Sbjct: 128 LLESMEFEACYLAANSSAVSFA-------------------------MGRPTCLVVDIGH 162

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           + + V P+I G+   K+  +  + G+++N L+ + L  R 
Sbjct: 163 DVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%)

Query: 308 PGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYL 367
           PGI++ I  S++     LR  +  N++ TGG   +P   +R+  EL ++LP      +  
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 368 PQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            Q +  +   W   S  +S   +    V +QEY E G +    +RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 43/239 (17%), Positives = 89/239 (37%), Gaps = 56/239 (23%)

Query: 6   LVVDNGSYEVKFGYSTTSQP-------FRALNALAR--------DKFGATYLSN----QI 46
           +V+D GS+    G+S +  P       + A+  +          D+  A    N    +I
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 47  NQIKDISSVSFKRPH-------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHL 99
            ++ +  SV + R +       + G++  W+     W +   N        LK ++G   
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENE-----LFLKSNEGVPA 131

Query: 100 IASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXX 159
           + +E      E  K   +V+ E   F++   +     + F+    N              
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNC------------- 178

Query: 160 XXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
                       +V+D G +   V P++ G+ F K+ ++  + G+++N L+ + L  R 
Sbjct: 179 ------------LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + I  S+      LR  +  N++ TGG+ ++P   +R+  EL + LP      +   
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
           Q +  +   W   S  AS   +    V +QEY E G +   K+RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/220 (18%), Positives = 81/220 (36%), Gaps = 41/220 (18%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH---- 61
           +++D GS+    GYS T  P     A+    +G      +   + +  S+   R      
Sbjct: 17  IIIDPGSFNTNIGYSGTDCP----QAILPSCYGQYINDEEKPSLFNEQSIGLPRKDYEIK 72

Query: 62  ---EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQV 118
                G++  W+     W++   +   F+      +KG   + +E      +  K   +V
Sbjct: 73  EIVRSGEVVDWDKAQEQWEWAIKSVLLFES-----NKGLPALLTEPIWNSEDNRKKSLEV 127

Query: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGF 178
           + E  +F++    P +  + F+                            P  +V+D G 
Sbjct: 128 LLEGMDFEACYLTPTATAVSFAMG-------------------------RPTCLVVDIGH 162

Query: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           + T V P+I G+   K+  +  + G  +N L++ +L  R 
Sbjct: 163 DITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPRE 202

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + +  +++     LR  +  N++ TGG+ ++P   +RL TEL ++LP      +   
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             +  +   W   S  +S   +    V RQEY E G E   K+RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 81/222 (36%), Gaps = 36/222 (16%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNAL-----ARDKFGATYLSNQINQIKDISSVS 56
           E   +V+D GSY    GYS T  P   + +      A  K G    ++Q   I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFE 71

Query: 57  FKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMD 116
            KR  E G +  WE     W +   +  +F+ F     KG     +E      E  K   
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDS 176
           +V+ E  EF++   AP +    F+                            P  +V+D 
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFA-------------------------MGRPTCLVLDI 161

Query: 177 GFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           G +   V P++ G+   K+  +  L G+ +N L++  L  R 
Sbjct: 162 GHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 302 IAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDW 361
           +A L+   I+ET ++        LR  +  N++ TGG+ ++    +RL TEL ++LP   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 362 SAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
              +     +  +   W   S  +S   +    V RQEY E G E   K+RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 82/222 (36%), Gaps = 36/222 (16%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNA-----LARDKFGATYLSNQINQIKDISSVS 56
           E   +V+D GSY    GYS T  P   + +        +K G    ++Q   +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMD 116
            KR  E G +  WE     W +   +  +F  F     KG     +E      E  K   
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDS 176
           +V+ E  EF++   AP +  + F+                            P  +V+D 
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFA-------------------------MGRPTCLVVDI 161

Query: 177 GFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           G +   V P++ G+   K+  +  L G+ +N L+++ L  R 
Sbjct: 162 GHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           GI + +  S++     LR  +  NI+ TGG+ ++P F +RL  EL ++LP      +   
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             +  +   W   S   S   +    V ++EY E G E    +RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 42/227 (18%), Positives = 84/227 (37%), Gaps = 49/227 (21%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDIS--------SVSF 57
           +V+D GS+    GYS T  P     A+    +G    +   +   + S        S++F
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  KRPH-------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPE 110
            RP        E G +  W+     WD+   N        L+ +KG   + +E+     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPF 170
                 +V+ E  +F++   +     + F+    N                         
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC------------------------ 163

Query: 171 QMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFR 217
            +V+D G +     P++ G+   ++ ++  + G+F++ L+ + L  R
Sbjct: 164 -LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 81/217 (37%), Gaps = 35/217 (16%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNAL----ARDKFGATYLSNQINQIKDISSVSF 57
           E   +V+D GSY    GYS +  P   L ++      DK   T  S Q   I        
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPR-KDYEL 71

Query: 58  KRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQ 117
           K   E G +  W+     W +   N        L  + G   + +E      E  K   +
Sbjct: 72  KPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKKSLE 126

Query: 118 VVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSG 177
           V+ E  +F++   AP S  + F+    N                          +V+D G
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAGRPNC-------------------------LVVDIG 161

Query: 178 FNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
            +   V PI+ G+   K+ ++  + G+FIN L+K+ +
Sbjct: 162 HDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + +  S+      LR  +  N++ TGG  ++P   +RL TEL + LP+     +   
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             +  +   W   S   S   +    V +QEY E GV+    +RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 89/239 (37%), Gaps = 56/239 (23%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISS--VSFKR 59
           E   +V+D GSY    GYS T  P   L +    ++G+   +N+ +  +D  S   + KR
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPHSILPS----RYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PH--------------------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHL 99
            H                    E G +T W+     W++   N        L+ +KG   
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE-----LFLESTKGIPA 123

Query: 100 IASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXX 159
           + +E      +  K   + + E   F++   AP S  + F+    N              
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANC------------- 170

Query: 160 XXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
                       +V+D G +   V P++ G+   K+ ++    G++IN L++  L  R 
Sbjct: 171 ------------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 42/105 (40%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + +  S+      LR  +  N+  TGG   +P   +RL  EL  +LP      +   
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             K  E   W   S   S   +    V RQEY E G +    +RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + I  S+      LR  +  N++ TGG  ++P   +R+  EL + LP      +   
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             K  +   W   S  +S   +    V +QEY E G     K+RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 80/236 (33%), Gaps = 59/236 (25%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLS--------------NQIN 47
           E   +V+D GSY    GYS T  P   L +    ++G  Y+S               ++ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQ-YISEEEEKDEQEQQEDDRKLK 67

Query: 48  QIKDISSVSFKRPH---------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQH 98
           Q K  S  S   P            G +  W+     W +   +   F+      +KG  
Sbjct: 68  Q-KVFSEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFES-----TKGMP 121

Query: 99  LIASETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXX 158
              +E      E  K   +V+ E  EF++   +P    + F+                  
Sbjct: 122 AFLTEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSFA------------------ 163

Query: 159 XXXXXXXXYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
                     P  +V+D G +   V P++ G+   K+     + G  +N LL + L
Sbjct: 164 -------MGRPTCLVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%)

Query: 325 LRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAF 384
           LR  +  N++ TGG  ++P   +RL TEL + LP+     +     +  +   W   S  
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGGSIL 458

Query: 385 ASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            S   +    V +QEY E G+E    +RF
Sbjct: 459 TSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 81/219 (36%), Gaps = 39/219 (17%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRAL----NALARDKFGATYLSNQINQI--KDISSV 55
           E   +V+D GSY    GYS +  P   L      L  D+      S Q   I  KD    
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKLTADENSKKMFSEQSIGIPRKD---Y 69

Query: 56  SFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNM 115
             K   E G +  W+     W +   N        L  + G   + +E      E  K  
Sbjct: 70  ELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMENRKKS 124

Query: 116 DQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVID 175
            +V+ E  +F++   AP S  + F+    N                          +V+D
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPNC-------------------------LVVD 159

Query: 176 SGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
            G +   V PI+ G+   K+ ++  + G+FIN L+++ L
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%)

Query: 325 LRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAF 384
           LR  +  N++ TGG+ ++P   +RL  EL R+LP      +     K  +   W   S  
Sbjct: 408 LRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGHTKERQYQAWLGGSIL 467

Query: 385 ASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            S   +    V + EY E GVE    +RF
Sbjct: 468 TSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/223 (19%), Positives = 81/223 (36%), Gaps = 40/223 (17%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDI---SSVSFKRPH- 61
           +++D GS+    GYS T  P   L +        T       + K I   SS+   RP  
Sbjct: 17  VIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPRPDY 76

Query: 62  ------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNM 115
                 E G +  W+     W +   +        L+ + G   + +E      E  K  
Sbjct: 77  EIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHLQSTSGIPALLTEPIWNSVENRKKS 131

Query: 116 DQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVID 175
            +++ E   F++   + +   + F+                            P  +V+D
Sbjct: 132 LEILLEGMNFEACYLSSVPTCVSFAAG-------------------------RPNCLVVD 166

Query: 176 SGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
            G + T V P++ G+   K+  +  + G++IN L+++ L  R 
Sbjct: 167 IGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 10/133 (7%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIET----ILESLSLVPEPLRPL---MVSNILCTGGNFN 341
           E   VPE  F P +    + GI E     I +     P  L      M  N+   GGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 342 LPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDL-YKAARVSRQEY 400
           +P    R+  E    LP+D    + + +  + ++  W  M   A+T+  Y+   V+ +EY
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNISEAPTLDV--WNGMYRLANTEEDYQRTIVTSEEY 734

Query: 401 YEHGVEWTTKNRF 413
            E GV++  +++ 
Sbjct: 735 DECGVDYLKEHKL 747

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 78/204 (38%), Gaps = 32/204 (15%)

Query: 5   PLVVDNGSYEVKFGYSTTSQP---FRALNALARDKFGATYLS--NQINQIKDISSVSFKR 59
           P+ +D GSYE++ GY+  S+P   F    +  RD+    YL        +   +    + 
Sbjct: 42  PIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARS 101

Query: 60  PHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVV 119
           P +   + +W++   +  Y F +     G    +     +I +E    L     N  Q +
Sbjct: 102 PFDGPLVVNWDMVEDILQYTFHHL----GVQPDNGVTNPIIINEKLACLQSQRSNWYQTL 157

Query: 120 FEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVIDSGFN 179
           FE +    +  A + G + F  H   +                         +VID G+ 
Sbjct: 158 FESFGVPKVSMA-VEGMLAFYGHNGGSST----------------------GIVIDCGYE 194

Query: 180 CTWVVPIIKGVPFYKAVKKLDLGG 203
            T V+PI++G       K+++ GG
Sbjct: 195 DTNVIPIVEGQGMMLDAKRINWGG 218

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 86/222 (38%), Gaps = 45/222 (20%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH 61
           E   +V+D GSY    GYS +  P   L ++    +G  Y +++ N+ K  S  S   P 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGK-YTADEGNK-KIFSEQSIGIPR 66

Query: 62  ---------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
                    E G +  W+     W +   N        L  + G   + +E      E  
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENR 121

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           K   +V+ E  +F++   AP S  + F+    N                          +
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC-------------------------L 156

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
           V+D G +   V PI+ G+   K+ ++  + G+FIN L+K+ L
Sbjct: 157 VVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + +  S+      LR  +  N++ TGG  ++P   +RL TEL + LP+     +   
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
                +   W   S   S   +    V ++EY E GVE    +RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 1/125 (0%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPER 348
           E   VP+     +I  ++ PGI + +  +++     LR  +  N++ TGG   +P   +R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 349 LATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWT 408
           L  EL ++LP      +     +  +   W   S   S   +    V ++EY E G +  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 409 TKNRF 413
            K+RF
Sbjct: 591 LKDRF 595

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 62/166 (37%), Gaps = 30/166 (18%)

Query: 53  SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELS 112
           S    KR  E G +  W++    W +        D F     KG   + +E      +  
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-----KGIPALLTEPVWNTVQNR 211

Query: 113 KNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQM 172
           K   +V+ E+ EF++     I   + F+                           +P  +
Sbjct: 212 KKSLEVLLEKMEFEACYLTTIPTNVSFAAG-------------------------KPNCL 246

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
           V+D G +   V P+I G+   K+V++    GR++N LL+  +  R 
Sbjct: 247 VVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 80/220 (36%), Gaps = 41/220 (18%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH 61
           E   +V+D GSY    GYS +  P   L ++    +G          I    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 62  -------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKN 114
                  + G +  W+     W +   N        L  + G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVI 174
             +V+ E  +F++   AP S  + F+                            P  +V+
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAG-------------------------RPNCLVV 158

Query: 175 DSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
           D G +   V PI+ G+   K+ ++  L G+FIN L+K+ L
Sbjct: 159 DIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+   +  S+      LR  +  N++ TGG   +P   +RL TEL + LP+     +   
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
                +   W   S   S   +    V ++EY E GVE    +RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%)

Query: 309 GIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLP 368
           G+ + +  S+      LR  +  N++ TGG   +P   +RL  EL  +LP      I   
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 369 QPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
             +  +   W   S   S   +    V ++EY + GV+    +RF
Sbjct: 440 HTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 42/221 (19%), Positives = 76/221 (34%), Gaps = 37/221 (16%)

Query: 2   ESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH 61
           E   +V+D GSY    GYS T  P   L +   D         +  ++    S+   R  
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKD 72

Query: 62  -------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKN 114
                  E G +  W+     W +   N        L+ + G   + +E      E  K 
Sbjct: 73  YEIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 115 MDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVI 174
             +++ E  +F++   A     + F     +                          +V+
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGTGRSSC-------------------------LVV 162

Query: 175 DSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLS 215
           D G +   V P++ G+   K+ K+    G ++N L+K  +S
Sbjct: 163 DLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%)

Query: 325 LRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAF 384
           LR  +  NI+ TGG  ++P F +RL +EL ++LP      +     +  +   W   S  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 385 ASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            S   +    V +QEY E G +    +RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/222 (18%), Positives = 77/222 (34%), Gaps = 44/222 (19%)

Query: 6   LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDI---SSVSFKRPH- 61
           +V+D GS+    G+S T  P     A+    +G      + N  K I    S+   RP  
Sbjct: 17  VVIDPGSFSTNIGFSGTDCP----QAILPSCYGEQKAETEDNAPKKIFAEQSIGIPRPDY 72

Query: 62  ------EYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNM 115
                 +   +  W+     W +        D   L  + G   + +E      E     
Sbjct: 73  EIKPIVQNSMVVDWDAAEEQWSWAL-----KDILYLNSNSGIPALLTEPIWNTLENKTKS 127

Query: 116 DQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPFQMVID 175
            +++ E  +F++   +     + F+    N                          +V+D
Sbjct: 128 LEILLESLQFEACYLSSTPTCVSFASGRPNC-------------------------LVVD 162

Query: 176 SGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFR 217
            G + T V P++ G+   K+  +  L G  IN L+K+ L  +
Sbjct: 163 LGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPLKGK 204

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 51/120 (42%), Gaps = 14/120 (11%)

Query: 289 ELFSVPETFFHPEIAQLLKPGIIE---TIL------ESLSLVPEPLRPLMVSNILCTGGN 339
           E   VPE  F P +    + GIIE   TIL      E   L P  L   M +N+  TGGN
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLWITGGN 671

Query: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFA-STDLYKAARVSRQ 398
             LP   ER+  E    LP        + Q  +  L  W  M+    +++ YK   +S++
Sbjct: 672 SKLPGMKERIVKEFTGFLPV--GTAFNVKQSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%)

Query: 308 PGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYL 367
           PGI++ I  S+S     +R  +  N++ TGG+  +P   +R+  EL  + P      +  
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 368 PQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRF 413
            Q    +   W   S  +S   +    + ++EY E G E    +R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/228 (19%), Positives = 80/228 (35%), Gaps = 45/228 (19%)

Query: 6   LVVDNGSYEVKFGYSTTSQP-----------FRALNALARDKFGATYLSNQINQIKDI-- 52
           +++D GSY    GY+ T  P             A  + + D    T  + ++   + I  
Sbjct: 17  VIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSIPI 76

Query: 53  --SSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPE 110
                  KR  E GQ+  W+     W +   N        ++ ++G   + +E      E
Sbjct: 77  PRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTEPLWNSKE 131

Query: 111 LSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVIXXXXXXXXXXXXXXXXXYEPF 170
                 +++ E  EF++      S  + F+                            P 
Sbjct: 132 NRSKSLEILLEGMEFEACYLTATSTAVSFATG-------------------------RPN 166

Query: 171 QMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRH 218
            +++D G +   V P+I G+   K+ +     GRF+N LL + L  R 
Sbjct: 167 SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 109/290 (37%), Gaps = 69/290 (23%)

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL----------------- 214
           +V+D G +   V PII G     AV +    G F++  + E L                 
Sbjct: 141 LVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPE 200

Query: 215 SFRHYNVMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRK 274
           SF+++        +++ K   L +SP    +    +D  A  +   D +  FL       
Sbjct: 201 SFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFLY------ 252

Query: 275 NPPSKDAQTVTL-RDELFSVPETFFHPEIAQ---LLKPGIIETILESL------------ 318
               K  +T+TL + E + + E  F P++A      K G+ E +++++            
Sbjct: 253 ---KKGNKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNS 309

Query: 319 --------------------SLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP 358
                               +  PE +   +++NI+ TG    +P   +R+  EL  Q P
Sbjct: 310 GPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFP 369

Query: 359 TDWSAKIYLPQPKSCELAGW---CSMSAFASTDLYKAARVSRQEYYEHGV 405
               +    P     +L  W    +MS   S +L     ++RQEY  +G+
Sbjct: 370 QYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWEL--GNWITRQEYDANGI 417

>Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {ON}
            complement(31585..40677) [9093 nt, 3031 aa]
          Length = 3030

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 331  SNILCTGGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLY 390
            +N L     F +  F E + +EL++   T W+ K +     S    G  S+S+  +T LY
Sbjct: 2751 NNRLVVTSLFEVRSFSEPMISELEKLYDTHWTEKNFTHTVISFLCKGL-SISSIKTTSLY 2809

Query: 391  KAARVSRQEYYEHGVEWTTKNRFGY 415
               ++ R  YYEH +   + +   Y
Sbjct: 2810 CIEQLFRNTYYEHTLNPESTDYLSY 2834

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 93/253 (36%), Gaps = 40/253 (15%)

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNI 231
           +V+D G   + V PII G     AV +    G F++  + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 232 KEKCLFM--SPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADR--KNPPSKDAQTVTL- 286
           K+  L +  +  ++   F           L D  +  L  +     KN   +  +T++L 
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLT 257

Query: 287 RDELFSVPETFFHPE-IAQ--LLKPGIIETILESLS---------------LVPEPLRPL 328
           + +   + E  F P  ++Q  +   G+ E + +S+                  PE     
Sbjct: 258 QKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAA 317

Query: 329 MVSNILCTGGNFNLPHFPERLATELQRQLP-----------------TDWSAKIYLPQPK 371
           +++NIL TG +  +    +R+  +L  Q P                   W   + +    
Sbjct: 318 LLTNILITGSSSLISGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQGGVTMANLP 377

Query: 372 SCELAGWCSMSAF 384
           S +L  W S S +
Sbjct: 378 SWDLGDWVSQSDY 390

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFD 126
           + E C+ LP LSK++DQV   E EFD
Sbjct: 171 SEEICLNLPNLSKDIDQVESNENEFD 196

>ZYRO0E08558g Chr5 complement(685474..686586) [1113 bp, 370 aa] {ON}
           highly similar to uniprot|P53088 Saccharomyces
           cerevisiae YGL211W
          Length = 370

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 323 EPLRPLMVSNILCTGGNFNL-PHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCS 380
           E +RP  + +I+ +G N  L P  P+R  T  Q ++ TD S  +       CE  G+ S
Sbjct: 268 EMVRPSCIIDIIHSGENLVLKPKKPKRTGTPKQMEVRTDGSVSLGFVDGNKCEKCGYLS 326

>KNAG0G02750 Chr7 (611571..612794) [1224 bp, 407 aa] {ON} Anc_8.713
           YOR264W
          Length = 407

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 56/129 (43%), Gaps = 9/129 (6%)

Query: 283 TVTLRDELFSVPETFFH--PEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340
           T+ L+  L SVPE F H     +Q  +  ++ TI E      +P RP+  +    + G  
Sbjct: 60  TLRLKQRLESVPEIFLHDFKRRSQEQRHSVLSTIDEKTR---DPSRPMHAAK---SNGVA 113

Query: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400
             PH   +    LQR+LP     +    QP S ++ G  ++     ++  K    + Q+ 
Sbjct: 114 AHPHNKIQSKRVLQRRLPPKQQLRSVSSQPTS-QVFGGSNVRVLQGSNKPKITVTAVQDT 172

Query: 401 YEHGVEWTT 409
            E+  ++ T
Sbjct: 173 EENEAKFMT 181

>Kwal_47.18006 s47 complement(643091..644947) [1857 bp, 618 aa] {ON}
           YLR054C - Hypothetical ORF [contig 201] FULL
          Length = 618

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 5/123 (4%)

Query: 18  GYSTTSQPFRALNALARDKFGATYLSNQINQI---KDISSVSFKRPHEYGQLTSWELQSC 74
           G   +S  F  +N   R  FG TY S Q N+     D   ++ +R  +  +     L + 
Sbjct: 62  GRQLSSGSFALVNDCCRFYFGLTYASKQFNKTTSKHDTLMINLQRVQDVFEDEKSTLNAM 121

Query: 75  VWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYEFDSLLKAPIS 134
           +        +E   F  + S    L   E    +P +S N+  +VFE++++D LL+   S
Sbjct: 122 LTQLEHTKVDEVVKFAPESSCDMALKVWE--HVIPRISLNVISIVFEQFDYDKLLENSSS 179

Query: 135 GFM 137
            F+
Sbjct: 180 HFI 182

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 173 VIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETL 214
           +ID G N T +VPI+           L+ GG +IN +L++ L
Sbjct: 160 IIDIGLNHTDIVPIVDYTTINHLSNTLNYGGSYINTILQKLL 201

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/264 (18%), Positives = 90/264 (34%), Gaps = 66/264 (25%)

Query: 172 MVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDE------- 224
           +++D G     V P+I G     A+ +    G F++  + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 225 -------TILVNNIKEKCLFMSPVSYFD-SFAKKDQTAVEYVLPDFQTTFLGYVADRKNP 276
                     + + K   L ++P    D   A  D   + YV               KN 
Sbjct: 154 LELWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYV---------------KNF 198

Query: 277 PSKDAQTVTL-RDELFSVPETFFHPE---------------IAQLLKPGIIETILESLSL 320
             +  +T++L + E  ++ E  F P                +A+ +K     T   S + 
Sbjct: 199 LYRRQKTISLMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSAT 258

Query: 321 ---VPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP-----------------TD 360
               PE +   +++NI+ TG +  +P   +R+  +L  Q P                   
Sbjct: 259 NATTPEQIHAALLTNIVITGSSSLIPGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQS 318

Query: 361 WSAKIYLPQPKSCELAGWCSMSAF 384
           W   + +    S +L  W S S +
Sbjct: 319 WQGGVTMANLPSWDLGEWISQSDY 342

>Ecym_3568 Chr3 (1077825..1079363) [1539 bp, 512 aa] {ON} similar to
           Ashbya gossypii AFR361C
          Length = 512

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 27  RALNALARDKFGA-TYLSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNE 85
           R LN  AR+   +  ++ +  NQ+K  S +   + H  G+ T  ELQ+   + C  +P+ 
Sbjct: 427 RTLNWNAREAQSSFVHMLSGKNQMKYESDIYEGQFHNSGEPTE-ELQTEDSEDCRRHPDS 485

Query: 86  FDGFDLKDSKGQHLIASETC 105
           +D     DS  +H ++SE C
Sbjct: 486 YDKITGSDSDREHYVSSEEC 505

>CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highly
           similar to uniprot|P09368 Saccharomyces cerevisiae
           YLR142w PUT1 Proline oxidase
          Length = 469

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 276 PPSKDAQTVTL-RDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNIL 334
           PPS  A   TL R E+FS+        +A   KP ++  +++    VP PL  + VS + 
Sbjct: 50  PPSSVAYLKTLSRAEVFSLGMI----GLATTSKP-VLNLVIKLFPYVPMPLIKMFVSRLY 104

Query: 335 CTGGNFN-LPHFPERL 349
           C G N N +  F E+L
Sbjct: 105 CGGDNINEVKTFGEKL 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,805,893
Number of extensions: 1959216
Number of successful extensions: 5012
Number of sequences better than 10.0: 160
Number of HSP's gapped: 4820
Number of HSP's successfully gapped: 260
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)