Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038408.257ON72672636170.0
SAKL0H17160g8.257ON73973326870.0
ZYRO0C01782g8.257ON73072826140.0
Kwal_56.236078.257ON72573025550.0
KLTH0G13794g8.257ON72571524970.0
KLLA0F19041g8.257ON76376624850.0
Suva_2.2698.257ON72571520960.0
YDR109C8.257ON71569520800.0
Skud_4.3708.257ON71470820510.0
Smik_4.3558.257ON70470720060.0
NDAI0J014008.257ON58853617100.0
Kpol_392.98.257ON59453417090.0
Ecym_43138.257ON59752216490.0
KAFR0B055608.257ON60552416430.0
NCAS0B038708.257ON59652416210.0
TBLA0E044008.257ON58952915870.0
KNAG0H032608.257ON58052315420.0
CAGL0B01727g8.257ON57754815340.0
AGR092W8.257ON59658114890.0
TPHA0B032408.257ON58552214210.0
Suva_14.931.111ON5435364767e-51
Skud_14.891.111ON5695604708e-50
YNL249C (MPA43)1.111ON5425344468e-47
Smik_14.861.111ON5435344432e-46
KLTH0F03080g1.111ON5335324132e-42
Kwal_33.135301.111ON5345404122e-42
TDEL0C059001.111ON5435384114e-42
SAKL0C03432g1.111ON5475294044e-41
ZYRO0F16016g1.111ON5425343877e-39
KNAG0F006601.111ON5355363796e-38
KLLA0C02937g1.111ON5165002848e-26
NCAS0A007801.111ON5495431394e-08
NDAI0H002204.9ON810118820.31
NCAS0C059004.9ON703120820.31
Kwal_47.175064.113ON92455771.4
KLLA0E00595g4.9ON661119743.2
KAFR0A044206.159ON35534724.7
TPHA0K022804.9ON667106715.9
SAKL0H25938g4.9ON685111716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03840
         (726 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...  1397   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...  1039   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...  1011   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   988   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   966   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   961   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   811   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   805   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   794   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   777   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   663   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   662   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   639   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   637   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    629   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   615   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   598   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   595   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   578   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   551   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   187   7e-51
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   185   8e-50
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   176   8e-47
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   175   2e-46
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   163   2e-42
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   163   2e-42
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   162   4e-42
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   160   4e-41
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   153   7e-39
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   150   6e-38
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   114   8e-26
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    58   4e-08
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    36   0.31 
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    36   0.31 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    34   1.4  
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    33   3.2  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    32   4.7  
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    32   5.9  
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    32   6.5  

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score = 1397 bits (3617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/726 (94%), Positives = 684/726 (94%)

Query: 1   MRHRGQSRSSLSIAQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLA 60
           MRHRGQSRSSLSIAQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLA
Sbjct: 1   MRHRGQSRSSLSIAQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLA 60

Query: 61  EKPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXX 120
           EKPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSL      
Sbjct: 61  EKPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDDE 120

Query: 121 XXXXXXXXXFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLK 180
                    FANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLK
Sbjct: 121 DKEVGVGPVFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLK 180

Query: 181 NNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNT 240
           NNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNT
Sbjct: 181 NNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNT 240

Query: 241 INLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGV 300
           INLPELVENVFCQDRWPATATAADGTTHSFLSAGEYV             PVHCVVGSGV
Sbjct: 241 INLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGV 300

Query: 301 IDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVN 360
           IDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVN
Sbjct: 301 IDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVN 360

Query: 361 GVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRL 420
           GVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRL
Sbjct: 361 GVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRL 420

Query: 421 ETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGA 480
           ETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGA
Sbjct: 421 ETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGA 480

Query: 481 CEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV 540
           CEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV
Sbjct: 481 CEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV 540

Query: 541 FGSALLGAVASESFNSHHAKSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPS 600
           FGSALLGAVASESFNSHHAKSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPS
Sbjct: 541 FGSALLGAVASESFNSHHAKSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPS 600

Query: 601 PYTAPHXXXXXXXXXXXXXXFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATR 660
           PYTAPH              FPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATR
Sbjct: 601 PYTAPHATSSTSQIAATSGSFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATR 660

Query: 661 NPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKV 720
           NPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKV
Sbjct: 661 NPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKV 720

Query: 721 EKAIAK 726
           EKAIAK
Sbjct: 721 EKAIAK 726

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/733 (70%), Positives = 585/733 (79%), Gaps = 20/733 (2%)

Query: 3   HRGQSRSSLSIAQQRFMSQSMAAISLEQ-AMIYYVGVDVGTGSARACIIDNTGNILSLAE 61
           H  +SRSSLSI+QQR +SQSM+A+S+EQ  M YYVGVDVGTGSARACIIDN GNILSLAE
Sbjct: 2   HSRKSRSSLSISQQRLLSQSMSALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAE 61

Query: 62  KPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXX 121
           +PIQR+ELKP+YITQSSQEIW +IC+CVKSVV+DSGV  E+IHGIGFDATCSL       
Sbjct: 62  RPIQRQELKPSYITQSSQEIWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDS 121

Query: 122 XXXXXXX-XFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLK 180
                    F N +QNI+LWMDHRAI ET EINATNDKCLKYVGGQMSVEMEIPKIKWLK
Sbjct: 122 DKEVAVGPDFFNTEQNIILWMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLK 181

Query: 181 NNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNT 240
           NNLP+E+F+KCKFFDLADYLTFKAT  +TRS+CSTVCKQGL+P+GVE SK+GWSK+FL  
Sbjct: 182 NNLPREKFEKCKFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTN 241

Query: 241 INLPELVENVFCQDRWPATATAADGTTHS-FLSAGEYVXXXXXXXXXXXXXPVHCVVGSG 299
           I L +L ++ F   R    +  +DG+  S FLSAGE +             P HCVVGSG
Sbjct: 242 IGLEDLCQDDF---RKLGGSIKSDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSG 298

Query: 300 VIDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFV 359
           VIDAYAGWVGTVAA+TDV++P+L EAD  K GID ATGRLAAVAGTSTCHIA+S+DP+FV
Sbjct: 299 VIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFV 358

Query: 360 NGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSR 419
           +GVWGPYRDVMA GFW AEGGQSCTGALLAHV++ HPA+TELSHLSDAA++SKFDYLNSR
Sbjct: 359 DGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSR 418

Query: 420 LETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLG 479
           LE L QQRG RSVVALAKHL+FYGDYHGNRSPIADPSMRAA+IGQSMDNSIDDLAIMYLG
Sbjct: 419 LEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLG 478

Query: 480 ACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAV 539
           ACEFIAQQTRQIVEKM  +GH+I+ IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAV
Sbjct: 479 ACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAV 538

Query: 540 VFGSALLGAVASESFNSHHAKSEITRRRKSSLTN-----LDPSSLPSASGKGPLSQLGKM 594
           VFGSALLGAVASESFN +H    ++RRRKSSL+       D   +P    K  LS+LG  
Sbjct: 539 VFGSALLGAVASESFNLNHKSGSLSRRRKSSLSGKYEEFKDSMEIPK---KNFLSKLGGT 595

Query: 595 KP-DLPSPYTAPHXXXXXXXXXXXXXXFPFPVVGESSEAITEEANDSE--GPVSFKPTRA 651
              DLPSPYTAP               FPFPV  + S AI EE +  E    +SF   +A
Sbjct: 596 ASGDLPSPYTAPSATASTSQIASTVGGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKA 655

Query: 652 TSQEGLA---TRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMAD 708
           T+QE LA    ++    GDALWDVMY MTGGGKVV+PS +D PDRVLL+AKYKIFLDMA+
Sbjct: 656 TAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAE 715

Query: 709 SQRRYREAIDKVE 721
           +QRRYREA+DKVE
Sbjct: 716 TQRRYREAVDKVE 728

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/728 (67%), Positives = 578/728 (79%), Gaps = 17/728 (2%)

Query: 3   HRGQSRSSLSIAQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEK 62
           +RG+SRSS+SI+QQR +SQSM  +SLEQ MIYY+GVDVGTGSARAC+ID+ GNI+SLAEK
Sbjct: 2   YRGRSRSSMSISQQRLLSQSMLGLSLEQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEK 61

Query: 63  PIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXX 122
           PIQREELKP YITQSS+EIW +IC+CVK+VVRDSGV +ERIHGIGFDATCSL        
Sbjct: 62  PIQREELKPTYITQSSKEIWSAICYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDG 121

Query: 123 XXXXXX-XFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKN 181
                   F N DQNI+LWMDHRA+ ET EIN+TN   LKYVGGQMS+EMEIPKIKWLKN
Sbjct: 122 ADVPVGPDFENPDQNIILWMDHRAVQETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKN 181

Query: 182 NLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTI 241
           ++P+E+F+   FFDLAD+LT+KAT   TRSF S+VCKQGL+P+GVEGS  GWS +FLN I
Sbjct: 182 HMPREKFNDTVFFDLADFLTYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLI 241

Query: 242 NLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVI 301
           +LPELV N F +    +     D    +FLSAG+YV               HCVVGSGVI
Sbjct: 242 DLPELVANDFAK-LGGSVKPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVI 300

Query: 302 DAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNG 361
           DAYAGWVGTVAAQTD E+P+LA+ ++ K G+D+ATGRLAAVAGTSTCH+ALSRDP+FV G
Sbjct: 301 DAYAGWVGTVAAQTDEEIPELAKCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPG 360

Query: 362 VWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLE 421
           VWGPYRDVMA GFW AEGGQSCTGALLAHV+STHPA+T+L HLS++A +SKFDYLNSRLE
Sbjct: 361 VWGPYRDVMAPGFWCAEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLE 420

Query: 422 TLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGAC 481
            LV  R +RSVVALAKHL+FYGDYHGNRSPIAD +MRAAIIGQSMDNS+DDLA+ YLGAC
Sbjct: 421 YLVNARKERSVVALAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGAC 480

Query: 482 EFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVF 541
           EFIAQQTRQIVE MC +GH IS+IFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVF
Sbjct: 481 EFIAQQTRQIVEIMCKSGHNISSIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVF 540

Query: 542 GSALLGAVASESFNSHHAKSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSP 601
           GSALLGAVASES+N+HH K+++ +RR SSL + D +   +  GKG LS+L +++ D PSP
Sbjct: 541 GSALLGAVASESYNAHHTKTDLRKRRASSLGSKDQAI--AGLGKGGLSKLSELQTDQPSP 598

Query: 602 YTAPHXXXXXXXXXXXXXXFPFPVVGESS-------EAITEEANDSEGPVSFKPTRATSQ 654
           YTAPH                FP+VG  +       EAI  E  D E PV+FK  ++T+Q
Sbjct: 599 YTAPHATSSSHMGGGSY----FPIVGSDAAANLSPGEAIA-ETEDEEEPVTFKSVKSTTQ 653

Query: 655 EGLATRNPPN-NGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRY 713
           E LA +   N NG+ LW VMY MTGGGKVVRP+P+ +PDRVLLNAKYKIFLDMA++QR+Y
Sbjct: 654 ENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQY 713

Query: 714 REAIDKVE 721
           R AID+VE
Sbjct: 714 RSAIDRVE 721

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/730 (66%), Positives = 560/730 (76%), Gaps = 15/730 (2%)

Query: 3   HRGQSRSSLSIAQQRFMSQSMAAISLEQ-AMIYYVGVDVGTGSARACIIDNTGNILSLAE 61
           H  +SRSSLSI+QQR MS+SM  +SLEQ  M+YY+GVDVGTGSARACIID+ GNILSLAE
Sbjct: 2   HSRKSRSSLSISQQRMMSRSMTGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAE 61

Query: 62  KPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXX 121
           +PIQRE+LKPN+ITQSSQEIWQ++CHCVKSVVRDSGVP E+IHGIGFDATCSL       
Sbjct: 62  RPIQREQLKPNFITQSSQEIWQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGS 121

Query: 122 XXXXXXX-XFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLK 180
                    F N +QNI+LWMDHRAI ET +INAT DKCLKYVGGQMSVEMEIPKIKWLK
Sbjct: 122 NKEVAVGPDFQNTNQNIILWMDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLK 181

Query: 181 NNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNT 240
           N+LP  +FD+CKFFDLADYLTFKA+ K+TRSFCSTVCKQGL+P+GVEGSKEGWS++FL  
Sbjct: 182 NHLPNNKFDECKFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTE 241

Query: 241 INLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGV 300
           I L + +E+ F   R    +        +FLSAGE+V               HCVVGSGV
Sbjct: 242 IGLEDFIEDDF---RKIGGSVKNSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGV 298

Query: 301 IDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVN 360
           IDAYAGWVGTVAA+TDV +P L + D+ K G+DRATGRLAAVAGTSTCHIA+SRDP+FV+
Sbjct: 299 IDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVD 358

Query: 361 GVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRL 420
           GVWGPYRD +A  FW AEGGQSCTGALLAHVM+THPA+TELS L+DAA++SKFDYLNSRL
Sbjct: 359 GVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRL 418

Query: 421 ETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGA 480
           ETL QQ+  RSVV LA+HL+FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLA+MYLGA
Sbjct: 419 ETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGA 478

Query: 481 CEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV 540
           CEFIAQQTRQIVEKM  +GH ++ IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVV
Sbjct: 479 CEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVV 538

Query: 541 FGSALLGAVASESFNSHHAKSEITRRRKSSLT-NLDPSSLPSASGKGPLSQLGKMKPDLP 599
           FGSALLGAVASESF+     SE++  RKSS+  +    S P  S    L Q G    DLP
Sbjct: 539 FGSALLGAVASESFDLSGTTSELSVSRKSSIAGHPTDGSQPKKSAVSKLGQFG--SDDLP 596

Query: 600 SPYTAPHXXXXXXXXXXXXXXFPFPV------VGESSEAITEEANDSEGPVSFKPTRATS 653
           SPYTAP               FPFP       +GE +E   +  N SE            
Sbjct: 597 SPYTAP-SATASTSQIASTVGFPFPTPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKD 655

Query: 654 QEGLATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRY 713
            E        +NGDA+W+VMY MTGGGKVV+P PED+PDR LL+ KYKIFLDMA++QR+Y
Sbjct: 656 MEDRMKGRSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKY 715

Query: 714 REAIDKVEKA 723
           R  +++VEK+
Sbjct: 716 RNLVNEVEKS 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/715 (66%), Positives = 552/715 (77%), Gaps = 19/715 (2%)

Query: 15  QQRFMSQSMAAISLEQ-AMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNY 73
           QQR MS+SM  +SLEQ  M+YYVGVDVGTGSARACIID+ GNILSLAE+PIQRE+LK N+
Sbjct: 14  QQRMMSRSMVGLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANF 73

Query: 74  ITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFAN 132
           ITQSSQEIWQ++CHCVKSVVRDSGVP E+IHGIGFDATCSL                F+N
Sbjct: 74  ITQSSQEIWQAVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSN 133

Query: 133 NDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCK 192
            DQNI+LWMDHRAI ET  INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP+ +F++CK
Sbjct: 134 TDQNIILWMDHRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECK 193

Query: 193 FFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFC 252
           FFDLADYLTFKA+ K+TRSFCSTVCKQGL+P+GVEGS EGWS++FL  I L EL+E+ F 
Sbjct: 194 FFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDF- 252

Query: 253 QDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVA 312
             R    +        +FLSAGE++               HCVVGSGVIDAYAGWVGTVA
Sbjct: 253 --RRIGGSVKNSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVA 310

Query: 313 AQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAH 372
           A+TDV +P L + D+ K G+DRATGRLAAVAGTSTCHIA+SRDP+FV+GVWGPYRD +A 
Sbjct: 311 ARTDVSIPALVKTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALAT 370

Query: 373 GFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSV 432
            FW AEGGQSCTGALLAHV++THPA+TELS L+DAA++SKFDYLNSRLETL QQ+  RSV
Sbjct: 371 NFWCAEGGQSCTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSV 430

Query: 433 VALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIV 492
           V LAKHL+FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLA+MYLGACEFIAQQTRQIV
Sbjct: 431 VHLAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIV 490

Query: 493 EKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552
           +KMC +GH +S IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASE
Sbjct: 491 DKMCTSGHDLSAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550

Query: 553 SFNSHHAKSEITRRRKSSLTNLDPSSL--PSASGKGPLSQLGKMKPDLPSPYTAPHXXXX 610
           SF+     S ++  RKSS+   +P++   P  S      QLG    DLPSPYTAP     
Sbjct: 551 SFDLSGTHSALSVSRKSSIAG-EPANAGQPKKSAVSKFGQLG--GDDLPSPYTAP-SATA 606

Query: 611 XXXXXXXXXXFPFPVVGESSEAITE--EANDSEGPVSFKPTRATSQ-----EGLATRNPP 663
                     FPFP   E + AI E  E    EG  +    +A S+     E        
Sbjct: 607 STSQIASTIGFPFPTP-EDAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSS 665

Query: 664 NNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAID 718
           +NGDA+W+VMY MTGGGKVV+P+ E++ DRVLLNAKYKIFLDMA++QR+YR  +D
Sbjct: 666 DNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/766 (63%), Positives = 561/766 (73%), Gaps = 58/766 (7%)

Query: 6   QSRSSLSIAQQRFMSQSMAAISL--EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKP 63
           +S SSLSI+QQR +S SM+ +SL  E+ M+YYVGVDVGTGSARAC+IDN GNILSLAE+P
Sbjct: 6   KSHSSLSISQQRLLSHSMSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERP 65

Query: 64  IQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXX 123
           IQR ELKPNYITQSSQEIW +IC+CVK+VVRDSGV    IHGIGFDATCSL         
Sbjct: 66  IQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVDNNNED 125

Query: 124 XXXXXXFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNL 183
                 F +N QNI+LWMDHRAI ET EINAT DKCLKYVGGQMSVEMEIPKIKWLKNN+
Sbjct: 126 VGVGPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNI 185

Query: 184 PKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINL 243
           P+++F +CKFFDLADYLTFKAT  + RS+CSTVCKQGL+P+GVEGSK GWSK+FL  I L
Sbjct: 186 PEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGL 245

Query: 244 PELVENVFCQDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDA 303
            EL+ + F +     T T       +FLSAGE +               HCVVGSGVIDA
Sbjct: 246 EELIADDFAKLGGSVTET-------TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDA 298

Query: 304 YAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVW 363
           YAGWVGTVAA+TDVE+P L ++D  K GIDRATGRLAAVAGTSTCHIA+S+DP+FV GVW
Sbjct: 299 YAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVW 358

Query: 364 GPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETL 423
           GPYRDVMA GFW AEGGQSCTGALLAHV++THPA+ ELS LSDAAN+SKFDYLNSRLE L
Sbjct: 359 GPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELL 418

Query: 424 VQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEF 483
            QQR   SVVALAKHL+FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDL+IMYLGACEF
Sbjct: 419 AQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEF 478

Query: 484 IAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGS 543
           IAQQTRQIVE+MC++GH+++ IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGS
Sbjct: 479 IAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGS 538

Query: 544 ALLGAVASESFN------------SHHAKSEITRRRKSSLTNLDPSSLPSAS-------- 583
           ALLGAVASESFN            +  +  +++ RRKSSL+  D   +   S        
Sbjct: 539 ALLGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAA 598

Query: 584 ---GKG------PLSQLGKMK--------PDLPSPYTAPHXXXXXXXXXXXXXXFPFPVV 626
              G G      PL+   K +         D+PSPYTAP               +PFPV+
Sbjct: 599 SGLGHGGGNTLKPLTSFAKAQKKTNDLKFADMPSPYTAP-SATSSTAQISTTGGYPFPVM 657

Query: 627 GESSEAITEEANDSEGPVS---FKPTRATSQEGLATRNPPNNG--------DALWDVMYQ 675
             + EAI +E  +     S   F      S+E   +    NN         D LW+VMY 
Sbjct: 658 ASNEEAIIDEMEEENEDESLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYN 717

Query: 676 MTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721
           MTGGGKVV P+ ED PDR+LLNAKYKIFLDMA +Q++YR+ +D+V+
Sbjct: 718 MTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/715 (57%), Positives = 507/715 (70%), Gaps = 30/715 (4%)

Query: 14  AQQRFMSQSMAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNY 73
           +Q + + Q+    S E+   ++VGVDVGTGS RACIID  G ILSLAEKPI+REE++ N+
Sbjct: 26  SQNKLLPQTSLQDSQEK---FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNF 82

Query: 74  ITQSSQEIWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFAN 132
           ITQSS+EIW ++CHCVK+V+++S V  +++HGIGFDATCSL                F+N
Sbjct: 83  ITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSN 142

Query: 133 NDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCK 192
           NDQNI+LWMDHRA+ ET EIN+T DKCLKYVGGQMSVEM+IPKIKWLKNNL  E F  CK
Sbjct: 143 NDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCK 202

Query: 193 FFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFC 252
           FF+L DYLTFKAT K+ RSF S VCKQG +P GVE SK GWS++FLN+I L EL  N F 
Sbjct: 203 FFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDF- 261

Query: 253 QDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVA 312
            +R   +         +FLSAGE V               HC+VGSG+IDAYAGWVGTVA
Sbjct: 262 -ERLGGSLR----DKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVA 316

Query: 313 AQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAH 372
           A+    +P L+E +  K  I+ A GRLAAVAGTSTCHI LS+DP+FV+GVWGPYRDV+A 
Sbjct: 317 AKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLAR 376

Query: 373 GFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSV 432
            FW AEGGQSCTGALLAHV+ THPAFTELS L+DAA+IS F+YLNS LETLVQ+R +RSV
Sbjct: 377 NFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSV 436

Query: 433 VALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIV 492
           V+LAKH +FYGDYHGNRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI+
Sbjct: 437 VSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQII 496

Query: 493 EKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552
           E M + GH+I  IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE
Sbjct: 497 EAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASE 556

Query: 553 SFNSHHAKSEITRRRKSSLTNL-----DP-SSLPSASGKGPLSQLGKMKPDLPSPYTAPH 606
           + +  + K+ I + R+SSL+       DP   + + SG+        +  D+  P + P 
Sbjct: 557 ASDLANEKT-ICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQ-----NLAFDVSPPNSTPS 610

Query: 607 XXXXXXXXXXXXXXFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNG 666
                            P+V      +    N ++   S     +T   GL  +   N+G
Sbjct: 611 YIKNIPATLNSHIS---PIVERQLHVVVSARNRNDKDTS----TSTVTRGL-QKERCNSG 662

Query: 667 DALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721
           D LW VM ++TG  KVV P+ +  PDR+LL+ KY+IFLDMA++QR+YR  +D+VE
Sbjct: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/695 (56%), Positives = 495/695 (71%), Gaps = 20/695 (2%)

Query: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93
           +YVGVDVGTGSARAC+ID +GN+LSLAEKPI+RE+L  N+ITQSS+EIW ++C+CV++VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 94  RDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETNEI 152
            +SGV  ER+ GIGFDATCSL                F NNDQNI+LWMDHRA+ ET EI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212
           N++ DKCLKYVGGQMSVEMEIPKIKWLKNNL    F  CKFFDL DYLTFKAT K+ RSF
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272
           CS VCKQG +P+GVEGS  GWSK+FLN+I L EL +N F  +R   +         +FL+
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDF--ERLGGSLREK----KNFLT 272

Query: 273 AGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332
           AGE +               HCVV SG+IDAYAGWVGTVAA+ +  +  LAE +  KK  
Sbjct: 273 AGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDF 332

Query: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392
           + A GRLAAVAGTSTCHI LS++P+FV+GVWGPYRDV+A GFWAAEGGQSCTG LL H++
Sbjct: 333 NGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLI 392

Query: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452
           +THPAFTELSH+++ A +SKF+YLN  LETLV++R  RSV++LAKHL+FYGDYHGNRSPI
Sbjct: 393 TTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPI 452

Query: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512
           ADP+MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI+E M  +GH+I+ IFMSGGQC
Sbjct: 453 ADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQC 512

Query: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRRKSSLT 572
           RN LLMRLLADCTGLPI+IPRY+DAAVVFGSALLGA ASE F+    K  + + +KSS T
Sbjct: 513 RNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTL-KGQKSSQT 571

Query: 573 NLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHXXXXXX-XXXXXXXXFPFPVVGESSE 631
             +  +   +S    + +L     +  + + +PH               +  P+  +   
Sbjct: 572 KTERFNDSYSS----IQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQPL 627

Query: 632 AITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDP 691
             T E +  +  ++        QE L      N    LW VM ++TG  ++V P+ +  P
Sbjct: 628 DKTSEESSKDASLT------VGQESLG-EGRYNGTSFLWKVMQELTGNARIVNPNEKTHP 680

Query: 692 DRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726
           DR+LL+ KY+IFLDM ++QR+YR  +DKVE + ++
Sbjct: 681 DRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/708 (56%), Positives = 492/708 (69%), Gaps = 22/708 (3%)

Query: 22  SMAAISLEQAMI-YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQE 80
           S++ I L+   + +YVGVDVGTGSARACIID +GN+LSLAEKPI+REEL+PN+ITQSS+E
Sbjct: 26  SLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSRE 85

Query: 81  IWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVL 139
           IW ++CHCVK+V+++S V  +R+HG+GFDATCSL                F  NDQNI+L
Sbjct: 86  IWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIIL 145

Query: 140 WMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADY 199
           WMDHRA+ ET EIN++ DKCLKYVGGQMSVEMEIPKIKWLKNNL  E F  CKFFDL DY
Sbjct: 146 WMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDY 205

Query: 200 LTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPAT 259
           LTFKAT K+ RSF S VCKQG +P GVEGS  GWS++FLNTI L EL+E+ F        
Sbjct: 206 LTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDF------EK 259

Query: 260 ATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVEL 319
              +     +FLSAGE +               +CVV SG+IDAYAGWVGTVAA+ +  +
Sbjct: 260 LGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPI 319

Query: 320 PDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEG 379
             LAE +      + A GRLAAVAGTSTCHI LS+DP+FV+G+WGPYRDV+A GFWAAEG
Sbjct: 320 RGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEG 379

Query: 380 GQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHL 439
           GQSCTG LL HV+  HPA+TELS L++AA +SKF+YLNS LET+V++R +RSV++LA+HL
Sbjct: 380 GQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHL 439

Query: 440 YFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAG 499
           +FYGDYHGNRSPIAD +MRA IIGQSMDNS++DLAI YL ACEFI+QQTRQIVE M  +G
Sbjct: 440 FFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSG 499

Query: 500 HQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHA 559
           H+I  IFMSGGQCRN LL RLLADC+GLPI+IPRYID AVVFGSALLGA ASE+F+    
Sbjct: 500 HKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDLAKG 559

Query: 560 KSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHXXXXXXXXXXXXX 619
           +  +T ++ SS      +S PS        Q   +  D+   Y  P+             
Sbjct: 560 RRTLTTKKSSSAQEFFINSYPSPQNSAMRHQ--NLASDVTCSYNLPNSISSA-------- 609

Query: 620 XFPFPVVGESSEAITEEANDSEGPVSFKPTRAT-SQEGLATRNPPNNGDALWDVMYQMTG 678
             P  +   SS    +   D     S K T  T +   L  +     G  LW VM ++TG
Sbjct: 610 --PDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTG-ILWKVMQELTG 666

Query: 679 GGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726
             K V P+    PDR+LL+ KY+IFLDMA++Q+RYR  +D +E++ +K
Sbjct: 667 DAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/707 (56%), Positives = 487/707 (68%), Gaps = 36/707 (5%)

Query: 29  EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHC 88
           E    +YVGVDVGTGS RACIID +GNILSLAEKPI+REEL  N+ITQSS+EIW ++C+C
Sbjct: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84

Query: 89  VKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIA 147
           V+ V++++GV   RIHGIGFDATCSL                F NNDQNI+LWMDHRA+ 
Sbjct: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144

Query: 148 ETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNK 207
           ET EIN + + CLKYVGGQMSVEMEIPKIKWLKNNL    F  CKFFDL DYLTF+AT K
Sbjct: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204

Query: 208 DTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTT 267
           + RSF S VCKQG +P GVEGS  GWSK FL++I L EL +N F           +    
Sbjct: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDF------EKLGGSLRNQ 258

Query: 268 HSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327
            +FLSAGE +               +CVV SG+IDAYAGWVGTVAA+ + E+  L E + 
Sbjct: 259 KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENED 318

Query: 328 TKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGAL 387
            K   + A GRLAAVAGTSTCHI LS+  +FV+G+WGPYRDV+A GFWAAEGGQSCTG L
Sbjct: 319 YKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVL 378

Query: 388 LAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHG 447
           L HV++THPAF++LS L+DAAN+SKF+YLNS LE LV++R +RSV+ LAKHL+FYGDY G
Sbjct: 379 LDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRG 438

Query: 448 NRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFM 507
           NRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  +GH I+ +FM
Sbjct: 439 NRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFM 498

Query: 508 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRR 567
           SGGQCRNGLLMRLLADCTGLPI+IPRYID AVVFGSALLGA AS+ F+ +  +  + + +
Sbjct: 499 SGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNK-RRRVIKSK 557

Query: 568 KSSLTN------LDPS--SLPSASGKGPLSQLGKMKPDLPSPYTAPHXXXXXXXXXXXXX 619
           KSSL        L PS  +LP  +    +    K+     S   AP              
Sbjct: 558 KSSLVQTEFLEGLYPSIQNLPLENHSTNVVASYKLA---CSNLNAPARTSSDL------- 607

Query: 620 XFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGG 679
              FP+  E    +   ++ S   +S    R   +E    R+   N   LW VM ++TG 
Sbjct: 608 ---FPISKEQPADMI--SDKSSKGISLDKGRENLEE---ERDIDKN--ILWKVMQELTGN 657

Query: 680 GKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726
            KV+ P+ +  PDR+LL+ KY+IFLDM ++QR YR  +DKVE+  ++
Sbjct: 658 AKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 401/536 (74%), Gaps = 11/536 (2%)

Query: 28  LEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICH 87
           +E+ + YY+GVDVGTGS RACIID+ G I S AE  I R+ELK + ITQSSQEIW+++C 
Sbjct: 1   MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF 60

Query: 88  CVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAI 146
           CVK VV + G   +++ GIGFDATCSL                F +++Q+I+LWMDHRA+
Sbjct: 61  CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL 120

Query: 147 AETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATN 206
            ET EIN+TND+CLKYVGGQMS+EME+PKIKWLK ++ K+ F +C+F+DLADYLTFKAT 
Sbjct: 121 KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG 180

Query: 207 KDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGT 266
           + TRSFCS VCKQG++P+GVEGSK GWSKDFL  I+L EL  N +   +   + + + G 
Sbjct: 181 RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYA--KLGGSVSGSHG- 237

Query: 267 THSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEAD 326
             +FL+AGEY+                C+VGSG+IDAYAGW+GTV + T V+L  L    
Sbjct: 238 -RNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQL---- 291

Query: 327 RTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGA 386
             + G+  A GRLAAVAGTSTCHI LS+DP+FV GVWGPY+D +  G+W  EGGQSCTGA
Sbjct: 292 -FRVGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGA 350

Query: 387 LLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYH 446
           LL HV+ THP++ EL  +S+   ++KFDYLN+RL  + ++  +RSV+ LAKH++FYGD H
Sbjct: 351 LLQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLH 410

Query: 447 GNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIF 506
           GNRSP+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E MCDAGH+IS I+
Sbjct: 411 GNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIY 470

Query: 507 MSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSE 562
           MSGGQCRN LLM+LLADC+GL +IIP YID+AVVFG+A+LGA AS+ +  + ++S+
Sbjct: 471 MSGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESD 526

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 41/58 (70%)

Query: 664 NNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721
           N  + LW  M +MT  G  + P P+D PDR+LL+AKYKIFLDMAD Q+RYR  +D VE
Sbjct: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/534 (58%), Positives = 388/534 (72%), Gaps = 17/534 (3%)

Query: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91
           M +Y+GVDVGTGS RAC+I++ G ILSL  K I +EELKPNYITQSS+EIWQ IC CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 92  VVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETN 150
           V+++S +    + GIGFDATCSL                F ++++NI+LWMDHRA+ ET+
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210
           EINAT DKCLKYVGG+MSVEME+PKIKWLKNNL    F  CKFFDL DYLT+KAT+KD R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHS- 269
           SF STVCKQGL+P+GVEGS  GWSK+F   I+L EL  + F         +A  G+ HS 
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNF---------SAIGGSIHSE 231

Query: 270 -----FLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAE 324
                  S GEYV             P  C+VGSG+IDAYAGWVGTVAA+ + E+  +  
Sbjct: 232 QLENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINN 290

Query: 325 ADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCT 384
            D     +D + G LA +AGTSTCHI LS  P+FVNG+WGPYRDV++H FW AEGGQSCT
Sbjct: 291 DDDASSKLDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCT 350

Query: 385 GALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGD 444
           GALL H+++THPA+ EL    +  ++  F++LN+RL  L ++   RS+++L KH + YGD
Sbjct: 351 GALLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGD 410

Query: 445 YHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQIST 504
           YHGNRSPI+D SMRAAIIGQSMD SID LAIMYL ACEFI+QQ+RQI+ ++  AGH I  
Sbjct: 411 YHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKK 470

Query: 505 IFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHH 558
           I+MSGGQ RN LLMRLLADCTGLP++IPRYIDA+V+FGSA+LGAVA +++N  H
Sbjct: 471 IYMSGGQARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH 524

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (77%)

Query: 664 NNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721
           ++G  LW+ M ++T  G V+ P+  + PDRVLLNAKYKIFLDMA++QR+YR  ID++E
Sbjct: 532 DHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/522 (58%), Positives = 383/522 (73%), Gaps = 14/522 (2%)

Query: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93
           +Y+GVDVGT S RAC++D  G ILSLA KPI R+E++PNY+TQSS EIW++IC C++ ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 94  RDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETNEI 152
            DS V  + I GIGFDATCSL                F + +Q+I+LWMDHRAI E NEI
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212
           N+T  +CLKYVGG+MS+EM+IPKIKWLKNNLP+ +FDKC+F+DL D+LT++AT    RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272
           CSTVCK GL+P+GV+GS +GW +D    I L EL     C+  +         T  +FLS
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAEL-----CRREFSKLGGVVSSTASNFLS 238

Query: 273 AGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332
           AG+YV                C+V SG+IDAYAGWVGT+AA   +   D  E++      
Sbjct: 239 AGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG-SDGQESEL----- 292

Query: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392
             A+ RLA VAGTSTCHI +S+ P F++GVWGPYRD +  G+W  EGGQSCTGALLAHV+
Sbjct: 293 --ASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVL 350

Query: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452
            +HPA+  L  L+    ISKFD++N+RLE L ++RG +SV AL KHL+FYGDYHGNRSPI
Sbjct: 351 KSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPI 410

Query: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512
           ADP+MRA IIGQSMD S+DDLAIM LGACEFIAQQTRQIVE +  +GH+I++I+MSGGQC
Sbjct: 411 ADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQC 470

Query: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESF 554
           RN +L++LLA+CT LPI++P+YIDAAVVFGSALLG  ASE +
Sbjct: 471 RNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%)

Query: 669 LWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAI 724
           LW VM  +TG G+++ PS   D +  LL+ KY+IFLDM ++Q+RYR+ + + E ++
Sbjct: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/524 (57%), Positives = 377/524 (71%), Gaps = 9/524 (1%)

Query: 33  IYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSV 92
            +++GVDVGTGS RAC+ID  G+IL+L +KPI REELKP +ITQSS+EIW SIC CV+ V
Sbjct: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78

Query: 93  VRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETNE 151
           + D+ +P  ++ GIGFDATCSL                F+ NDQNI++WMDHRA  ET+E
Sbjct: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138

Query: 152 INATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRS 211
           IN+  D  LKYVGG+MS+EME+PKIKWLKN++P+E F K  FFDL DYLTFKAT    RS
Sbjct: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198

Query: 212 FCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFL 271
            CS VCKQGL+PIGVEGS EGWS+ FL+   LPEL+EN F +   P         + +FL
Sbjct: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGN------NSRNFL 252

Query: 272 SAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKG 331
           SAGEYV                CVVGSG+IDAYAG +GT+AA+ D       + D   + 
Sbjct: 253 SAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQD 310

Query: 332 IDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHV 391
           +  A GRLAAVAGTSTCHI LS  P+FVNGVWGPY+D++A  +W AEGGQSCTG LL HV
Sbjct: 311 LQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHV 370

Query: 392 MSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSP 451
           ++THPA+ EL   +  + +  F+ LN  +  L +Q+G  +++ L K L+ YGDYHGNRSP
Sbjct: 371 ITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSP 430

Query: 452 IADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQ 511
           IADP MRA+IIGQSMD +++ LA++YL ACEFIA QTR I+ KM +AGH I +I+MSGGQ
Sbjct: 431 IADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQ 490

Query: 512 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFN 555
           CRN +LM LLAD TGLP++IP+YIDAAVVFG+AL+GA A + FN
Sbjct: 491 CRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 663 PNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAID 718
           P     LW+ M +MTG G  + P       + LLN KYKI++DMA +Q++YR  ID
Sbjct: 544 PQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/524 (57%), Positives = 378/524 (72%), Gaps = 8/524 (1%)

Query: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93
           YYVG+DVGTGS RAC++D+ GN+LSL EK I REELKPN+ITQS++EIWQ+ C CVK+ +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 94  RDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETNEI 152
               V    + GIGFDATCSL                F N D N++LWMDHRA+ E NEI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212
           NATNDKCLKYVGG MSVEM+IPKIKWLKNN+    F KC+FF+LADYLTFKAT K TRSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272
           CS VCKQG +P GVEGS EGWSK+FL++I L +L  N +            + +  +F S
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDS----LGGALKNDSQDNFQS 251

Query: 273 AGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332
           +G+ +               +CVVG+G+IDAYAG +GT+AA ++         + +  G+
Sbjct: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSE---GSHQIKNDSSIGL 308

Query: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392
             A GRLA+VAGTSTCH+ LS+DPVFV GVWGPYRDV+A G+W AEGGQ+CTG LL++V+
Sbjct: 309 QNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVL 368

Query: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452
           S HPAF EL + S  A I KF YLN+ L+ L  +    S + LAKH++FYGDY GNRSP 
Sbjct: 369 SIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPY 428

Query: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512
           ADP M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE +  AG  +S I+MSGGQC
Sbjct: 429 ADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQC 488

Query: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNS 556
           RN LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S  S
Sbjct: 489 RNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKS 532

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 41/56 (73%)

Query: 666 GDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721
           G  LW+ M +MT  G ++ P+  + PDR LL+ KY+IFLDMA++QR+YR+ +D ++
Sbjct: 540 GFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/529 (55%), Positives = 375/529 (70%), Gaps = 5/529 (0%)

Query: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R+ELKP YITQS+ +IW +IC C+++
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 92  VVRDSGVP--VERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAE 148
           ++++S V     +I GIGFDATCSL                F +NDQN++LWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 149 TNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKD 208
           T EIN+T+ KCLKYVGGQMSVEMEIPKIKWLKNN+    +  CKF DL D+LT+KAT   
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 209 TRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTH 268
            RSFCS VCKQGL+P+GVEGS +GW+++FL  I L +L+E+ F +   P    +      
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV-- 238

Query: 269 SFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRT 328
           SF +AGE++                C V SG+IDAYAGW+GT+AA T   +  L      
Sbjct: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298

Query: 329 KKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALL 388
             G+  ++GRLA VAGTSTCHI+L+  P+FV GVWGPYRDV+ H FW AEGGQSCTGALL
Sbjct: 299 LNGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALL 358

Query: 389 AHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGN 448
            HV+ THPA+ EL  +S   +IS F+ LN+++  L  QR     V L K+L+FYGD+HGN
Sbjct: 359 QHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGN 418

Query: 449 RSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMS 508
           RSP+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ M  +G+ + +++MS
Sbjct: 419 RSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMS 478

Query: 509 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSH 557
           GGQCRN LLM+L+++C GLP++IP+ ID AVVFGSAL+GA ASE   SH
Sbjct: 479 GGQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSH 527

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 4/52 (7%)

Query: 669 LWDVMYQMTGGGKVVRPSPEDDPDRV--LLNAKYKIFLDMADSQRRYREAID 718
           LWDVM +MTG G VV  SP+D   +V  LL  KY+I+LDM  +Q+RYR  ++
Sbjct: 538 LWDVMCKMTGQGIVV--SPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/523 (55%), Positives = 362/523 (69%), Gaps = 21/523 (4%)

Query: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93
           YY+GVDVGTGSARA ++ + G  L+L E PI+R+EL+ ++ITQSS EIW ++CHCV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 94  RDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETNEI 152
             SGV    + GIGFDATCSL                F ++ QNI+LWMDHRA  ET+ I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212
           NAT D+CLKYVGGQMSVEME+PKIKWLK ++P+ QF KCKFFDL DYLTF AT KD RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHS--- 269
           CS VCKQGL+P GV+GS+  WS +FL  + L EL++  F Q           GT+ S   
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQ---------LGGTSESKPK 236

Query: 270 FLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTK 329
           FL+AG+ V                C+V SGVIDAYAGW+G+V A+ D             
Sbjct: 237 FLTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKS 288

Query: 330 KGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLA 389
            G+D A  RLA +AGTSTCHI LS+ P FV GVWGPYRDV+  G+W AEGGQSCTGALLA
Sbjct: 289 SGLDVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLA 348

Query: 390 HVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNR 449
           H++ THPA  EL  L+    +S F+YL   L+TL+ +R  R+V+ L++  + YGD+HGNR
Sbjct: 349 HILETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNR 408

Query: 450 SPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSG 509
           SP+ADPSMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIVE M   GH +  ++MSG
Sbjct: 409 SPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSG 468

Query: 510 GQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552
           GQCRN LLM+L+AD  G+P+++P+Y D  VVFG+ALL   AS+
Sbjct: 469 GQCRNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 669 LWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAI 724
           LWD+M  MT  G  V P+ +   +R  ++AKY IFLDM + Q+ YR  +D+V ++I
Sbjct: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSI 579

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 378/548 (68%), Gaps = 18/548 (3%)

Query: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91
           M YY+GVDVG+GS RAC++D+ G +LS+A + I +EE  P ++TQSS EIW ++C+CVKS
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 92  VVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETN 150
            + +S V    I GIGFDATCSL                F NN+QNI++WMDHRAI ET 
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210
           EIN + D CLKYVGGQMSVEMEIPKIKWLKN++  E+F K  F DL DYLTF A+  +TR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270
           S+CS VCKQG +P GVEGS +GWS +FL  I L E+ ++ F        A      + +F
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNF-------NALGGPNESGNF 233

Query: 271 LSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330
             AG  +                C+VGSG+IDAYAGW+GTVA+ T +E+P+    ++   
Sbjct: 234 TYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVV 288

Query: 331 GIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAH 390
            I+   GRLAAVAGTSTCHI LS+  +FV GVWGPYRDV+   +W AEGGQS TGALLAH
Sbjct: 289 DIEECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAH 348

Query: 391 VMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRS 450
           ++S HP+  ELS+L    N+ KF +LN+ +  L ++    + + L K  + YGDYHGNRS
Sbjct: 349 ILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRS 408

Query: 451 PIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGG 510
           PIADP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ + +AGH I  I+MSGG
Sbjct: 409 PIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGG 468

Query: 511 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVA--SESFNSHHAKSEITRRRK 568
           QCRN +LM+L+A+CTGLP+IIP+YID+AVVFGSA+LGA+A  S   NS    +++     
Sbjct: 469 QCRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLW--- 525

Query: 569 SSLTNLDP 576
           S+++N+ P
Sbjct: 526 STMSNMTP 533

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 8/78 (10%)

Query: 642 GPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYK 701
           G +++  ++  S +G A        D LW  M  MT  G  V P+ ED  +R L+N K+K
Sbjct: 505 GAMAYSSSKNNSDKGGA--------DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHK 556

Query: 702 IFLDMADSQRRYREAIDK 719
           IFLDMA +Q+ YR+ ++ 
Sbjct: 557 IFLDMAKTQQTYRQLVEN 574

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/581 (50%), Positives = 380/581 (65%), Gaps = 32/581 (5%)

Query: 23  MAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIW 82
           M+A  ++Q   YYVGVDVGT  ARACIID +G IL+  + PI R + K ++ITQSS EIW
Sbjct: 1   MSAAEMKQ---YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIW 57

Query: 83  QSICHCVKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWM 141
            ++C  V++ V +S V V+ + GI FDATCSL                F++N QN++LWM
Sbjct: 58  GAVCKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWM 117

Query: 142 DHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLT 201
           DHRA+AE +EIN+T    L+YVGG+MSVEM++PKIKWL+ ++P+ +F KCKF+DL D+LT
Sbjct: 118 DHRAVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLT 177

Query: 202 FKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATAT 261
           ++AT  ++RSFCSTVCK GL+P GV+ S  GWS++FL  I L EL     C+D +     
Sbjct: 178 YQATGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEEL-----CEDGFRRLGG 232

Query: 262 AADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPD 321
           A D     F SAGE V                CVVGSGVIDAYAGWVGTV A  D     
Sbjct: 233 ALDEPGSEFRSAGEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPD----- 287

Query: 322 LAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQ 381
                R   G++   GRLAAVAGTSTC I LS+ P FV GVWGPYRDV+A G+W  EGGQ
Sbjct: 288 ---GARESGGVEELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQ 344

Query: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYF 441
           SCTGALLAH + THPA+TEL   +    ++ FDY+N RL+ L  + G RS+ ALAKH + 
Sbjct: 345 SCTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFL 404

Query: 442 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQ 501
           YGDYHGNRSP+ADPSMRAA++G SMD S DDLA+  L A EFIA Q R I++ M  AG  
Sbjct: 405 YGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLH 464

Query: 502 ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKS 561
           + T+++SGGQ RN LL +LLAD    P++ PR++ AAVVFGSALL A A E++ ++    
Sbjct: 465 VDTVYLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLAN---- 520

Query: 562 EITRRRKSSLTNLDPSS-LPSASGKGPLSQLGKMKPDLPSP 601
                     TN   SS LPS++ + P+ +L ++   L  P
Sbjct: 521 ----------TNATASSILPSSASRAPMHRLWQIMSRLTVP 551

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 658 ATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAI 717
           A+R P +    LW +M ++T  G VV PSP+ DPD  LL AKYK+FL+MA++Q+ YR+ +
Sbjct: 533 ASRAPMHR---LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLV 589

Query: 718 DKVEK 722
           D VE 
Sbjct: 590 DDVEN 594

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/522 (52%), Positives = 359/522 (68%), Gaps = 8/522 (1%)

Query: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91
           M  Y+GVDVGTGSARACI +  G IL++  K I ++EL+  +ITQSS EIW +I   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 92  VVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXX-XFANNDQNIVLWMDHRAIAETN 150
           V+  S V    I GI FDATCSL                F +++QNI+LWMDHRA +ET+
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210
            IN+TNDK LKYVGG+MSVE E+PKIKWLK++L  E F +C F DLAD+LT+KAT K   
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270
           SF S VCKQGL+P GVEGSK GWSK+FL  I L EL  N F  ++   +    +G   +F
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNF--EKLGGSINLKEG---NF 235

Query: 271 LSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330
           L  G+ V             P HCVVG+GVIDAY+GWVGTVA  +DV     +++ +   
Sbjct: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELN 293

Query: 331 GIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAH 390
            I+ + GR+A V+GTSTCHI LS+ P+F++GVWGPYRDV+A   WA EGGQS TGALL +
Sbjct: 294 KIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353

Query: 391 VMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRS 450
           ++ THPA+ EL  ++   N + F YL+ +LE L   R   SV  L K+++ YGDY+GNRS
Sbjct: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRS 413

Query: 451 PIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGG 510
           P+ADP M   IIGQ+MD+SI+DLAI YL ACEFIA QTR I++ +   GH I+ I+MSGG
Sbjct: 414 PLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGG 473

Query: 511 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552
            C+N LLM L+++C  LP+++ +YID++VVFG+A+LG+VA++
Sbjct: 474 HCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 667 DALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEK 722
           D LW  M  MT  G ++ P  E    R  L AKY+++LDM D+  +YR+ +++V K
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  187 bits (476), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 148/536 (27%), Positives = 246/536 (45%), Gaps = 88/536 (16%)

Query: 36  VGVDVGTGSARACIIDNTGNIL-SLAEKPIQREELKPNY--ITQSSQEIWQSICHCVKSV 92
           +G+D+G+ SAR  I D   ++L ++A++P+      P Y   ++ S + WQ     +K++
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPV------PYYHDSSKKSWKFWQKSTEIIKAL 62

Query: 93  ---VRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAET 149
               ++  +    +   G  ATCSL                  N+ N++ WMD  A+   
Sbjct: 63  QNCFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIPY--PNEDNVIFWMDSSAV--- 117

Query: 150 NEINATNDKC----LKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKAT 205
           +E    N+KC    L Y+GG+   EM IPK+K+  N     Q  +   FDL  Y+ ++  
Sbjct: 118 DECEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELG 177

Query: 206 NKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADG 265
                +      ++ +  IG +G   GWS  F N I             + P+  T    
Sbjct: 178 RLYRWNTDELSARENINGIGNDGEASGWSSSFYNDIM------------KLPSNVTIG-- 223

Query: 266 TTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEA 325
                      +                C      ID+YA W         V  P+L  +
Sbjct: 224 -----------LTGLNSNNSSSTTTVCSC------IDSYASWFA-------VSSPNLEAS 259

Query: 326 DRTKKGIDRATGRLAAVAGTSTCHIALSRDPVF---VNGVWGPYRDVM-AHGFWAA-EGG 380
                        L  +AGTSTC++  S  PV    + GVWGP+  ++  +G ++    G
Sbjct: 260 -------------LFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAG 304

Query: 381 QSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLY 440
           QSCTG L+ H+  +HPA  ++    +      ++ L + ++  ++++  +S+  LAKH++
Sbjct: 305 QSCTGKLIEHLFKSHPAARKIQRSGEDI----YEVLENSIQD-IEKKNRKSIHILAKHMF 359

Query: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM--CDA 498
           FYGDY GNR+P AD  MR + IG+S D SI +L   Y+   EF++ QT+ I++     ++
Sbjct: 360 FYGDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNS 419

Query: 499 GHQISTIFMSGGQCRNGLLMRLLADCT-GLPIIIP-RYIDAAVVFGSALLGAVASE 552
           G +I  + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 420 GARIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  185 bits (470), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 155/560 (27%), Positives = 253/560 (45%), Gaps = 84/560 (15%)

Query: 36  VGVDVGTGSARACIIDNTGN-ILSLAEKPIQREELKPNY--ITQSSQEIWQSICHCVKSV 92
           +G+DVG+ SAR  I +   + +L +A++P+      P Y   +++S + WQ     +K++
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPV------PYYQDSSRTSWKFWQRSTEIIKAL 87

Query: 93  ---VRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAET 149
              ++   +    +   G  ATCSL                  N+ N++ WMD  AI E 
Sbjct: 88  QKCLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPY--PNEDNVIFWMDSSAIDEC 145

Query: 150 NEINA-TNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKD 208
            ++NA  + + L ++GG    EM IPK+K+  N     Q  +   FDL  Y+ ++ ++  
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 209 TRSFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVENVFCQDRWPATATAADGTT 267
             +    + ++    +GV+G   GWS  F  N ++LP  V               ++G T
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENIMHLPSNV------------IIGSNGAT 253

Query: 268 HSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327
              +++   V                       ID+YA W         V  P L  +  
Sbjct: 254 CKKIASSAIV--------------------RSCIDSYASWFA-------VSSPHLETS-- 284

Query: 328 TKKGIDRATGRLAAVAGTSTCHI-ALSRDPVFVNGVWGPYRDVMAHG--FWAAEGGQSCT 384
                      L  +AGTSTC++       + + GVWGP+  ++     F     GQSCT
Sbjct: 285 -----------LFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCT 333

Query: 385 GALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGD 444
           G L+ H+  THP   E+  L   A+I  +  L   +  + +Q G +SV    K ++FYGD
Sbjct: 334 GKLIEHLFVTHPCAKEI--LKRGADI--YQVLERTIHDIEKQNG-QSVHVFTKDIFFYGD 388

Query: 445 YHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVE--KMCDAGHQI 502
           Y GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QTR I++  K  + G  I
Sbjct: 389 YEGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCI 448

Query: 503 STIFMSGGQCRNGLLMRLLADC-TGLPIIIPR-YIDAAVVFGSALLGAVASESFNSHHAK 560
             + +SG Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E        
Sbjct: 449 QELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEG----KQI 504

Query: 561 SEITRRRKSSLTNLDPSSLP 580
            ++ R R +S  N     LP
Sbjct: 505 IDVIRERDTSDDNEKFEPLP 524

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 693 RVLLNAKYKIFLDMADSQRRYREAIDKV 720
           R LL AKY+I LDMA  Q+RY + ID+V
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  176 bits (446), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 144/534 (26%), Positives = 241/534 (45%), Gaps = 84/534 (15%)

Query: 36  VGVDVGTGSARACIIDNTGN-ILSLAEKPI---QREELKPNYITQSSQEIWQSICHCVKS 91
           +G+DVG+ SAR  + +   + +L +A++P+   Q    K     Q S EI +++  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 92  VVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAETNE 151
           +     +    +   G  ATCSL                  N+ N++ WMD  A+ E   
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIPY--PNEDNVIFWMDSSAVNECQW 122

Query: 152 INATN-DKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210
           +N     + L Y+GG+   EM +PK+K+  +     +      FDL  Y+ ++ +     
Sbjct: 123 LNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYEW 182

Query: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVENVFCQDRWPATATAADGTTHS 269
           +    + ++ L  IG +G   GWS  F  N INLP               +  + GTT  
Sbjct: 183 NIEGLLGRENLNGIGNDGEVSGWSSSFYKNIINLP---------------SNVSIGTTS- 226

Query: 270 FLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTK 329
            L A +++                  V    ID+YA W    +       P L  +    
Sbjct: 227 -LVANKHIST---------------TVVRSCIDSYASWFAVAS-------PHLETS---- 259

Query: 330 KGIDRATGRLAAVAGTSTCH-----IALSRDPVFVNGVWGPYRDVMAH--GFWAAEGGQS 382
                    L  +AGTS+C+     I+ +R P    GVWGP+  ++ +   F     GQS
Sbjct: 260 ---------LFMIAGTSSCYMYGTTISDTRIP----GVWGPFDTILDNRGDFSVYAAGQS 306

Query: 383 CTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFY 442
           CTG L+ H+  +HP   ++  L D A+I  +  L   +  + +  G  S+  L K ++FY
Sbjct: 307 CTGKLIEHLFESHPCARKI--LKDGADI--YQVLEQTIRDIEKNNG-LSIHILTKDMFFY 361

Query: 443 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGH-- 500
           GDY GNR+P ADP ++ + IG+S D S+ +L   Y+   EF++ QT+ I++   +     
Sbjct: 362 GDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNI 421

Query: 501 QISTIFMSGGQCRNGLLMRLLADC-TGLPIIIPRY-IDAAVVFGSALLGAVASE 552
            I  + +SG Q +N  L+ L++    G+ II P+  +D   + G+ +L   A E
Sbjct: 422 HIKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKE 475

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 693 RVLLNAKYKIFLDMADSQRRYREAIDKV 720
           R LL  KY I LDMA  Q+RY + +D+V
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  175 bits (443), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 147/534 (27%), Positives = 236/534 (44%), Gaps = 84/534 (15%)

Query: 36  VGVDVGTGSARACIIDNTGN-ILSLAEKPIQREELKPNY--ITQSSQEIWQS---ICHCV 89
           +G+D+G+ SAR  I     + +L +A++P+      P Y   T+ S + WQ    I   +
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPV------PYYQDFTKKSWKFWQKSTEIIEAL 62

Query: 90  KSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAET 149
           +   +   +    +   G  ATCSL                  N+ N++ WMD  A  E 
Sbjct: 63  QKCFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALIPY--PNENNVIFWMDSSATDEC 120

Query: 150 NEINATNDK-CLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKD 208
             +NA   K  L Y+GG+   EM IPK+K+  N     Q  +   FDL  Y+ ++     
Sbjct: 121 EWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLY 180

Query: 209 TRSFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVENVFCQDRWPATATAADGTT 267
             +    +  + +  IG +G   GWS  F  N +N+P    NV      P    +     
Sbjct: 181 QWNIDGLLRGENINGIGNDGEASGWSSSFYKNIMNIPS---NVIIG---PVGLVSKK--- 231

Query: 268 HSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327
                                   +   V    ID+YA W         V  P L  +  
Sbjct: 232 -----------------------VISTTVVRSCIDSYASWFA-------VSPPFLERS-- 259

Query: 328 TKKGIDRATGRLAAVAGTSTCHIALSRDPVF---VNGVWGPYRDVM--AHGFWAAEGGQS 382
                      L  +AGTS+C++  +  PV    + GVWGP+ +++     F     GQS
Sbjct: 260 -----------LFMIAGTSSCYMYGT--PVSNTKIPGVWGPFNNILDDKGDFSVYAAGQS 306

Query: 383 CTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFY 442
           CTG L+ H+  +HP   ++  L   A+I  +  L   +  + +++G  S+  LAK ++FY
Sbjct: 307 CTGKLIEHLFESHPCARKI--LKSGADI--YQVLEQTIHGIEKKKG-LSIHILAKDMFFY 361

Query: 443 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCD--AGH 500
           GDY GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QT+ I++      A  
Sbjct: 362 GDYEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACI 421

Query: 501 QISTIFMSGGQCRNGLLMRLLADC-TGLPIIIPR-YIDAAVVFGSALLGAVASE 552
           +I  + +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E
Sbjct: 422 RIQELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANE 475

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  163 bits (413), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 144/532 (27%), Positives = 227/532 (42%), Gaps = 79/532 (14%)

Query: 36  VGVDVGTGSARACIID-NTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVR 94
           +G+D+G+ + R  I D  T  ++ +  KP+       N +TQSS +I  +I  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 95  DSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQ---NIVLWMDHRAIAETNE 151
           D    ++ +   G  ATCSL                    +   N+V WMD  A  E   
Sbjct: 71  D----LKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 152 INATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRS 211
           +N T  +  +++GG    EM IPK+  +    P+ +  K + FDL  Y+ ++   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGWD 185

Query: 212 FCSTVCKQGLIPIGVEGSKEGWSKDFLN-TINLPELVENVFCQDRWPATATAADGTTHSF 270
               + K     IG +G  +GW   F N  + LP               A    G  H+ 
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFYNDVLKLP---------------ANVKIGPIHAL 230

Query: 271 LSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330
                               PV     +  ID Y+ W    ++  +              
Sbjct: 231 ----------------NTESPVRV---ASCIDCYSNWFSMCSSSPN-------------- 257

Query: 331 GIDRATGRLAAVAGTSTCHI-ALSRDPVFVNGVWGPYRDVM----AHGFWAAEGGQSCTG 385
                   L   AGTSTC++ A + +   + GVWGP+ +++    A  +   E GQS TG
Sbjct: 258 ------NSLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTG 311

Query: 386 ALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDY 445
            L+ H+  THPA    S   D + +  F  + S +E L Q  G+ SV   +KH++ YG+ 
Sbjct: 312 KLIEHLFETHPAARAYS--MDKSKL--FSAIESAIEKLEQDFGE-SVHFRSKHMFTYGEL 366

Query: 446 HGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTI 505
            GNR+P  D SM    IG++ D S  DL + Y+   EF+A Q + I E  C    +I  I
Sbjct: 367 QGNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKE--CFKA-EIKDI 423

Query: 506 FMSGGQCRNGLLMRLLADCTG-LPIIIP-RYIDAAVVFGSALLGAVASESFN 555
            ++G Q +N  L+ L +     + + IP +  D   V G+ LLG  A ++ N
Sbjct: 424 RIAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNIN 475

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 693 RVLLNAKYKIFLDMADSQRRYREAIDKV 720
           + LL AKYKI+LDMA +Q RYR  +D V
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 150/540 (27%), Positives = 227/540 (42%), Gaps = 93/540 (17%)

Query: 36  VGVDVGTGSARACIID-NTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVR 94
           +G+D+G+   R    +  T   +++  + +   E +    TQSS EI ++I  C +S+  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 95  DSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFAN-----NDQNIVLWMDHRAIAET 149
              + +  +   G  ATCSL                       NDQN+V WMD  AI E 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 150 NEIN--ATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNK 207
           + IN  A N+K   Y GG    EM +PK+     +  K   D  + FDL  Y+ +   N+
Sbjct: 124 SNINDLAINEKA--YFGGSFIPEMGVPKLASFLKSCSKNNSD-FEVFDLHTYVAYDLANR 180

Query: 208 DTRSFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVE-NVFCQDRWPATATAADG 265
                   + +     IG +G  +GW  +F   T+ LP  V     C +R          
Sbjct: 181 YGWDASFLINRPNHNGIGHDGEIKGWKDEFYEKTLKLPPNVRIGPLCINR---------- 230

Query: 266 TTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEA 325
                                    PV     +  ID Y+ W    ++      P+ +  
Sbjct: 231 ----------------------RFSPVKV---ASCIDCYSSWFSMFSST-----PERS-- 258

Query: 326 DRTKKGIDRATGRLAAVAGTSTCHIALSRDPV-FVNGVWGPYRDVMAHG---FWAA-EGG 380
                        L   AGTSTC++  +  P   + G+WGP+ D++       W+  E G
Sbjct: 259 -------------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAG 305

Query: 381 QSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLET---LVQQRGDRSVVALAK 437
           QS TG L+ H+  +HPA     +L D       + L +RLET   L++Q+   SV    K
Sbjct: 306 QSTTGKLIEHLFESHPAAK--PYLEDR------NVLFNRLETEINLIEQQSAESVHFKTK 357

Query: 438 HLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCD 497
           H++ YG+  GNR+P  DP M    IG+S D S  DL + Y+   EF+A Q R I E +  
Sbjct: 358 HMFNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL-- 415

Query: 498 AGHQISTIFMSGGQCRNGLLMRLLADCT-GLPIIIP-RYIDAAVVFGSALLGAVASESFN 555
            G  I+ I ++G Q +N  L+ L++    G  + IP    D   V G+ LLG       N
Sbjct: 416 -GAPINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLGLN 474

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 688 EDDPDRVLLNAKYKIFLDMADSQRRYREAID 718
           E++  R L   KYKI+L+MA +QR+YRE ++
Sbjct: 500 EENKLRALFEIKYKIYLNMAQTQRQYREMVN 530

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  162 bits (411), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 137/538 (25%), Positives = 237/538 (44%), Gaps = 89/538 (16%)

Query: 36  VGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQ------SICHCV 89
           +G+D+G+ S R  +     +++      +Q  + K +Y       +W+       I   +
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM------VQCVKQKISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 90  KSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFA-NNDQNIVLWMDHRAIAE 148
           +  + D  +    I   G  ATCS+                + ++ QN++ WMD+ +  E
Sbjct: 60  ERCLHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTE 119

Query: 149 TNEINATNDKCLK-YVGGQMSVEMEIPKIKWLKNNLPKE---QFDKCKFFDLADYLTFKA 204
              +N   +K L+ ++GG+   EM IPKI  L N L      Q       DL  YL ++ 
Sbjct: 120 CKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEI 179

Query: 205 TNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDF-LNTINLPELVENVFCQDRWPATATAA 263
             +   +F   +       IG +G   GWS  F ++T+ +P               +   
Sbjct: 180 AKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIP---------------SNIT 224

Query: 264 DGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLA 323
            G         EY                   + +  ID Y+ W+   +       P   
Sbjct: 225 IGPEPPLEDDFEYCKG----------------IVASCIDCYSSWLSLCS-------PTPE 261

Query: 324 EADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVM--AHGFWAAEGGQ 381
           E+             L  V GTSTC++  +     + GVWGP+ D++  ++ +   EGGQ
Sbjct: 262 ES-------------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQ 308

Query: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDY--LNSRLE---TLVQQRGDRSVVALA 436
           SCTG L+ H++ THPA         +++I+K D+  L  ++E   + ++++  RS+    
Sbjct: 309 SCTGKLIEHLLQTHPA---------SSSIAKDDWPLLLEKIEQEISAIEEQTGRSIHFKT 359

Query: 437 KHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMC 496
           KH++FYGD+ GNR+P ADP M    IG++ D S ++L + Y+   EF+A Q + ++    
Sbjct: 360 KHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFN 419

Query: 497 DAGHQ--ISTIFMSGGQCRNGLLMRLLADC-TGLPIIIPRY-IDAAVVFGSALLGAVA 550
            A  Q  I+ I + G Q +N  L+ L++    G  I +P+  ++ + V G+ LLG  A
Sbjct: 420 KAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA 477

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 685 PSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKV 720
           PS  + P  +LL AKY+I LDMA  Q  YRE I+K+
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  160 bits (404), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 147/529 (27%), Positives = 227/529 (42%), Gaps = 83/529 (15%)

Query: 36  VGVDVGTGSARACIID-NTGNILSLAEKPIQREEL-KPNYITQSSQEIWQSICHCVKSV- 92
           VGVD+G+ S R  I      ++L + E+P++          TQS+ EI  ++  C+  + 
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDELG 72

Query: 93  VRDSGVPVERIHGIGFDATCSLXXXXXXXXXXX-----XXXXFANNDQNIVLWMDHRAIA 147
           +R  G     I   G  ATCS+                      ++D+N+V WMD  A  
Sbjct: 73  LRPGG---RSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASE 129

Query: 148 ETNEINATNDKCLKY-VGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATN 206
             + ++      +K  + G    EM +PK+  L    P    +    FDL  Y+ +    
Sbjct: 130 ACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYDLAR 186

Query: 207 KDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVENVFCQDRWPATATAADG 265
           +      +   +     IG +G   GW ++F  N + LP               AT A G
Sbjct: 187 RYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNVLKLP---------------ATVAVG 231

Query: 266 TTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEA 325
              +F   G+ V                    +  ID YA W G  + Q +  L      
Sbjct: 232 PASTF--KGQRVGV------------------ASCIDCYASWFGVCSTQPEQSL------ 265

Query: 326 DRTKKGIDRATGRLAAVAGTSTCHI-ALSRDPVFVNGVWGPYRDVM--AHGFWAA-EGGQ 381
                           VAGTSTC++ A +     + G+WGP+ +++      W+  E GQ
Sbjct: 266 --------------FLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQ 311

Query: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYF 441
           S TG LL H+  THPA  +  +  D   +  F  L  R+  +    G  S+  LA+H++ 
Sbjct: 312 STTGRLLEHLFETHPAARD--YAGDTGRL--FKDLEDRIADMEADSGC-SIHHLARHMFL 366

Query: 442 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM-CDAGH 500
           YG+  GNR+P ADP M    +G++ D S  +LA+ Y+   EF+A QTRQIVE     A  
Sbjct: 367 YGELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAA 426

Query: 501 QISTIFMSGGQCRNGLLMRLLADCTG-LPIIIP-RYIDAAVVFGSALLG 547
            I  + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 427 AIGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 19/28 (67%)

Query: 693 RVLLNAKYKIFLDMADSQRRYREAIDKV 720
           R LL AKY I LDMA  Q+RYR  ID V
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  153 bits (387), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 150/534 (28%), Positives = 220/534 (41%), Gaps = 83/534 (15%)

Query: 36  VGVDVGTGSARACIIDNTGNILSLAEK----PIQREELKPNY-ITQSSQEIWQSICHCVK 90
           +G+D+G+ S R  +  N  N   +A K    P        N+  TQSS+EI  +I  C +
Sbjct: 10  IGIDLGSSSVRVSLF-NFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQ 68

Query: 91  SVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAETN 150
            +  D       I   G  ATCSL                 + D+N+V WMD  AI ET 
Sbjct: 69  ELNIDK----HEIKSCGVGATCSLAIFQTKDNALIPWN-LDDPDKNVVFWMDSIAIKETQ 123

Query: 151 EINA-TNDKCLKYVGGQMSVEMEIPKIKW----LKNNLPKEQFDKCKFFDLADYLTFKAT 205
           E+N     +   ++GG    EM +PK++     LKN      F+     DL  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 206 NKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFL-NTINLPELVENVFCQDRWPATATAAD 264
            ++   + +      L  IG +G   GWS  F  N + LP            P       
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENVLQLP------------PNIVIGP- 227

Query: 265 GTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAE 324
            T HS  S+ + +                    S  ID Y+ W   + +           
Sbjct: 228 -TKHSQHSSKQGLKV------------------SSCIDCYSNWFALLPSNLQ-------- 260

Query: 325 ADRTKKGIDRATGRLAAVAGTSTCHI-ALSRDPVFVNGVWGPYRDVM--AHGFWAAEGGQ 381
                         L  V GTSTC++ A S     + GVWGP+ ++   +  F   E GQ
Sbjct: 261 ------------NSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQ 308

Query: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYF 441
           SCTG L+ H+  THPA    SH+        F  +N  +E  V+Q    S+    KH++F
Sbjct: 309 SCTGKLIEHLFKTHPA---SSHIDTRDWPHLFSQINDFIEK-VEQNTQDSIHMQTKHMFF 364

Query: 442 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQI--VEKMCDAG 499
           YGD  GNR+P ADPSM    IG++ D S  +L   Y+   EFIA Q + +  +    +  
Sbjct: 365 YGDLDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGD 424

Query: 500 HQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVV--FGSALLGAVAS 551
             IS +   G   +N  L+ LLA       I    +D A++  +GS L+G  ++
Sbjct: 425 EDISNLQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKAST 478

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 684 RPSPEDDPDRV-LLNAKYKIFLDMADSQRRYREAIDKV 720
           RP  + D   V LL  KY+I+ +MA+ QR+YR+ ++ V
Sbjct: 495 RPPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  150 bits (379), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 146/536 (27%), Positives = 230/536 (42%), Gaps = 99/536 (18%)

Query: 36  VGVDVGTGSARACIID-NTGNILSLAEKPIQREELKPNYITQSSQEIWQ------SICHC 88
           +G+D+G+ S R  I   +  ++L +  KP+      P Y   +   +W+       I   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 89  VKSVVRDSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANNDQNIVLWMDHRAIAE 148
           +K     + +    +   G  ATCSL                  + +N+V WMD  A  E
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQHC--EGDSRNVVFWMDSMAKEE 119

Query: 149 TNEINATNDKC----LKYVGGQMSVEMEIPKI-KWLKN--NLPKEQFDKCKFFDLADYLT 201
           TN +NA   +C    L ++GG    EM IPK+ ++LK+  + PK    + + FDL  Y+ 
Sbjct: 120 TNSLNA---RCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNI-QWEVFDLHKYVA 175

Query: 202 FKATNKDTRSFCSTVCKQGLIP----IGVEGSKEGWSKDFLNTI-NLPELVENVFCQDRW 256
           +K      + +C    +    P    IG +G   GWSK F + I  LP  V  + C    
Sbjct: 176 YKLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKIVRLPPNV-TIGC---- 226

Query: 257 PATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTD 316
           P T    D                              V+    ID Y+ W   +     
Sbjct: 227 PKTIENEDSL----------------------------VIVDSCIDCYSSWFSPL----- 253

Query: 317 VELPDLAEADRTKKGIDRATGRLAAVAGTSTCHI---ALSRDPVFVNGVWGPYRDVMAHG 373
                        + +++ T  L  VAGTSTC+I      +    V G+WGP+ D++   
Sbjct: 254 -------------QSLNKNT--LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGAN 298

Query: 374 FWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVV 433
               E G SC+G L+ H+ ++HP+   L +LS    ISK +   +  ET    +   S+ 
Sbjct: 299 KVVYESGSSCSGKLIEHLFTSHPSAISL-NLSTGQLISKLEEEINIWET----QNATSIH 353

Query: 434 ALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVE 493
             A + + YGD  GNR+P  DP MR   IG+S D S  DL + Y+   E +A QT+ +V+
Sbjct: 354 FEACNNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVD 413

Query: 494 KMCDAGHQISTIFMSGGQCRNGLLMRL--LADCTGLPIIIPRYIDAAVVFGSALLG 547
              +  + I+ +F+ G Q +N  L++L  L +   L ++     D   V G+ LLG
Sbjct: 414 NF-EKLNSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  114 bits (284), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 115/500 (23%), Positives = 205/500 (41%), Gaps = 84/500 (16%)

Query: 36  VGVDVGTGSARACIIDN-TGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVR 94
           +GVD+G+   R  I D  T +++   ++ +         ITQ + +I  ++     ++  
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGIITQCTSDILTAVEKAFNTLY- 64

Query: 95  DSGVPVERIHGIGFDATCSLXXXXXXXXXXXXXXXFANND---QNIVLWMDHRAIAETNE 151
              +    I  +G  ATCS+                 + +    +I+ WM   AI ET  
Sbjct: 65  ---IQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEETEY 121

Query: 152 IN-ATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210
           +N  T++  L + GG+   EM IPK+  L N L K+  D     DL  +L +K + K   
Sbjct: 122 LNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKD--DGLTVLDLHIWLLWKISLKLGH 178

Query: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270
                V +     IG +G   GWSK+F   + L ++                       F
Sbjct: 179 KELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI-----------------------F 215

Query: 271 LSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330
           +     +                   G   ID YA W    +          A  +RT  
Sbjct: 216 IGNNAVIKKNEQ-------------FGDSCIDCYASWFQCWST---------AMLNRT-- 251

Query: 331 GIDRATGRLAAVAGTSTCHIALSR-DPVFVNGVWGPYRDVMAH--------GFWAAEGGQ 381
                   L  VAGTSTC +  S     F+ G+WGP++D++ +         +   E G 
Sbjct: 252 --------LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGI 303

Query: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYF 441
           S TG LL  ++STHPA  +       ++++  + +  +++ L++Q   +S+  + K+ +F
Sbjct: 304 SRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFF 355

Query: 442 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQ 501
           + DY    S         +I+ +  + ++ DLA+ Y+   E +A Q   ++    +    
Sbjct: 356 HEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHIT 415

Query: 502 ISTIFMSGGQCRNGLLMRLL 521
           IS + ++G Q +N  L+++L
Sbjct: 416 ISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 122/543 (22%), Positives = 194/543 (35%), Gaps = 117/543 (21%)

Query: 36  VGVDVGTGSARACIID-NTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVR 94
           +G+DVG+ S R  I +   G  +    K I +E L   Y  +   ++W    +    V+R
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEML---YKHEPDSKLWHYTQNAF--VMR 55

Query: 95  DS-GVPVERIHG-------IGFDATCSLXXXXXXXXX-----XXXXXXFANNDQNIVLWM 141
           DS    +E +H         G  ATCS+                      NN  +I+ W 
Sbjct: 56  DSIFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWK 115

Query: 142 DHRAIAETNEIN-----------ATNDKCLKYVGGQMSV--EMEIPKIKWLKNNLPKEQF 188
           DH A  E   +N              +K L  +G +     EM IPK+  L  NL KE F
Sbjct: 116 DHTAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLI-NLIKEGF 174

Query: 189 DK----CKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLP 244
            +     + +DL  Y+      K   +      K  +  IG++G  +GW   F     LP
Sbjct: 175 YETPHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY-VWALP 233

Query: 245 ELVENVFCQDRWPATATAADGTTHSFLSAGEYVXXXXXXXXXXXXXPVHCVVGSGVIDAY 304
           E          +P     +     +                     P  C      ID Y
Sbjct: 234 E--------TSFPICIGPSKVINET-----------------SIVRPKSC------IDCY 262

Query: 305 AGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTSTCHI-ALSRDPVFVNG-- 361
           A W  T A   D                      L   AGTSTC + A+ R  +   G  
Sbjct: 263 ASWFSTDACTKD--------------------DTLFMAAGTSTCCLYAMPRSALEYFGEQ 302

Query: 362 ------VWGPYRDVMAHGFWAA-EGGQSCTGALLAHVMSTHPAFTELSHLSDAANISKFD 414
                  WGP+ +V+     ++ E G S TG LL  + + H      S ++++ N     
Sbjct: 303 QQPLSLFWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKHQITASWS-VAESIN----- 356

Query: 415 YLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIA--DPSMRAAIIGQSMDNSIDD 472
           Y+ +++   + +R     + L   +Y +  Y     P     P          + +S   
Sbjct: 357 YVENQIA--IYERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLG 414

Query: 473 LAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLA---DCTGLPI 529
           L   Y+   E++A Q   ++ +       I+ + +SG Q +N  L+ L+    D T + I
Sbjct: 415 LIFKYIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLILFMHDGT-IDI 473

Query: 530 IIP 532
           I+P
Sbjct: 474 IVP 476

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 13/118 (11%)

Query: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM----C 496
           F   ++G  +P  DP  RA I+G S   +   +A     A E +  Q R I++ M     
Sbjct: 612 FVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGDKI 668

Query: 497 DAGHQ---ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVAS 551
           + G++   + T+ + GG  ++  +M++ AD  G  I + R   + +V  +AL  A+A+
Sbjct: 669 EDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR---SPIVECTALGAAIAA 723

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM----- 495
           F   ++G  +P  DP  RA I+G S   +   +A     A E +  Q R I++ M     
Sbjct: 505 FVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGSDEV 561

Query: 496 -CDAGHQ---ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVAS 551
             D+ ++   ++T+ + GG  ++  +M++ AD  G  I + R   + +V  +AL  A+A+
Sbjct: 562 YGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR---SPIVECTALGAAIAA 618

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 396 PAFTELSHLSDAANISKFDYLNSRLETLVQQRGD----RSVVALAKHLYFYGDYH 446
           P   +L  + +A +I  F+YLN  + T V   GD     S++ L KH Y+ G+YH
Sbjct: 382 PFVKDLIRIKEAISILSFEYLNLTMHTPV---GDLDFFESLLILIKHQYWIGEYH 433

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 52/119 (43%), Gaps = 16/119 (13%)

Query: 431 SVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDL-------------AIMY 477
           S V  +  + F   + G  +P  DP  RA I+G S   +   +             AI+ 
Sbjct: 448 SAVPNSGGVVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIARAAVEGVCFQARAILK 507

Query: 478 LGACEFIAQQTRQIVEKMCDAGHQ---ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPR 533
             + +    + +  +E++ D  ++   +ST+ + GG  R+  +M++ AD  G  + + R
Sbjct: 508 AMSSDAFGSEDKDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRR 566

>KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {ON}
           Anc_6.159 YGL100W
          Length = 355

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%)

Query: 6   QSRSSLSIAQQRFMSQSMAAISLEQAMIYYVGVD 39
           QS  SLS    RF +Q +A   LEQA+IY  G D
Sbjct: 166 QSDFSLSWCPSRFSTQKIAVCVLEQALIYQKGKD 199

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGH 500
           F   + G  +P  DP+ RA+I+G S   +   +A     A E +  Q R I++ M     
Sbjct: 468 FVPAFSGLFAPYWDPNARASIMGMSQYTTAAHIA---RAAVEGVCFQARAILKAMSSDVL 524

Query: 501 Q-------------ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPR 533
           Q             +ST+ + GG  R+  +M++ A+  G  + + R
Sbjct: 525 QESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILGPCVKVRR 570

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 18/111 (16%)

Query: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIA--------------- 485
           F   + G  +P  DP  RA I+G S   +   +A   +    F A               
Sbjct: 474 FVPAFSGLFAPYWDPDARATIMGMSQYTTASHIARAAVEGVCFQARAILKAMSSDAFGEG 533

Query: 486 QQTRQIVEKMCDAGHQ---ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPR 533
           ++ R  +E++ D  ++   +ST+ + GG  R+  +M++ AD  G  I + R
Sbjct: 534 EKDRDFLEEIEDETYERTALSTLAVDGGMSRSDEVMQIQADILGPCIKVRR 584

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,249,199
Number of extensions: 2775870
Number of successful extensions: 6768
Number of sequences better than 10.0: 41
Number of HSP's gapped: 6817
Number of HSP's successfully gapped: 70
Length of query: 726
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 609
Effective length of database: 40,065,477
Effective search space: 24399875493
Effective search space used: 24399875493
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)