Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038308.256ON1195119557750.0
ZYRO0C01804g8.256ON1209121224700.0
Smik_12.1438.256ON1220121923550.0
Suva_10.1688.256ON1220120823490.0
Skud_12.1528.256ON1220120623480.0
NCAS0B049808.256ON1204119422730.0
YLR084C (RAX2)8.256ON1220120922710.0
NDAI0B023808.256ON1219122122600.0
Kpol_392.108.256ON1226121722540.0
SAKL0H17204g8.256ON1211122221950.0
TPHA0B032508.256ON1215122120190.0
KAFR0B026908.256ON1210120419900.0
TBLA0E043908.256ON1278127718620.0
KNAG0G020008.256ON1202122917120.0
KLLA0F18975g8.256ON1200122516810.0
Kwal_56.235898.256ON1213122116720.0
KLTH0G13838g8.256ON1214120916710.0
CAGL0L12144g8.256ON1156117615070.0
AGR095W8.256ON1201122515040.0
Ecym_43158.256ON1212123514710.0
TPHA0M020606.369ON53655820.61
TDEL0A057708.631ON43379781.5
AFL206C5.393ON648201754.5
NDAI0C039205.285ON86252737.6
NCAS0A116403.459ON40151728.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03830
         (1195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...  2229   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   956   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   911   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   909   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   909   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   880   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   879   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   875   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   872   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   850   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   782   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   771   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   721   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   664   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   652   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   648   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   648   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   585   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   583   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   571   0.0  
TPHA0M02060 Chr13 (423979..425589) [1611 bp, 536 aa] {ON} Anc_6....    36   0.61 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   1.5  
AFL206C Chr6 complement(46599..48545) [1947 bp, 648 aa] {ON} Syn...    33   4.5  
NDAI0C03920 Chr3 (890187..892775) [2589 bp, 862 aa] {ON} Anc_5.285     33   7.6  
NCAS0A11640 Chr1 (2315022..2316227) [1206 bp, 401 aa] {ON} Anc_3...    32   8.5  

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score = 2229 bits (5775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1110/1195 (92%), Positives = 1110/1195 (92%)

Query: 1    MYGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGEALQLFGGFNALTFPQYEG 60
            MYGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGEALQLFGGFNALTFPQYEG
Sbjct: 1    MYGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGEALQLFGGFNALTFPQYEG 60

Query: 61   QENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXX 120
            QENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVP                  
Sbjct: 61   QENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYE 120

Query: 121  XXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXX 180
              RQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATW    
Sbjct: 121  LGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSS 180

Query: 181  XXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEI 240
                  PFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEI
Sbjct: 181  NTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEI 240

Query: 241  NELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYN 300
            NELLPLRAATWNT         AFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYN
Sbjct: 241  NELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYN 300

Query: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQ 360
            SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQ
Sbjct: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQ 360

Query: 361  VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYAN 420
            VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYAN
Sbjct: 361  VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYAN 420

Query: 421  NSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQY 480
            NSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQY
Sbjct: 421  NSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQY 480

Query: 481  TMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAP 540
            TMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAP
Sbjct: 481  TMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAP 540

Query: 541  VLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLSNFTNSTD 600
            VLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLSNFTNSTD
Sbjct: 541  VLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLSNFTNSTD 600

Query: 601  SKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTAKYA 660
            SKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLW           ELDEDLHVSSTAKYA
Sbjct: 601  SKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAKYA 660

Query: 661  TGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDEL 720
            TGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDEL
Sbjct: 661  TGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDEL 720

Query: 721  LVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS 780
            LVFNNEYVF            TFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS
Sbjct: 721  LVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS 780

Query: 781  NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYS 840
            NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYS
Sbjct: 781  NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYS 840

Query: 841  KNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYH 900
            KNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYH
Sbjct: 841  KNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYH 900

Query: 901  ISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLS 960
            ISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLS
Sbjct: 901  ISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLS 960

Query: 961  FNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVD 1020
            FNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVD
Sbjct: 961  FNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVD 1020

Query: 1021 VIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYPQASIYNFQRWLPYYVANKADDEDPSR 1080
            VIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYPQASIYNFQRWLPYYVANKADDEDPSR
Sbjct: 1021 VIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYPQASIYNFQRWLPYYVANKADDEDPSR 1080

Query: 1081 TTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLVRKSGKINRGFVVL 1140
            TTFFTNQDDSQLYDSQNLL                       KGSLVRKSGKINRGFVVL
Sbjct: 1081 TTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVL 1140

Query: 1141 IGLALALGTVVIIGITGVLLALVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL 1195
            IGLALALGTVVIIGITGVLLALVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL
Sbjct: 1141 IGLALALGTVVIIGITGVLLALVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL 1195

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1212 (42%), Positives = 741/1212 (61%), Gaps = 23/1212 (1%)

Query: 4    LLFLLFQSVCLSLA----SQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFP 56
            +LF    S    LA    SQL +L+      NI  P+LD      +AL+L G F  LTF 
Sbjct: 1    MLFFALLSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFY 60

Query: 57   QYEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXX 116
            +Y GQENFT  +N++TDS G++YYSNDTF++L NGS+D+ +++IVP              
Sbjct: 61   KYTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHI 120

Query: 117  XXXXXXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATW 176
                  RQL YNL+DLS +PIF+  LT+V  IL D P+ YFGGNF+F NGS  GHSV  W
Sbjct: 121  DGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLW 180

Query: 177  XXXXXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLL----ITNENTSKT 232
                      PF GFG+ S VNSII+LD DNILF G FY LDD  LL    + + N+S  
Sbjct: 181  NSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSK 240

Query: 233  NHSQSIEINELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESY 292
            ++   +E+   +PL+ A W T          FICP+ ++E+W    TSGSL  SLP E+ 
Sbjct: 241  SNWTDVELGLAIPLQNANW-TSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETT 299

Query: 293  PKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAA 352
            P K+RIYNSP E N VSLFRI+ +P+ GI+NL+YVDP  GEL  CDAFCPL  +  L+ A
Sbjct: 300  PYKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEA 359

Query: 353  VANGNTSQVVRL--DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQL 410
             +N ++ + +    DNN TDI+W  D+Q+FAFVN + ++ ++F+ALSSYG  VGLSS+Q 
Sbjct: 360  SSNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQF 419

Query: 411  YQDTLTTYANNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTF 470
            +Q   + YANNSLN+  C      S + +S+++W+QGL GQ+YL   +   Q  +P+VTF
Sbjct: 420  FQSRASIYANNSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTF 479

Query: 471  YPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQ 530
            +P I Y G Y++ LYTPGC  D TC  R+IVNVT+W       LSS ++++NN  +KYD+
Sbjct: 480  HPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDE 539

Query: 531  VYSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQY 590
            ++ GHL+++P +TLEY+SPI PNNP++VVVAD + +  +S D  +    + I LNG+FQY
Sbjct: 540  LWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKD-ITLNGIFQY 598

Query: 591  QLSNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMY-NNTLWXXXXXXXXXXXELDE 649
            Q+SNFT +  +K SI NT+L+ + +  F  N+SLF+S+Y N+TL            +LD+
Sbjct: 599  QISNFTKNI-TKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDK 657

Query: 650  DLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRT 709
            +  V S+  +     V GI SYSDG+ILFG +N S +    L+FNG F S+  +  ++  
Sbjct: 658  NWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVER 717

Query: 710  YTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQF 769
            +TN+  +  ELLVF+NE+ +             F LS+WSAG+N   D +FSGAV+ N +
Sbjct: 718  FTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDY 777

Query: 770  PGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWT 829
              L G  S++ N S    ++++   PY   +LND++TAYAY+ GS S++ F NG EGPW 
Sbjct: 778  ENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWR 837

Query: 830  WFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDR 889
            W  +I +M Y     +LA+GT  S   P LS+ NLT+ +VLAN T+ +   ++SM+ F +
Sbjct: 838  WTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFGK 897

Query: 890  NSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMN 949
            NS+LL+GG++  SDA C+GLCLYNY  K+W+ FAN+SITG +T++QL  S +LLI+G++ 
Sbjct: 898  NSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLR 957

Query: 950  VANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLE 1009
            V   + VNL+S N++   +  L+    GP++SF+  ++ ++ WN+TSL  Y +  W+++ 
Sbjct: 958  VNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHIS 1017

Query: 1010 FDNS-SLISIVDVIAVKTEPALDKRQTFS--STFDAILVAGQNYAEYP--QASIYNFQRW 1064
              NS S   + D+  V  E +L+KR   S  S  D +LV G +  +    QASIY++  W
Sbjct: 1018 TSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGNDKTQGDSYQASIYDYYSW 1077

Query: 1065 LPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKG 1124
             P ++AN   +   S    F NQD S  + S+ +L                         
Sbjct: 1078 TPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGD 1137

Query: 1125 SLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGH-SGYEQVDPRADESEMI 1183
               R S K++RG+VVLIGLALA+GTVV+IG+ G+L+A +F     GYE + P A+ ++  
Sbjct: 1138 KKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAA 1197

Query: 1184 DTVPPEKLLKFL 1195
            +T PP K  KFL
Sbjct: 1198 ETAPPAKSSKFL 1209

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1219 (41%), Positives = 735/1219 (60%), Gaps = 28/1219 (2%)

Query: 1    MYGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQ 57
            ++ L FL       S ASQL+N+K+   I +   P L+       A+Q+ GG +A++F +
Sbjct: 6    LWTLAFLFLAQA--SKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYK 63

Query: 58   YEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXX 117
            Y GQ+NFT  I+  T+S G+VYYSN+T+I+L + S D+ ++KI P               
Sbjct: 64   YTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTIN 123

Query: 118  XXXXXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWX 177
                  Q+LYNLS LS+ PIF  SL DV  +L +    YFGGNFS++NGS +GHS   W 
Sbjct: 124  NISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWD 183

Query: 178  XXXXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN---- 233
                     PFGGFGE S VNSI+KL+ DNI+F G+FYTLDD ++LIT+ N    +    
Sbjct: 184  AMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSL 243

Query: 234  HSQSIEINELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYP 293
            ++  +E+ + + LR A+W++         + +CPN    AW  P+TSGSL  +LPYE  P
Sbjct: 244  NATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSP 303

Query: 294  KKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAV 353
             K+R+YNS +  + ++LF+I+T PS+ IMNLTY+DPLSGEL NCD FCPL  + +L AA 
Sbjct: 304  TKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAAS 363

Query: 354  ANGNTSQ--VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLY 411
             N ++S   +  +D N TD++WS D+QDFAF N++ VT L+ +AL+SYGD++GLS  +LY
Sbjct: 364  QNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELY 423

Query: 412  QDTLTTYANNSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVT 469
            Q+T +TYANNSLNE GC +  + +S+S LS++ W  GL G+SY+  ++   Q E +P+V 
Sbjct: 424  QNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVK 483

Query: 470  FYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYD 529
            FYP I ++G YT+N YTPGC  D TC+SR IVNVT+W+    +++ +  ++QNN+ +KYD
Sbjct: 484  FYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYD 543

Query: 530  QVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK-----NQTDETIPL 584
            Q++SG+L+ +P + LEY S I  +N + VVVADR+ VI  S+D        N      PL
Sbjct: 544  QIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPL 603

Query: 585  NGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXX 644
            NG+FQYQ SNFT +T +K  + NTTLN + V N+PKNASL   +YN+ L           
Sbjct: 604  NGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRIST 663

Query: 645  XELDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLE 704
             +L+E+  + S+      G V GI+    G++++G    S    + L FN  FG   N  
Sbjct: 664  IDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYS 723

Query: 705  TTLRTYTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAV 764
              + + TN+S   +EL VF+N Y+             +F LSLW+AG N   D LFSG V
Sbjct: 724  KRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTV 783

Query: 765  TKNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK 824
            +  +F  L GSAS  +   V   ++  G  PY   +LN+SV+AYAY   +++++YF N  
Sbjct: 784  SHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFSNKV 843

Query: 825  EGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSM 884
               W W  TI  M Y+ N T+L + ++ S+    L++FNL +   +AN T+  N  +S++
Sbjct: 844  NPSWNWSNTITRMLYANNQTMLVVSSESSSTAD-LTIFNLRNMTTIANETLGSNAKVSAL 902

Query: 885  VFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLI 944
            V F++NSS+LVGGD+ I+  +CSGLCLYNY+ K W+ F NN+I G +T++ L+ S +L+I
Sbjct: 903  VNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELII 962

Query: 945  SGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGD 1004
            SG  N     S+ L SFN++N+ + PL+  S G + SF+  DN ++ WN+TSL  Y +  
Sbjct: 963  SGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQK 1022

Query: 1005 WQNLEF-DNSSLISIVDVIAVKTEP-ALDKRQTFSSTFDAILVAGQNYA--EYP--QASI 1058
            W       + SLI  V  I+  T+   L+KR T ++   +IL+   N+   +Y   Q+ +
Sbjct: 1023 WNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLL 1082

Query: 1059 YNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQ-NLLXXXXXXXXXXXXXXXXXX 1117
            ++FQ W PY+++  ++  +    TFF N+D S  ++SQ  L                   
Sbjct: 1083 FDFQAWTPYFISEISNSSN-YNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSPS 1141

Query: 1118 XXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPR 1176
                 +     +  KI+RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR
Sbjct: 1142 TSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPR 1201

Query: 1177 ADESEMIDTVPPEKLLKFL 1195
             DE+EM+DTVPPEKL+KF+
Sbjct: 1202 IDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1208 (41%), Positives = 728/1208 (60%), Gaps = 32/1208 (2%)

Query: 15   SLASQLENLKNKHGIVNIGTPRLDFPGE---ALQLFGGFNALTFPQYEGQENFTGTINNN 71
            S ASQL+++K    I +   P L+   +   A+Q+ GG +AL+F +Y GQ+NFT  I + 
Sbjct: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77

Query: 72   TDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLSD 131
            T+SRG+VYYSN+T+I L     D+ ++KI P                     Q+LYNLS 
Sbjct: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137

Query: 132  LSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGGF 191
            LS+  IF  SL  V  +L +    YFGGNFS++NGS  GH    W          PFGGF
Sbjct: 138  LSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGF 197

Query: 192  GEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN----HSQSIEINELLPLR 247
            GE+S VNSI+KL+ DNILF G+FYTLDD ++L T+   +       ++ ++E+ + +PLR
Sbjct: 198  GEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLR 257

Query: 248  AATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNA 307
             A+W++           +CP++ K+AW  P TSGSL  +LPYE  P K+R+YNSP   N 
Sbjct: 258  YASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDND 317

Query: 308  VSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS--QVVRLD 365
            +SLF+I+T PS  IMNLTY+DP+SGEL +CD FCPL  +D+L +A  N ++S   +  +D
Sbjct: 318  ISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFID 377

Query: 366  NNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNE 425
            NN TD++WS D+QDFAF N+++VT L+F AL+SYG+ VGLS  +LYQDT +TYANNSLNE
Sbjct: 378  NNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNE 437

Query: 426  VGCES--NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQYTM 482
             GC +  ND +S+S LSD++W  GL GQSY+  D+   Q +  P VTFYP+I + G YT+
Sbjct: 438  YGCSALAND-SSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTI 496

Query: 483  NLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVL 542
            N YTPGC  D TC+SR IVNVTMW+    +++ + L++QNN  +KYD++YSG+L+ +P +
Sbjct: 497  NTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEI 556

Query: 543  TLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDET-----IPLNGMFQYQLSNFTN 597
             ++Y S I  +N + ++VAD++ +I +S+D   + ++ T      PLNG+ QYQ SNFT 
Sbjct: 557  VMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTA 616

Query: 598  STDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTA 657
            +T +   IANTTLN ++V N+PKN+S+F+ +Y+  L            + +++L V+S+ 
Sbjct: 617  TTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSE 676

Query: 658  KYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQ 717
                 G V G++  + G+++FG    S    + L FNG F S  N    +    N++   
Sbjct: 677  NKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLAN 736

Query: 718  DELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSAS 777
            ++L+VFNN+Y+F            +F LSLWSAG N  DD LFSGAV++ QF  L GSA 
Sbjct: 737  NDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSAR 796

Query: 778  IYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSM 837
              + S+V   +L  G  PY   +LN+S  AYAY+  S+S++YF N     W W   I  M
Sbjct: 797  FLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFSNNVSPSWNWSNNITKM 856

Query: 838  RYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGG 897
             Y+ N T+L IG++ ST    LS+ NL +F  +AN T+  N  I++ V F++NSSLLVGG
Sbjct: 857  VYANNQTLLVIGSESSTTAE-LSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGG 915

Query: 898  DYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVN 957
            D+ +S  +C+GLC+YNY+ K W+ F NN+I G IT++  +   +L+ISG      + S+ 
Sbjct: 916  DFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIR 975

Query: 958  LLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEF-DNSSLI 1016
            L SFN++N  + PL+  S G + SF   +  I+ WN+TSL  Y D  W       N S +
Sbjct: 976  LGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSV 1035

Query: 1017 SIVDVIAVKTEP-ALDKRQTFSSTFDAILVAGQNYA--EYP--QASIYNFQRWLPYYVAN 1071
            S V  I   T+  AL KR T  +   +IL+   N++  +Y   Q  +++ Q W PY+ + 
Sbjct: 1036 SSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSE 1095

Query: 1072 --KADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLVRK 1129
              +A   +P   T F N+D S  ++SQ  L                            + 
Sbjct: 1096 TLEASSYNP---TIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKS 1152

Query: 1130 SGK-INRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVP 1187
              K ++RGFVVLIGLALALGTV ++GI GV+LA VF    G Y  + PR DE+EM+DTVP
Sbjct: 1153 KKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVP 1212

Query: 1188 PEKLLKFL 1195
            PEKL+KF+
Sbjct: 1213 PEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1206 (42%), Positives = 725/1206 (60%), Gaps = 28/1206 (2%)

Query: 15   SLASQLENLKNKHGIVNIGTPRLDFPGE---ALQLFGGFNALTFPQYEGQENFTGTINNN 71
            S ASQL+N+K+   I +   P L+   +   A+Q+ GG +AL+  +Y GQ+NFT  I+  
Sbjct: 18   SKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPG 77

Query: 72   TDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLSD 131
            T+SRG+VYYSN+T+I++ + S D+ ++KI P                     Q+LYNLS 
Sbjct: 78   TNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLST 137

Query: 132  LSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGGF 191
            LS+ PIF+  L  V  +L +    YFGGNFS++NGS  GHS   W          PFGGF
Sbjct: 138  LSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGF 197

Query: 192  GEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN-----HSQSIEINELLPL 246
            GE S VNSIIKL+ DNILF G+FYTLDD + LIT  + + TN     ++  +E+ + +PL
Sbjct: 198  GENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNSTSLLNATKLELGQRIPL 257

Query: 247  RAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHN 306
            R ATW+          + +CPN+ ++AW  P+TSG+L   LPYE  P KVR+YNS +   
Sbjct: 258  RYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDG 317

Query: 307  AVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT--SQVVRL 364
             +S+F+I+T PSN IMNLTY+DPLSG+L NCD FCPL  + +L +A  N ++    +  L
Sbjct: 318  EISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFL 377

Query: 365  DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLN 424
            DNN TD++WS D+QDFAF N++ VT L+F A++SYG +VGLS  +LYQDT +TYANNSLN
Sbjct: 378  DNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLN 437

Query: 425  EVGCES--NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQYT 481
            E GC +  ND +S++  S + W  GL G+SY+  ++   Q E  P+V FYP I + G Y 
Sbjct: 438  EYGCSALANDSSSSTLSS-NSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYI 496

Query: 482  MNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPV 541
            +N YTPGC  D TC+SR IVNVTMW+    +++ +  ++QNN+ +KYDQ+YSG+L+ +P 
Sbjct: 497  INTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPE 556

Query: 542  LTLEYYSPISPNNPSNVVVADRLEVIVESVDILKN-----QTDETIPLNGMFQYQLSNFT 596
            + LEY S I  +N + VVVAD++ VI   +D          T E IPLNG+ QYQ SNFT
Sbjct: 557  IILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFT 616

Query: 597  NSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSST 656
            ++T ++  I NTTLN + V N+P N+SLF+    + L             L+++L V  +
Sbjct: 617  STTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLS 676

Query: 657  AKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQ 716
             K    G V G++  S G+++FG    S+   S L FNG F +  N   T+ +  N+S  
Sbjct: 677  EKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVFNYSRTVNSAINISLA 736

Query: 717  QDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSA 776
             ++L+VF+N+Y+             +F LSLWSAG N  DD LFSGAV++ QF GL GSA
Sbjct: 737  NNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSA 796

Query: 777  SIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINS 836
               S   V   +L N   PY A +LN+S TAYAY    ++++YF N  +  W W  +I  
Sbjct: 797  RFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITR 856

Query: 837  MRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVG 896
            M Y+ N ++L +G++ ST    LS+FNL +F ++AN T+  N  I+++V F++NSSLLVG
Sbjct: 857  MLYANNQSLLTVGSESSTTAE-LSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVG 915

Query: 897  GDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSV 956
            G++ +S  +CSGLCLYNY+ K W+ F NN+  G IT++  S +  L+ISG  +     SV
Sbjct: 916  GNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSV 975

Query: 957  NLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEF-DNSSL 1015
             L SFN++N  + PL+  + G I SF+  +  I+ WN+TSL  Y D +W       N S 
Sbjct: 976  RLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSS 1035

Query: 1016 ISIVDVIAVKTEPA-LDKRQTFSSTFDAILVAGQNYA--EYP--QASIYNFQRWLPYYVA 1070
            I  V  I     P  L++R T ++    IL+   N++  +Y   Q  +++F+ W PY+V+
Sbjct: 1036 IGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVS 1095

Query: 1071 NKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLVRKS 1130
              ++  +    T F N+D S  ++SQ  L                            +  
Sbjct: 1096 ESSNTSN-RNPTIFINRDVSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSK 1154

Query: 1131 GKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPE 1189
             +I+RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR DE+EM+DTVPPE
Sbjct: 1155 KRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPE 1214

Query: 1190 KLLKFL 1195
            KL+KF+
Sbjct: 1215 KLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1194 (42%), Positives = 729/1194 (61%), Gaps = 22/1194 (1%)

Query: 17   ASQLENLKNKHGIVNIGTPRLDFPGE--ALQLFGGFNALTFPQYEGQENFTGTINNNTDS 74
            ASQL +L+    I +I  P L+   +  + +L GG ++L+F +Y GQ+NFT  I  N++S
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77

Query: 75   RGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLSDLSL 134
             G+ YYSN+TFI+L   S DS +E+I+P                     QLL+NLS  SL
Sbjct: 78   NGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFSL 137

Query: 135  RPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGGFGEE 194
            + IF  +L  V  IL D  V  FGGNF+    S  GHSVA W          PF GFGE 
Sbjct: 138  KQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGEN 197

Query: 195  SIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAATWNTX 254
            S++NSI KL+ DNILF G+FYTLD+ TLL    +T +  +   I + +L+PL AATW++ 
Sbjct: 198  SLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMR--NISDINLGQLIPLSAATWSST 255

Query: 255  XXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRII 314
                     F+CP+   EAW    TSG+L  +LP++  P K+RIYNSP+  N +SLFRI 
Sbjct: 256  GSFFDEE-TFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIF 314

Query: 315  TKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS--QVVRLDNNLTDIQ 372
            + PS  IMNLTY+DP+ G+L +CDAFCPL  +  LK+A  N   S   +  L++N +DI+
Sbjct: 315  SDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIR 374

Query: 373  WSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCESND 432
            WS D+Q+FAFVN+++ + L+FLAL+SYG  VGLSSFQ+YQD    +ANNSLNE  C S +
Sbjct: 375  WSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNSLE 434

Query: 433  IASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSD 492
              S+S LS++ W +G+  Q+Y+   +   Q  LP+VTF+P + Y+GQY++ LYTPGC  D
Sbjct: 435  SFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQD 494

Query: 493  QTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISP 552
             TC+SR IVNVT+W+    SILS+ L++QNN+ +KYD++YSG+L  +P +T+ Y+S I  
Sbjct: 495  NTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYS 554

Query: 553  NNPSNVVVADRLEVIVESVDILK--NQTDETIPLNGMFQYQLSNF-TNSTDSK-PSIANT 608
               +  VV DRL +++ S+DIL   + +  ++ LNG+FQYQLSNF T+S DS    +ANT
Sbjct: 555  GTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANT 614

Query: 609  TLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTAKYATGGTVEGI 668
            ++N  T+  F  N SL +S+YN+TL            EL++DL + S+++    G + G+
Sbjct: 615  SINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGL 674

Query: 669  SSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNNEYV 728
             SYS+G++++G FN S +  + L+FNG F S GN+ + +  + N++    ELLVF+N  +
Sbjct: 675  KSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLI 734

Query: 729  FXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFS 788
            F            +F LSLWS+G N   DTLFSGA+++ QF  L GS SI +N S    S
Sbjct: 735  FNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANNLSAT--S 792

Query: 789  LQNGAQPYAACHLNDSVTAYAYRY-GSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILA 847
            L++   PYAA  LNDSVT Y  +   S S++ F +G + PW W G ++SM Y  N ++LA
Sbjct: 793  LRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLA 852

Query: 848  IGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCS 907
            +G+  S +   LS+ NL SF VLAN T+++N ++ +MV F+RNSS+LVGG++ IS+ +C 
Sbjct: 853  VGSSSSVNGE-LSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECF 911

Query: 908  GLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYE 967
            GLCLYNY   QW  F N +I G IT++Q+     L+I+G  +  +++SVNL   N+++ +
Sbjct: 912  GLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNK 971

Query: 968  VNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVDVIA--VK 1025
            +  + W    P+K FI  D++I  WNETSL  Y+   W ++   NS+  + +D I     
Sbjct: 972  LVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTT 1031

Query: 1026 TEPALDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKADDEDPSRTT 1082
            T+  L KR    ++ + ++V GQ Y     + QA IYNF+ W+PY   N           
Sbjct: 1032 TDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAE 1091

Query: 1083 FFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLVRKSGKINRGFVVLIG 1142
             F ++D S+L+DSQ L                        K  L +   KI+RGFVVLIG
Sbjct: 1092 LFIDRDVSKLFDSQ-LALQVSNTTASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIG 1150

Query: 1143 LALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPEKLLKFL 1195
            LALALGT+ ++GI GV+LA  F    G Y+ + PR +E EM+ TVPPEKL++F+
Sbjct: 1151 LALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1209 (40%), Positives = 736/1209 (60%), Gaps = 28/1209 (2%)

Query: 12   VCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQYEGQENFTGTI 68
            V +S ASQLEN+K+   I +   P L+       A+Q+ GG +AL+F +Y GQ+NFT  I
Sbjct: 15   VEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEI 74

Query: 69   NNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYN 128
               T S G+VYYSN+T+I+L + S D+ ++KI P                     Q+LYN
Sbjct: 75   GPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYN 134

Query: 129  LSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPF 188
            LS LS+ PIF  SL  V+ +L D    YFGGNFS++NGS  G+S   W          PF
Sbjct: 135  LSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPF 194

Query: 189  GGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNEN----TSKTNHSQSIEINELL 244
            GGFGE S VNSI+KL++DNILF G+FYTLDD + LI++ N    ++ + ++ ++E+ + +
Sbjct: 195  GGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQRI 254

Query: 245  PLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEE 304
            PLR A+W++         + +CPN+ ++AW  P TSGSL  +LPYE  P K+R+YNS   
Sbjct: 255  PLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRS 314

Query: 305  HNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQ--VV 362
             + +S+F+I+T PS+ IMNLTY+DPLSGEL NC  FCPL  + +L +A  N ++S   + 
Sbjct: 315  DSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMIT 374

Query: 363  RLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNS 422
             +DNN TD++W+ D+QDFAFVN++ V+ L+F+AL+SYG +VGLS  +LYQDT +TYAN+S
Sbjct: 375  FIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDS 434

Query: 423  LNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQY 480
            LNE GC +  + +S+S LS ++W  GL G+SY+ A +   Q E +P+V FYP I + G Y
Sbjct: 435  LNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHY 494

Query: 481  TMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAP 540
            T+N+YTPGC  D TC++R IVNVTMW++   +I+ + L++QNN+ +KYDQ+YSG+L+ +P
Sbjct: 495  TINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSP 554

Query: 541  VLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTD------ETIPLNGMFQYQLSN 594
             + LEY S I   N + VVVAD++ VI  S+D     +D      ET+ LNG+ QYQ SN
Sbjct: 555  EIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETL-LNGILQYQKSN 613

Query: 595  FTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVS 654
            FT++  ++  + NTTLN + V+N+PKN+SL++ +Y+N L            +L++D  V+
Sbjct: 614  FTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVT 673

Query: 655  STAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVS 714
            S+      G V GI+  + G+++FG    S+   +   FNG F +  N   T+ +  N+S
Sbjct: 674  SSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNIS 733

Query: 715  FQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYG 774
               ++ +V +N+YV             +F LSLW+AG N   D LFSGAV+  Q+  L G
Sbjct: 734  LANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNG 793

Query: 775  SASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTI 834
            S    + + +   +L+ G  PY   +LN+S TAYAY   S++++YF N     W W   I
Sbjct: 794  SVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGI 853

Query: 835  NSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLL 894
              M Y+ N T+LA+   GS+    LS+F+L +  ++AN T+  N  I+++V F++N S+L
Sbjct: 854  TQMLYADNQTLLAVSA-GSSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSML 912

Query: 895  VGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKT 954
            VGGD+ +++ +C+GLCLYNY+ K W+ F NN+I G IT++  + S +L+ISG        
Sbjct: 913  VGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQ 972

Query: 955  SVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQ--NLEFDN 1012
            S+ L SFN++N  + PL+  S G + SF   ++ I+ WN+TSL  Y + +W   +L  + 
Sbjct: 973  SIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNA 1032

Query: 1013 SSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYA----EYPQASIYNFQRWLPYY 1068
            SS+ S+  +        L+KR   +    +IL+   N+      Y Q+ +++FQ+W PY+
Sbjct: 1033 SSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYF 1092

Query: 1069 VANKADDEDPSRTTFFTNQDDSQLYDSQN-LLXXXXXXXXXXXXXXXXXXXXXXXKGSLV 1127
            ++   +  +      F N+D S  ++SQ+ L                        +    
Sbjct: 1093 ISETTNTSN-YNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSK 1151

Query: 1128 RKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTV 1186
             K  KI RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR DE+EM+DTV
Sbjct: 1152 SKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTV 1211

Query: 1187 PPEKLLKFL 1195
            PPEKL+KF+
Sbjct: 1212 PPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1221 (40%), Positives = 738/1221 (60%), Gaps = 41/1221 (3%)

Query: 6    FLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQE 62
            FLL   + +  ASQL N+KN   + N+  P L+      +  QL G  + L+F +Y+GQ+
Sbjct: 9    FLLL--IHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQ 66

Query: 63   NFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXX 122
            NFT  I   ++S G++YYSN+T I+L   S+D+Y+ KI P                    
Sbjct: 67   NFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLT 126

Query: 123  RQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXX 182
             QLLYNL+ LS+ PIF  S+ +V+ IL D  + YFGGNF+  NG++  HS+  W      
Sbjct: 127  NQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSS 186

Query: 183  XXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN--HSQSIEI 240
                 FGGFGE SI+NSI+KL+ DNILF GEFYTLD+   LI N  +S+ N  +S +++I
Sbjct: 187  TEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDI 246

Query: 241  NELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYN 300
             +L+PL A+TW+T          F+CP++ +E+W    T+GSL   LP+E  P K+RIYN
Sbjct: 247  GQLVPLSASTWDTGESTFDSD-TFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYN 305

Query: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT-- 358
            SP E N VSLFRI+T  + GIMNLTY+DP+S EL +CDAFCPL  +  L  A AN  +  
Sbjct: 306  SPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPS 365

Query: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418
              +  L +N TDI+W+ ++Q+FAF+N+I+V+ +QF+AL SYG+ V LSSFQLYQ+    +
Sbjct: 366  DTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVF 425

Query: 419  ANNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAG 478
            AN++LNE  C S + +S+S+LS ++W+ GL GQ+Y+   +   Q+ +P V+F P I Y G
Sbjct: 426  ANDTLNEPNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPG 485

Query: 479  QYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLET 538
            QY++N+YTPGC+ D TC+SR+IVNVT+W   G SIL++ L++QNN+ +KYD++YSG+L +
Sbjct: 486  QYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSS 545

Query: 539  APVLTLEYYSPISPNNPSNVVVADRLEVIVESVDI---LKNQTD--ETIPLNGMFQYQLS 593
            +P +T+EY S +  +N    VVADRL V+++S+++     N T+  E + LNG+ QYQ+S
Sbjct: 546  SPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQIS 605

Query: 594  NFTNS----TDSKPSIANTTLNSYTVQNFPKNASLFSSMY-NNTLWXXXXXXXXXXXELD 648
            NF+ S    TD K  I NT+LN  +++ F KN S+++ +Y +NTL            +L+
Sbjct: 606  NFSTSSSETTDVK--ITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLN 663

Query: 649  EDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNL--ETT 706
            E++ + S+ + +  G   G SSYS GI+ +G +NLSS+    + +NG F    N    ++
Sbjct: 664  ENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSS 723

Query: 707  LRTYTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTK 766
            +    N++    ELLV +N+ ++               LSLWS+G N   DT+FSGA+  
Sbjct: 724  ITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIAL 783

Query: 767  NQFPGLYGSASIYSNSSVAHFS--LQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK 824
              +  L GS +I +N +V + +  + +    Y    LNDS++ YA +  S S+L F NG 
Sbjct: 784  LDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNGY 843

Query: 825  EGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSM 884
              PW++F  IN M YS + T+LA+ +        LS+ NLT+F+ +AN T++ N  I+ +
Sbjct: 844  SAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGL 903

Query: 885  VFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLI 944
            + F+ NS+L+VGG++ I  ++CSGLCLYNYD  +W  FAN+SI G I +M+L     LL+
Sbjct: 904  INFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLL 963

Query: 945  SGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGD 1004
            SG  N  N +SVNL   ++S Y V+ +       ++SF    + IITWN   L  Y +G 
Sbjct: 964  SGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGA 1023

Query: 1005 WQNLEFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNY-AEYP--QASIYNF 1061
            W  ++ + +S  +I  +  +   P L KR    S  D  ++ G  Y  EY   QA IYNF
Sbjct: 1024 WSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSA-DGFIINGNIYDTEYGTIQAMIYNF 1082

Query: 1062 QRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLX------XXXXXXXXXXXXXXX 1115
            + W PYY+ +  + +   +   F N+DDS LY+SQ++L                      
Sbjct: 1083 KEWRPYYIISSTNSQIAGQ--IFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSAT 1140

Query: 1116 XXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVF-NGHSGYEQVD 1174
                   +  + RK  KI+RGFVVLIGLALALGTV ++GI G++LA +F +G   ++ ++
Sbjct: 1141 HSSQPHHQKQVGRK--KIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALN 1198

Query: 1175 PRADESEMIDTVPPEKLLKFL 1195
            PR +E EM++TVPPEKL+KFL
Sbjct: 1199 PRTNEDEMLETVPPEKLMKFL 1219

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1217 (41%), Positives = 726/1217 (59%), Gaps = 37/1217 (3%)

Query: 12   VCLSLASQLENLKNKHGIVNIGTPRLDF--PGEALQLFGGFNALTFPQYEGQENFTGTIN 69
            + +S ASQL N+K+  GI  +  P+++F      +Q+      LTF QY+GQ+NFTG+I+
Sbjct: 14   IGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSID 73

Query: 70   NNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNL 129
             N+++ G++YYSNDT IKL+ GS ++ +++IVP                     QLLYNL
Sbjct: 74   TNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNL 133

Query: 130  SDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFG 189
            SDLS+ P+F N L +++ IL D  + YFGGNFS+ + +   +S+ +W          PF 
Sbjct: 134  SDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFI 193

Query: 190  GFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENT-------SKTNHSQSIEINE 242
            GFG+ S VNSI+KLD DN+LF G+F TLDD++LL++N  T       S ++   ++E+ +
Sbjct: 194  GFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQ 253

Query: 243  LLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSP 302
             + L+ A+W            FICPN Q EAWS   T+G +  +L +E+   K+RI+NSP
Sbjct: 254  QISLKYASW-ASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSP 312

Query: 303  EEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVV 362
             E + ++ FRI+T PSNGIMNLTY+DPL+ E+  CDAFCPL   ++L+A+  N  TS   
Sbjct: 313  YEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSAST 372

Query: 363  R--LDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYAN 420
               ++ N T+I WS DYQ+FAFVN++ VT LQ +AL+SYGD VGLS FQLYQ++ + +AN
Sbjct: 373  SAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFAN 432

Query: 421  NSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQ 479
            NSLNE  C+S N +  +S LS++ W QGL  QSY+   +  G +  P V FYP+IN  G 
Sbjct: 433  NSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGN 492

Query: 480  YTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETA 539
            YT+N+YTPGC+ D TC+ R IVNVT+W      ++S+ L++QNN  MKYDQ++ G L+ A
Sbjct: 493  YTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYA 552

Query: 540  PVLTLEYYSPISPNNPSNVVVADRLEVI---VESVDILKNQTDET----IPLNGMFQYQL 592
            P +TLEYYS I+  N   VVVAD ++++   +E  + + N T  T    +PLNGMFQYQL
Sbjct: 553  PKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQL 612

Query: 593  SNFTNSTDSKP-SIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDL 651
            SNFT+S ++    + NT+LN + V  F  + SL+   YN TL             L    
Sbjct: 613  SNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYT 672

Query: 652  HVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYT 711
            ++ ST    TGG V G  +Y+ G++LFG FN+S++ VS+L++NG F SFGN+ + + T++
Sbjct: 673  NIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNIATFS 732

Query: 712  NVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPG 771
            N++F + E+L FNNEY F               LS+WSAG N F DTLFSG +T+N+FP 
Sbjct: 733  NLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPN 792

Query: 772  LYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWF 831
            L  SA +  N +     L+NG QPY   +LNDS+TAY Y   S S + F NG +G W   
Sbjct: 793  LNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLP 852

Query: 832  GTINSMRYSKNSTILAIGTDGSTDEPILSLF--NLTSFDVLANTTISENGTISSMVFFDR 889
             +++S  YS N T+  +G+  S  +    LF  N T+ D+L N T   N +I+S+V F R
Sbjct: 853  RSVSSAYYSDNETMF-VGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGR 911

Query: 890  NSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMN 949
            NSSLLVGGD+   + +CS LCL N    QW+ F+ N   G IT ++ +    LLISG+  
Sbjct: 912  NSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFS-NKFDGTITGLEFANDSRLLISGSYR 970

Query: 950  VANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLE 1009
              N++ ++L   +++N E   L+ DS   + SF   +  I+ W+ +++  Y    W N +
Sbjct: 971  FENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQ 1029

Query: 1010 FDN---SSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQR 1063
              N   S+ I  V +++           + +   + ILV G+ Y+E   + QA  Y+FQ 
Sbjct: 1030 IPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQN 1089

Query: 1064 WLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXK 1123
            W+PYY+       + S+ + F N+D S LY+SQ +L                        
Sbjct: 1090 WIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSST 1149

Query: 1124 GSLVRKSG----KINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRAD 1178
             S   K+G    KI+RG+VVLIGLALA+GTV I+GI GV +A +F+   G Y ++ PR D
Sbjct: 1150 SSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRID 1209

Query: 1179 ESEMIDTVPPEKLLKFL 1195
            E EM+DTVPPEKL+KF+
Sbjct: 1210 EHEMLDTVPPEKLMKFI 1226

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1222 (40%), Positives = 729/1222 (59%), Gaps = 60/1222 (4%)

Query: 11   SVC-LSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTG 66
            ++C L   SQL +LK K  I ++  P++D      + + L G F  LTF +Y GQENFTG
Sbjct: 13   ALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTG 72

Query: 67   TINNNTDSRGIVYYSNDTFIKL-----INGSSDSYVEKIVPXXXXXXXXXXXXXX-XXXX 120
            +I      + ++YYSN TFIKL      N ++D  +  I+P                   
Sbjct: 73   SITET--EKDLIYYSNGTFIKLDSLSDENATAD--INHIIPFGDDSFILSGTGTLPGGHN 128

Query: 121  XXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXX 180
              +QLLYNLS L    IF  S++ V  IL D  + YFGG F +  G++ GHSV  W    
Sbjct: 129  LEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTT 188

Query: 181  XXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEI 240
                  PF GFG +S+VNSI++LD+DNI+F G+F TLDD TLL     ++ + ++  IE 
Sbjct: 189  NEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATDIEF 248

Query: 241  NELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTS-GSLEASLPYESYPKKVRIY 299
            ++L+PL+ A W++         + ICP+   + W    T+ G    SL  +  P K+RIY
Sbjct: 249  DQLIPLKHAGWSSQGSLEHS--SLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIY 306

Query: 300  NSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS 359
            N+ +    VSLFRIIT P+NGIMNLTY+DP +GEL  CDA+CPL+  + L+ A AN   S
Sbjct: 307  NAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTIS 366

Query: 360  Q--VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTT 417
               V  + NN T+I+W+  YQ+FAFVN+++V  L FLAL SYG +VGL  F++YQ+   T
Sbjct: 367  SDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPT 426

Query: 418  YANNSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINY 476
            +AN++LN+  C++ N  +     S  +W QG    SY+++ +  G   LP V FYP I Y
Sbjct: 427  FANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYD-GTGDLPSVNFYPNITY 485

Query: 477  AGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHL 536
            AG YT+N+ TPGC+ D +C+SR IVNVT+W ++  ++LS+ L++QNN   KYD +YSG+L
Sbjct: 486  AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYL 545

Query: 537  ETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK---NQTDETIPLNGMFQYQLS 593
            E+AP +TL++Y  I+ ++ ++++VADR++VI++S+D  K      +ET  LNG+FQYQ+S
Sbjct: 546  ESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET--LNGLFQYQIS 603

Query: 594  NFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHV 653
            NFT  ++    I NTT+N Y+++N P N+ LF+  YNNTL            +L++DL++
Sbjct: 604  NFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNI 663

Query: 654  SSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNV 713
             S  +  TGG  EGI++YS+G++  G FNLSSQ +STL++NG F SFGNL T +  + N+
Sbjct: 664  ISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNI 723

Query: 714  SFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLY 773
            +    ELLVFNN Y+F            +F LSLWSAG N  +D +  GAV++ Q+  L 
Sbjct: 724  TIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELN 783

Query: 774  GSASIYSNSSVAHFSLQ--NGAQPYAACHLNDSVTAYAY--RYGSVSQLYFDNGKEG--- 826
            G+  I   +S++   L   +G + Y A ++NDS TAYAY  +  S   +    G      
Sbjct: 784  GAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDL 843

Query: 827  PWTWFGTINSMRYSKNSTILAIGTD-GSTDEPILSLFNLTSFDVLANTTISENGTISSMV 885
            P +W   +N+M Y+K+ ++LA+GT+ G T+   LSLFN+++  ++    +    +++++V
Sbjct: 844  PVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIV 903

Query: 886  FFDRNSSLLVGGDYHI--SDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLL 943
             F++NSSLLVGGD+ I   D  CSGLCLYNY+  +W+ F NNSI+GNIT++Q      LL
Sbjct: 904  AFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLL 963

Query: 944  ISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGY 1000
            ISG +   N+T +NL   NM++ EV  L   S   ++SF+  D   +++IT ++  +S Y
Sbjct: 964  ISGNLYTENETGINLAKLNMASNEVTILRHGST-MVQSFVTFDHTTDELITQSDNEISYY 1022

Query: 1001 SDGDWQNLEFD--NSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYPQAS 1057
            ++G+W+NL  +  N SL     +I +K   +  KR   +    A+LV G   ++ Y   S
Sbjct: 1023 TNGEWKNLTSEDFNDSLYMGAQLIPLKQTSS--KRDVSNR---ALLVNGDLKHSTYGSVS 1077

Query: 1058 --IYNFQRWLPYYVANKADDEDPSRTT-FFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXX 1114
              +Y+F+ W+PY++    D E+  R +  F N+D S LY +Q +L               
Sbjct: 1078 AMLYDFEDWMPYFI---VDGENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSNMP 1134

Query: 1115 XXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQV 1173
                           S KI+RGFVVLIGLALA+GTV ++G  G ++A  F G+ G YE +
Sbjct: 1135 SETSDKNES-----SSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPL 1189

Query: 1174 DPRADESEMIDTVPPEKLLKFL 1195
             PR DE +MIDTVPPEKL+KF+
Sbjct: 1190 KPRVDEGDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1221 (37%), Positives = 678/1221 (55%), Gaps = 45/1221 (3%)

Query: 5    LFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDF--PGEALQLFGGFNALTFPQYEGQE 62
            L +LF     + AS L N+     I     P L+F     ++QL G    L F  YEGQ+
Sbjct: 10   LVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQ 69

Query: 63   NFTGTINNNTDS-RGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXX 121
            NFT   N+   S   ++YYS+D  I+L  GS+D+ ++KI+P                   
Sbjct: 70   NFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYAL 129

Query: 122  XRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXX 181
             RQLLYNL+ LS++PIF+  L ++  IL D  + YFGG F++   S    SV +W     
Sbjct: 130  GRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSD 189

Query: 182  XXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNEN------TSKTNHS 235
                 PF GFG +S VNSI+KL+ DNILF G F TL + +LL  N        T+ T +S
Sbjct: 190  EVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENS 249

Query: 236  QSIEINELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKK 295
             +I++ + + L+ ATW+           F+C     EAW V   SG+L+ + P    P K
Sbjct: 250  STIQLEQQISLKYATWDAGTAYFDQNN-FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSK 308

Query: 296  VRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVAN 355
            +RIYN+    + VSLFRI+T PSNGIMNLTYVDPL+G+L  CDAFCPL+    L+ A +N
Sbjct: 309  IRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSN 368

Query: 356  G--NTSQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQD 413
                T Q V ++NN T + WS  YQ+FAF+N I V+ L  +A  SYG    LS  +L+QD
Sbjct: 369  STSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQD 428

Query: 414  TLTTYANNSLNEVGC--ESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFY 471
            + T YANN+LN+ GC  ES  + S+S LSD+ W +GL   SY+ A++++    LP V FY
Sbjct: 429  SHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFY 488

Query: 472  PAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQV 531
            P I   G +++ +YTPGC +D TC SRSIVNVT+     G++LS+ L++QNN  MKYD++
Sbjct: 489  PNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEI 548

Query: 532  YSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVI-----VESVDILKNQTDETIPLNG 586
            ++G L  +P +TL +YS I P+  S ++VADR+++      V+ + +  N    ++ LNG
Sbjct: 549  FNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNG 608

Query: 587  MFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXE 646
            +FQYQLSNFT  +D+K  + N +++   +  FP + SL  + +NN+++           +
Sbjct: 609  LFQYQLSNFT--SDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQ 666

Query: 647  LDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSS-QPVSTLTFNGVFGSFGNLET 705
            L+ DL + +T     GG    I +YS G++ FG +N+SS   V  L+FNG F SF  L  
Sbjct: 667  LNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGD 726

Query: 706  TLRTYTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVT 765
             + T+ N +++  ELL FNN+Y++             F  S+ + G N  +DTL  G + 
Sbjct: 727  NVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIV 786

Query: 766  KNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKE 825
            ++++        +Y NSS+   +  +   PYAA  LND+   YAY+ G  S++ + N   
Sbjct: 787  RSEYSNFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMT 846

Query: 826  GPWTWFGTINSMRYSKNSTIL---AIGTDGSTDEPILSLFNLTSFDVLANTTISENGTIS 882
                + GT+N + +S NS++L   AI  +GS+    L + N++    LA+  ++  G I+
Sbjct: 847  TSLDFSGTLNKLSFSNNSSLLFANAITNNGSSS---LVISNISDGMSLASENLNNYGYIT 903

Query: 883  SMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDL 942
            SM+ F+ N+++LV G++ + D DC G+CLYNY  K+W+ FAN++I G+I EMQL  S  +
Sbjct: 904  SMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQI 963

Query: 943  LISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSD 1002
            LISG  +  N +S+ L S ++  Y ++ L  DS   I SFI +   I  W+  ++  Y  
Sbjct: 964  LISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKS 1023

Query: 1003 GDWQNLEFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYP-------Q 1055
              W  + F N++   I  V AV  +      Q  +S    IL A   Y E+         
Sbjct: 1024 EKWNEISFPNTTSKYIESVEAVSID-----LQNSTSNVSKILFA---YGEFNSTLYGRLN 1075

Query: 1056 ASIYNFQRWLPYY-VANKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXX 1114
            A ++    W PY+ + N   +EDP+  T F N+D S L++S+N L               
Sbjct: 1076 AMLFRAGDWKPYFSINNFQVNEDPA-ITLFENRDLSSLFNSKNSLPANITSAETSSRSTV 1134

Query: 1115 XXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSGYEQVD 1174
                       +  K  KI+RGFVVLI LALA+GTV ++G+ GV +A +F     YE + 
Sbjct: 1135 SSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQKYESIK 1194

Query: 1175 PRADESEMIDTVPPEKLLKFL 1195
            PR D  EM+DTVPPEKL+KF+
Sbjct: 1195 PRIDGQEMLDTVPPEKLMKFI 1215

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1204 (40%), Positives = 701/1204 (58%), Gaps = 32/1204 (2%)

Query: 14   LSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTGTINN 70
            LSLASQL  L+N  GI     P L F      +LQL G ++AL+   Y GQ+NF+  I  
Sbjct: 17   LSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITP 76

Query: 71   NTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLS 130
            +T+S G+VYYSN+T I+L  G  D+ +  IVP                     QL YNLS
Sbjct: 77   DTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLS 136

Query: 131  DLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGG 190
             LS+ PIF  +L  V  IL D  + YFGGNF+F NG+  GHSVA W          PF G
Sbjct: 137  SLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLG 196

Query: 191  FGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAAT 250
            FGE S +N+I++L+ DNILF GEFYTLDD +LL +N + + TN    +E++ LLPL  AT
Sbjct: 197  FGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNATTNI-YDLELSPLLPLNEAT 255

Query: 251  WNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSL 310
            W++         +FIC N   +AW V  T+G+L  SLPY+S   K+RIYNSP+  N +S 
Sbjct: 256  WSSDVSDFDAS-SFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISE 314

Query: 311  FRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRL-DNNLT 369
            FR+I+ PS  IMN+TY+DP +G L +CD++CPL+ +D+L +A    + S++ RL  +N T
Sbjct: 315  FRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNAT 374

Query: 370  DIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCE 429
             I+WS +YQ+F FVN ++ T LQFLAL+SYG  V L+ + LYQD    +ANNSLN   C 
Sbjct: 375  VIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCT 434

Query: 430  SNDIASTSA-LSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPG 488
            SN+   TS+ LSD++W  G  GQ+Y+   +  G + +P+VTF   + Y+G Y +NLYTPG
Sbjct: 435  SNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPG 494

Query: 489  CSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYS 548
            CS D TC++R +VNVT++ E   SILS++ ++QNNEA+KYD+++SG+L+ +  + LEY S
Sbjct: 495  CSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVS 554

Query: 549  PISPNNPSNVVVADRLEVIVESVDIL----KNQTDETIPLNGMFQYQLSNFTNSTDSKPS 604
             IS ++    VVADR  + V S+DIL     ++   T+ LNG+FQYQLSNF+++ +S  +
Sbjct: 555  GISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLSNFSSTFNSSSA 614

Query: 605  -IANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTAKYATGG 663
             +  T LN Y +  F  N+SLF+S Y+N L            E   DL+ S++      G
Sbjct: 615  KVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEG 674

Query: 664  TVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSF---GNLETTLRTYTNVSFQQDEL 720
              + +  +S+GI L+G FNLS      +T+NG F  F   GN  +++ T+ NV+F   E+
Sbjct: 675  QFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGN--SSIDTFKNVTFGNSEI 732

Query: 721  LVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS 780
            LVFNN Y++            +  LSLWSAG N   D LF+GA ++  +     S +I +
Sbjct: 733  LVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIGA 792

Query: 781  NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYS 840
            N+ V   +      PY   ++N S  AY Y+    +++YF NG +  W W   + +  YS
Sbjct: 793  NNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYS 852

Query: 841  KNSTILAIGT-DGSTDEPILSLFNLTSFDVLAN-TTISENGTISSMVFFDRNSSLLVGGD 898
             N ++L  GT         L++ N T++DV+AN +  S+   IS +V F  N++ ++GG+
Sbjct: 853  DNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGN 912

Query: 899  YHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNL 958
            + + + +C GLCL+NY    W+ FA+ SI G +  MQL    +L++SG  +  N +S+ +
Sbjct: 913  FSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITM 972

Query: 959  LSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISI 1018
             S N+ N ++  L    +   KSF   D  I+ WN T+LS Y D  W      N +  S+
Sbjct: 973  ASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSSV 1032

Query: 1019 VDVIA-VKTEPALDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKAD 1074
            VD +  V    AL KR T SS  DAILV+GQ Y     + QA +Y+F  W+PY + N   
Sbjct: 1033 VDNLNYVTLASALSKRDTSSS--DAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSES 1090

Query: 1075 DEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLVRKSG--K 1132
            D   S    F ++D S   ++Q  L                         S+  K+   K
Sbjct: 1091 D---SSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASAT-SIPNKTHKRK 1146

Query: 1133 INRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPEKL 1191
            I+RGFVVL+GLALALGTV ++GI GV++A VF   +G YE ++PR DE+EMI+TVPPEKL
Sbjct: 1147 IDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKL 1206

Query: 1192 LKFL 1195
            +K++
Sbjct: 1207 MKYI 1210

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1277 (35%), Positives = 703/1277 (55%), Gaps = 92/1277 (7%)

Query: 4    LLFLLFQSVCLS--LASQLENLKNKHGIVNIGTPRL---DFPGEALQLF--GGFNALTFP 56
            +L +L  SV  S  +A+QL +LK+   I NI  P+    D   ++LQL    GF+ L F 
Sbjct: 8    ILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFV 67

Query: 57   QYEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXX 116
             Y GQ+NFT  I +++ +  ++YYSNDT+I+L++    + ++ I+P              
Sbjct: 68   HYNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSL 126

Query: 117  XXXXXXRQLLYNLSDLSLRPIFENSLT-DVRVILED--YPVAYFGGNFSFD-NGSTVGHS 172
                   QL+YNL+DLSL PIFEN L  +VR I +D    + YFGGNFS+    S + + 
Sbjct: 127  NGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNG 186

Query: 173  VATWXXXXXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKT 232
            +  W           FGGFG  S++N+I+KL+S+++LF+G+FYTLDD ++L    N +  
Sbjct: 187  LIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFP 246

Query: 233  NHSQSI---------EINELLPLRAATWNTXXXXX-XXXXAFICPNSQKEAWSVPSTSGS 282
            N++ S+         E+N+ +PL    ++T            ICP S+ EAW+  S +GS
Sbjct: 247  NNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGS 306

Query: 283  LEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCP 342
            L+ +LP+   P K+RI+NSP+  + V+ FRI     N IM+L Y+DPL G+L  C  FCP
Sbjct: 307  LQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCP 366

Query: 343  LMLQDSLKAAVANGN-TSQVVRL-DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYG 400
            L  ++ LK   +N N  S V+ L DNN TDI+WS  YQ+FAFVN+  +T L+F ALSSYG
Sbjct: 367  LYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYG 426

Query: 401  DAVGLSSFQLYQDTLTTYANNSLNEVGC------ESNDI----------ASTSALSDSEW 444
              VGLS   L+Q  +  +AN S N+  C      ++ D+          +S S LSD++W
Sbjct: 427  SRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDW 486

Query: 445  QQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVT 504
               L    YL   + +  + +P VTFYP + YAG YT+++ TPGC++D +C SR IVNVT
Sbjct: 487  YTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVT 546

Query: 505  MWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRL 564
            MW++   SIL + L++Q NE  K+DQ+++G+L+    +T+ +YS +  N  +  +VADR+
Sbjct: 547  MWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRI 606

Query: 565  EVIVESVDIL----KNQTD-ETIPLNGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFP 619
             +I+ S+D +     N+ D   + LNG+FQY   N  N+ +   +  N+T+N Y   N+P
Sbjct: 607  NLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNE--NYTNSTINQYAYSNYP 664

Query: 620  KNASLFSSMYN-NTLWXXXXXXXXXXXELDED-LHVSSTAKYATGGTVEGISSYSDGIIL 677
             N SL ++ Y+ +TL            +++++  ++S    +    +V GI  YSDG+I 
Sbjct: 665  ANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIA 724

Query: 678  FGTFNLSSQPVSTLTF-NGVFGSFGNLETTLRTYTNVSFQQD-ELLVFNNEYVFXXXXXX 735
            +G    SS     +TF N  FG+ GN    +++++N+S     E+L FNN+Y +      
Sbjct: 725  YGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNME 784

Query: 736  XXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQP 795
                  TF LSLWSAG+N  +D +FSG V++N+   L G  SI +N  +   +L N   P
Sbjct: 785  DFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYP 844

Query: 796  YAACHLNDSVTAYAYRYGS--VSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGS 853
            Y+A  LNDS T YAY   +  +++L   NG++  W+W   I+SM +  N ++L++GT   
Sbjct: 845  YSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISD 904

Query: 854  TDE-PILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLY 912
             D  P  S+ NLTS  V+AN T+++N  ISS+++F +NSS+LVGG++  SD  CSGLCL+
Sbjct: 905  KDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLF 964

Query: 913  NYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLV 972
            NY+ K W+ F NN++ G +++++L  + ++LISG ++     +++L   N++ Y V+ L+
Sbjct: 965  NYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILL 1024

Query: 973  WDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSS------LISIVDVIAVKT 1026
             ++N  + SF    N I  WN ++L  Y++  W  +   N +       ISI D+    +
Sbjct: 1025 QNTN--LTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNS 1082

Query: 1027 EPALDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKADDEDPSRT-T 1082
               L+KR    +  + ++  GQ Y++     QA  Y    W+PY+  N  ++ D S +  
Sbjct: 1083 SSILEKRALRDT--NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN 1140

Query: 1083 FFTNQDDSQLYDSQNLLX-----------------------XXXXXXXXXXXXXXXXXXX 1119
             F N+D S    S  +L                                           
Sbjct: 1141 IFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSI 1200

Query: 1120 XXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRAD 1178
                G    K  KI RGFVVLIGLAL+L TV ++GI G+LL+ +F    G YE + PR  
Sbjct: 1201 IPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTT 1260

Query: 1179 ESEMIDTVPPEKLLKFL 1195
            E EM D VPPEKL+ F+
Sbjct: 1261 EHEMFDAVPPEKLMPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1229 (34%), Positives = 672/1229 (54%), Gaps = 76/1229 (6%)

Query: 4    LLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGE--ALQLFGGFNALTFPQYEGQ 61
            +++ L+ +V ++ AS LEN++       +  P  D   +    Q+    N ++F +Y GQ
Sbjct: 5    VVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQ 64

Query: 62   ENFTGTINNNTDSRGIVYYSNDTFIKLING-SSDSYVEKIVPXXXXXXXXXXXXXXXXXX 120
            +NFT T  N TD + ++YYSN+TF+ L +  ++++ ++ I+P                  
Sbjct: 65   QNFT-TDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVS 123

Query: 121  XXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXX 180
               QL++N++DLS+  IF+  L  +  +  D P+ YF GNF+F+N +        W    
Sbjct: 124  LASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIMWDSRD 179

Query: 181  XXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLI-TNENTSKTNHSQSIE 239
                  PF GFG  + +NSI+KL+ DNILF G F T+ + +LL+ +N +     ++ S+ 
Sbjct: 180  RSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLL 239

Query: 240  INELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIY 299
            +N  +PL+ + W T           ICP+  K++WSV +T+G     LP++  P K+RIY
Sbjct: 240  LNPSVPLQYSQWKTNGELDSS--QLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIY 297

Query: 300  NSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVAN-GNT 358
            NSP++ + VSLFR +T P+  IMNLTY+DPLSG + +CDAFCPL  +  L++   N    
Sbjct: 298  NSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEA 357

Query: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418
            + V  ++NN T+IQW+ +YQ+FA V+ +A T L+F AL+SYG+ +GL+ FQ+YQ + + +
Sbjct: 358  NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAF 417

Query: 419  ANNSLNEVGCESNDIAS-----TSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPA 473
             NNS N   C +ND  S     +S+LS + W     G+ YL   +   +  +PKVT+   
Sbjct: 418  GNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTS--VGE-YLTVGYTPNENPVPKVTYKID 474

Query: 474  INYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYS 533
            I ++G+Y++N++TPGCS+D TC++R IVN T++  V   +L++ L++QNN+ +KYD +YS
Sbjct: 475  IQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYS 534

Query: 534  GHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLS 593
            G L ++  +T+ YYS +  +N    +VADR+++ + S+D+        + LNG+FQYQ+S
Sbjct: 535  GQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQIS 594

Query: 594  NFTNSTDSKP-SIANTTLNSYTVQNFPKNASLFS-SMYNNTLWXXXXXXXXXXXELDEDL 651
            NFTN  DS P  IANT+LN + + NF  + SL +  + N+++             L+ DL
Sbjct: 595  NFTN--DSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDL 652

Query: 652  HVSSTAKYATGGTVEGISSYSDGIILF-GTFNLSSQPVSTLTFNGVFG-SFGNLETTL-- 707
             V ++ +  +         YS+G+++  G  N+S           +F  +F NL TT+  
Sbjct: 653  SVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS-----------LFKDNFKNLNTTMDG 701

Query: 708  ---RTYTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXT-FGLSLWSAGRNQFDDTLFSGA 763
                   N++   DELLVFNN Y++            + F L++ SAG N  +DT+F G 
Sbjct: 702  SLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGK 761

Query: 764  VTKNQFPGLYGSASIYS--NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFD 821
            V + Q+     SA + +  N  +   SL +   P     LND  T Y Y+  + S+LY  
Sbjct: 762  VVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYIT 821

Query: 822  NGKE-GPWTWFGTINSMRYSKNSTILAIG-TDGSTDEPILSLFNLTSFDVLANTTISENG 879
            N        W+G   ++ Y KN T+L +G  + +T    LSL NLTSFDV+    ++   
Sbjct: 822  NSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGS 881

Query: 880  TISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSES 939
            +ISS+++F +N +LLV GD+  S+ +CS LCLYNY   QW   ANNS++G++  +QL ++
Sbjct: 882  SISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQN 941

Query: 940  YDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPI--KSFIAEDNDIITWNETSL 997
              +L+ G + +     VN+   N+SN  V  L+   + P+   S I  ++ I+ WN+T L
Sbjct: 942  DTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVL 1001

Query: 998  SGYSDGDWQNLEF--DNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYP 1054
              +    W  +     +SS  SI  V  +  E           T DA+L+ G+  ++E+ 
Sbjct: 1002 FSFDGNSWTRVSVPGTDSSATSISSVQFISME----------GTDDALLLLGEFRHSEFG 1051

Query: 1055 --QASIYNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXX 1112
              ++ +YNF+ W+PY +    D         F N+D S    +Q  L             
Sbjct: 1052 DIKSIVYNFRDWIPYLL--YVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLTNQSFA 1109

Query: 1113 XXXXXXXXXXKGSLVR------KSGK--INRGFVVLIGLALALGTVVIIGITGVLLALVF 1164
                        +L +      K G+  ++RGFVVLIGLALAL TV ++G+ GVLLA +F
Sbjct: 1110 SSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIF 1169

Query: 1165 NGHSG--YEQVDPRADESEMIDTVPPEKL 1191
              + G  Y+ ++PR DE+ M++T+PPEKL
Sbjct: 1170 RDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1225 (35%), Positives = 643/1225 (52%), Gaps = 64/1225 (5%)

Query: 4    LLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGEALQLFGGFNALTFPQYEGQEN 63
            L+++L     +   SQL N++    I     P  D P   L     F  LT   Y GQ+N
Sbjct: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPD--LTYMNNFEELTVISYTGQQN 64

Query: 64   FTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXR 123
            FT   N ++    ++YYSNDTF+KL   S ++ V  IVP                    +
Sbjct: 65   FTVQANESS----LLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQ 120

Query: 124  QLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXX 183
            Q+L NL+ L+  PIF +++ +V  IL       F GNFS    +  GH    W       
Sbjct: 121  QILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTT 180

Query: 184  XXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQ--SIEIN 241
               PF GFGE SIVNS++KL+SDNILF G F  + + +LL    N + ++H    S++ +
Sbjct: 181  ELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFD 240

Query: 242  ELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSV-PSTSGSLEASLPYESYPKKVRIYN 300
            + +PL+ ++              +CP+  +  WS   +   +L+  L  E +P KVRIYN
Sbjct: 241  QSVPLKLSS---ITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297

Query: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS- 359
            S EE++ +SLFRIIT PSNGIMNLTY+DP SGEL  CDA+CPL+  + L     N   + 
Sbjct: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357

Query: 360  QVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYA 419
            + V ++NN T+++WS  YQ+FAFVN I VT LQF+AL+SYG    L S ++++     YA
Sbjct: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417

Query: 420  NNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQ 479
            NNS NE  CES    S + LS   W       +Y+  +     + +P VTF+P I Y G+
Sbjct: 418  NNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITYPGR 474

Query: 480  YTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETA 539
            YT N+YTPGC  D +C+ R IVNVTM       +L+S+L++Q N   K+D +Y+G L +A
Sbjct: 475  YTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSA 534

Query: 540  PVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK-NQTDETIPLNGMFQYQLSNFTNS 598
            P + + +   I  ++  +V+V DRL VI E +D +  +  D T  LNG+FQY  +N T S
Sbjct: 535  PEIIVTWDKAIGESD--SVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTAS 592

Query: 599  TDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTAK 658
              S     N T N Y + NFP +A+L+++  NN +            EL+++  +SS+ K
Sbjct: 593  IFS----TNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQK 648

Query: 659  YATGGTVEGISSYSDGIILFGTFNLSSQPV-STLTFNG-VFGSFGNLETTLRTYTNVSFQ 716
              T G   GI  YS+G++L GT+ + +      L+++G  F SFG L+  +    N +  
Sbjct: 649  LGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTID 708

Query: 717  QDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSA 776
              ELL+F+N Y+F            TF ++  SAG N  +D+L  G+  K     L G A
Sbjct: 709  GHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLA 768

Query: 777  SIYSNSSVAHFSLQN---GAQPYAACHLNDSVTAYAYRYGSVS----QLYFDNGKEGPWT 829
            S+ S+  V+  +L       QPY A ++ND+  AYA + GS      ++   N       
Sbjct: 769  SLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHM 828

Query: 830  ----WFGTINSMRYSKNSTILAIGTDGSTD----EPILSLFNLTSFDVLANTTISENGTI 881
                W   IN+  Y     ILAIGT+GS      +   S+ NLT ++ +A    S N  +
Sbjct: 829  LQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERV 888

Query: 882  SSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLS-ESY 940
            +SMV F  N+S+LVGG Y I   +C+ LCLYNY  K+WT F N+SITG+I +MQ + E  
Sbjct: 889  NSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946

Query: 941  DLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSL 997
             LL+ G +   N++++ LLS  + +  +   V     P+ SF+  D   ++II    + +
Sbjct: 947  TLLVGGLIKTNNESNIQLLSVEVGS-NIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEI 1005

Query: 998  SGYSDGDWQNL--EFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYPQ 1055
                 G W +   + +N S++S   V++       + ++    +   +L    N +E+  
Sbjct: 1006 LRLESGTWSSFGPQLNNDSIVSGFKVLS-----GTESKKRDEGSHIVLLEGTLNSSEWGN 1060

Query: 1056 AS--IYN--FQRWLPYYV-ANKADDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXX 1110
             +  +Y+   Q+W PY+V ++  + E    ++FF N +D  L  SQ +L           
Sbjct: 1061 LTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVL-----QSNNSD 1115

Query: 1111 XXXXXXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSGY 1170
                          S   K  KI+RGF+VLIGLALAL TV +IG+ G L+   F  ++GY
Sbjct: 1116 TSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNGY 1175

Query: 1171 EQVDPRADESEMIDTVPPEKLLKFL 1195
            E + PR ++ EM+DTVPPEKL+KF+
Sbjct: 1176 ESLKPRINQDEMLDTVPPEKLMKFI 1200

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1221 (34%), Positives = 655/1221 (53%), Gaps = 49/1221 (4%)

Query: 6    FLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQE 62
            FL+   +C    + L  +++  G+ N   P LD  G   E +QL G F  L + +Y GQ+
Sbjct: 11   FLVVAKLCS--GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQD 68

Query: 63   NFTGTINNNTDSRGIVYYSNDTFIKLING--SSDSY-VEKIVPXXXXXXXXXXXXXXXXX 119
            NFTG I++      ++Y+SN T ++L +   S++S+ V+ ++P                 
Sbjct: 69   NFTG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGA 127

Query: 120  XXXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXX 179
                Q+++NLSDLS   IF  SL+ V  I  +   AYFGG+F F       H +  W   
Sbjct: 128  VLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFV 187

Query: 180  XXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIE 239
                   PFGG G++S VNSI+ LD +NILF G F T+D+++ L +    + T+ S + E
Sbjct: 188  KNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDS-APE 246

Query: 240  INELLPLRAATWNTXXXXXXXXXAFICP-NSQKEAWSVPSTSGSLEASLPYESYPKKVRI 298
            ++  +PL+ A W +           +CP NS   AW    T+G  E S+ +   P K+R+
Sbjct: 247  LSHKIPLKTAKWTSDGSLQKDD--LVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRL 304

Query: 299  YNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT 358
            +N+      VSLFR+IT PSNGIMNLTY+DP SGEL  CDA+CPL+   +L AA +   +
Sbjct: 305  HNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAAS 364

Query: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418
            +  V   NN T +QWS  YQDFAFVN + VT + F+AL SYG +VG++ F+LY+D  + Y
Sbjct: 365  TDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVY 424

Query: 419  ANNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAG 478
            AN+S N   C S    S ++LS S+W QG   + Y+       QE  P VTFYP I Y+G
Sbjct: 425  ANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEA-PSVTFYPQIVYSG 483

Query: 479  QYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLET 538
             YT+N+ TPGC +D +C SRS+VN ++W    G++LSSI ++QNN+  KYD +YSG+LE 
Sbjct: 484  LYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLEN 543

Query: 539  APVLTLEYYSPISPNNPSNVVVADRLEVIVESVD--ILKNQTDETIPLNGMFQYQLSNFT 596
               + LEY   I     S ++VA ++ V  +  D  +  ++  +T  LNG+  Y LSN +
Sbjct: 544  EVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKY-KTGKLNGLLHYSLSNSS 602

Query: 597  NSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSST 656
            +   +  S  +T L  Y+V NF KN++ F   + N +            E+D+   V + 
Sbjct: 603  SYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVRTV 662

Query: 657  AKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQ 716
                 G  V G+ ++S+G+ + GTF+ S++      +NG F       + + T+TN +  
Sbjct: 663  TTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYNGSFFDIPLSHSNVTTFTNFTLD 720

Query: 717  QDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYG-S 775
              EL+   N Y                 L+  SAG N   +T+F G++T+N++  L G  
Sbjct: 721  GAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSF 780

Query: 776  ASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAY--------RYGSVSQLYFDNGKEG- 826
                ++ S +      G   Y A ++++S T YA+         YG    +Y D  KE  
Sbjct: 781  FISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYG--VSIYKDMAKERD 838

Query: 827  -PWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMV 885
              + W   + SM YSKNS++LA+G    T  P L L NLT+ +  A      N +I+S++
Sbjct: 839  LSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLI 898

Query: 886  FFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLIS 945
            FFD+N+S+LVGGD++ S+++CSGLCL++Y++K W+ F +N I G+I  M++     L++ 
Sbjct: 899  FFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLG 958

Query: 946  GAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGYSD 1002
            G  ++ +   VNL S ++++   N ++      I  FI  D   ++++  +   L   ++
Sbjct: 959  GFFDINDTKQVNLASMSLTDGSYN-ILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTN 1017

Query: 1003 GDWQNL--EFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAG----QNYAEYPQA 1056
             +W+++  +FD+SS+   +    ++      KR+      +++L+ G    + Y +   A
Sbjct: 1018 NNWESISAQFDDSSVFGGLSEFPIQQGGQNKKRE---EEKNSLLITGDLLHKTYGKI-SA 1073

Query: 1057 SIYNFQRWLPYYVANKADDEDP-SRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXX 1115
            ++Y+F  W+PY+    A   D   ++  ++N+D S  ++ Q +L                
Sbjct: 1074 ALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTS 1133

Query: 1116 XXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHS-GYEQVD 1174
                      L  K  KI RGFVVLIGLALA+GT+ ++G+ G+ L   F   S  Y+ ++
Sbjct: 1134 SPTSSSPS-QLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLE 1192

Query: 1175 PRADESEMIDTVPPEKLLKFL 1195
            PRADESEMIDTVPPEKL++F+
Sbjct: 1193 PRADESEMIDTVPPEKLMRFI 1213

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1209 (34%), Positives = 642/1209 (53%), Gaps = 44/1209 (3%)

Query: 17   ASQLENLKNKHGIVNIGTPRLDF---PGEALQLFGGFNALTFPQYEGQENFTGTINNNTD 73
             S L+ L++K G+     P LD        +QL G F  +   +Y GQ+NFTG ++ N +
Sbjct: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPE 79

Query: 74   SRGIVYYSNDTFIKLINGSSDSYV---EKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLS 130
            +  ++YYSN+TF+++ + S  S V   + IVP                    RQLL+NLS
Sbjct: 80   N-ALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLS 138

Query: 131  DLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGG 190
             L  R IF   L  V  I  +    +FGG+F ++  +   HS+  W          PFGG
Sbjct: 139  SLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGG 198

Query: 191  FGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAAT 250
            FG+ S VNSI+ LD+ NILF G F  +D+ T  + N N S T+++   E+   + L++A 
Sbjct: 199  FGKNSTVNSILNLDNSNILFAGNFSAVDN-TQQLNNINVSNTSNTSVPELGHQISLQSAA 257

Query: 251  WNTXXXXXXXXXAFICPNSQKEAW-SVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVS 309
            W           A  CP+++   W    ST G  E  +P E+ P K+R++N+ +    VS
Sbjct: 258  W--VSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVS 315

Query: 310  LFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRLDNNLT 369
            LFRI+T PSNGIMNLTY+DP +GEL +CDA+CPL+   +L    +       V+   N T
Sbjct: 316  LFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYFENRT 375

Query: 370  DIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCE 429
             +QWS  +QDFAFVN + V+DL F+AL SYG +VGL+  +LY+   + YANN+LN   C 
Sbjct: 376  TLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCA 435

Query: 430  SNDIASTSALSDSE-WQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPG 488
                 S + LS+S  W  G    +YL    +   ET P V FYP+I Y G YT+++ TPG
Sbjct: 436  QGSATSNALLSNSSAWDSGSSEGNYLSTSVQD-SETNPFVIFYPSIIYPGVYTIDVLTPG 494

Query: 489  CSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYS 548
            C  D +C +R I+N T+      ++L SI ++QNN+  K+D +YSG L++   +TLE+  
Sbjct: 495  CLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDG 554

Query: 549  PISPNNPSNVVVADRLEVIVESVD--ILKNQTDETIPLNGMFQYQLSNFTNSTDSKPSIA 606
             I+      V+VA ++ V +E  D  + +N T   I  NG+  Y  SN ++      S +
Sbjct: 555  AINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFI--NGLLHYSTSNTSSFLSELGSYS 612

Query: 607  NTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDEDLHVSSTAKYATGGTVE 666
             T L  Y+V   PK++++F++M+ + L            +L  +L +        G  + 
Sbjct: 613  ATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDIS 672

Query: 667  GISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNNE 726
             IS YS G+I+ GTFN SS+P +   FNG F +     +T+RT++N++  Q E+L+F+  
Sbjct: 673  TISEYSGGLIIVGTFNGSSEPAAR-GFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKN 731

Query: 727  YVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVA- 785
             +                L + SAGRN ++DTLF G V +N +  L GS  I +NS    
Sbjct: 732  IILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVS 791

Query: 786  -HFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYF------DNGKEGPWT-WFGTINSM 837
             +F    G  PY A  +++S TAYAY     +   F      D+G     + W G + +M
Sbjct: 792  QNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAM 851

Query: 838  RYSKNSTILAI-GTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVG 896
              SKN ++LAI G D  TD  +L + N +S + LA+       +++S++FF RN+S+LVG
Sbjct: 852  ASSKNDSLLAIGGKDQHTDSQLL-VTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVG 910

Query: 897  GDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSV 956
            G + +++  CSGLCL+NY  K+W+ F NNSI G I  M++  + +LLI+G+  +     V
Sbjct: 911  GSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGV 970

Query: 957  NLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGYSDGDWQNLE--FD 1011
            +L S  + +   + ++ + N  +  F++ D   N+++ +++TSL     G WQ +   F 
Sbjct: 971  SLASICLKD-SSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFT 1029

Query: 1012 NSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYP--QASIYNFQRWLPYY 1068
             +S    +DV  +K      KR + S     +L+ G   +A++    A+ Y+   W P+ 
Sbjct: 1030 ENSKFKGLDVFPLKDTTRKQKRDSSSK---VLLITGSLQHAKFGSINAAFYDSGEWTPFL 1086

Query: 1069 VANKA-DDEDPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXXXXXXXXXXXXXXKGSLV 1127
             +N+A    D   +  F N+D S   D +  L                         +L 
Sbjct: 1087 SSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPS-NLQ 1145

Query: 1128 RKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVF-NGHSGYEQVDPRADESEMIDTV 1186
            RK  KI+RGF+VLI LALALGT+ ++G+ GV+ +  F +   GY+   PR DE+EMIDTV
Sbjct: 1146 RKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDTV 1205

Query: 1187 PPEKLLKFL 1195
            PPEKL++F+
Sbjct: 1206 PPEKLMRFI 1214

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1176 (33%), Positives = 612/1176 (52%), Gaps = 55/1176 (4%)

Query: 44   LQLFGGFNALTFPQYEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPX 103
            +QL G      +  Y+GQ+NFT T +++ +   ++YYSN+T ++L    +D  +  I+P 
Sbjct: 12   IQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPTDVEMRHIIPF 70

Query: 104  XXXXXXXXXXXXXXXXXXXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSF 163
                               RQ+L NL+ LS +PIFE  L  V+ I  D  V YFGG+ ++
Sbjct: 71   MDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGDITY 130

Query: 164  DNGSTVGHSVATWXXXXXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLL 223
            +N    G SV  W          PFGGFG  S VNSII+L+++N+LFTG+F  L++ + +
Sbjct: 131  NNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLENNSFV 190

Query: 224  ITNENTSKTNHSQSI-------EINELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSV 276
                  SKTN +++        E+ + + LR ATWN          AFICPNS ++AW  
Sbjct: 191  ------SKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVD--AFICPNSDQQAWYS 242

Query: 277  PSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLN 336
              + G +  + P      K+RIYN+P   N +SLFR+I  P NGI+NLTY+DP+S ++ +
Sbjct: 243  EGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKH 302

Query: 337  CDAFCPLMLQDSLKAAVAN-GNTSQVVR-LDNNLTDIQWSYDYQDFAFVNKIAVTDLQFL 394
            C   CPL  +++L  A+ N    S V+R ++NN T+I+W+  YQ+FAFVN++ +T LQF+
Sbjct: 303  CTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFV 362

Query: 395  ALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGC-ESNDIASTSALSDSEWQQGLFGQSY 453
            A +SY   VGLS FQ+YQD+   + NNS NE  C  SNDIAS   LS + W       SY
Sbjct: 363  ASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSY 422

Query: 454  LVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSI 513
            L   +   Q T P +T++  IN  G+Y +NL TPGC  D TC++R IVNVT +    G+I
Sbjct: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482

Query: 514  LSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESV-- 571
            L S L++QNN  +KYDQ+++G L  +  + +EYYS I+ N  +  VV   ++V+  S+  
Sbjct: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISS 542

Query: 572  DILKNQT--DETIPLNGMFQYQLSNFT-NSTDSKPSIANTTLNSYTVQNFPKNASLFSSM 628
            + + +Q   D ++ LNG+F+Y  SNFT ++      I  T L+ + V NF K AS+F+  
Sbjct: 543  EFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVD 602

Query: 629  YNNTLWXXXXXXXXXXXELDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPV 688
             N  L+                  V ST    + G + G+ S  +G+++FG+     +  
Sbjct: 603  QNQNLYLGSTNGSVYELNSLNGSSVPSTENNLS-GLINGMYSVEEGLVIFGSIAHRGREY 661

Query: 689  STLTFNGVFGSFGNLETTLRTYTNVSFQQ----DELLVFNNEYVFXXXXXXXXXXXXTFG 744
              +  N    S   L+         SF        LLVF+N  +F               
Sbjct: 662  GAVILN---KSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRN 718

Query: 745  LSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDS 804
            L L +AG+N  DD L  G +          S  I SN + + FSL +      A +LND+
Sbjct: 719  LDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDT 778

Query: 805  VTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNL 864
               Y+   G+V+     + +  PWTW  T+  + YS    +L    + S    I+ L +L
Sbjct: 779  KALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIV-LIDL 837

Query: 865  TSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFAN 924
             S  V+ +T       I+++V F  N++ LVGGD+ +S+  C GLCLYNY+   W+ F N
Sbjct: 838  FSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNWSSFLN 897

Query: 925  NSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIA 984
            NSITGNI++++ +++  +L+SG + V     +NLLS N+++ + + L+++++  +  FI 
Sbjct: 898  NSITGNISQIKFNDT-QMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFIL 956

Query: 985  EDNDIITWNETSLSGYSDGDWQNLE-FDN--SSLISIVDVIAVKTEPALDKRQTFSSTFD 1041
              N ++ WN T +   +   W NL  FD+  ++ I+ ++     + PAL         FD
Sbjct: 957  VRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSNPAL----IIYGQFD 1012

Query: 1042 AILVAGQNYAEYPQASIYNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLXX 1101
            ++     N      A IY+F  W PY+  +       +   FF ++D S   ++++++  
Sbjct: 1013 SMKYGTIN------AVIYDFNSWYPYFEVDVV--SQTATPLFFADRDQSSYGNTRHVVPD 1064

Query: 1102 XXXXXXXXXXXXXXXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLA 1161
                                       K  KI RGFVVLIGLALAL T++++GITGV++A
Sbjct: 1065 HIIVSSSHSSSAPSSSSSHKTN----EKPYKIRRGFVVLIGLALALATLIVLGITGVVIA 1120

Query: 1162 LVFNG--HSGYEQVDPRADESEMIDTVPPEKLLKFL 1195
            L+FN   +  Y+ +     ++     + PEKL++ L
Sbjct: 1121 LLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1225 (32%), Positives = 611/1225 (49%), Gaps = 89/1225 (7%)

Query: 17   ASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTGTINNNTD 73
             S LE++     I +  TPRLD      E L +F  F A  +  Y+GQ+ FTG   +   
Sbjct: 20   GSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGS 79

Query: 74   SRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXXXXXXRQLLYNLSDLS 133
            S  ++YYS  T+++L     D+ V +IVP                     QL+YNLS L 
Sbjct: 80   S--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLE 137

Query: 134  LRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXXXXXXXXXXPFGGFGE 193
            +  I   SL  V  IL D  + YFGG F++ +G+  GHS   W          PFGGFG 
Sbjct: 138  VTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGR 197

Query: 194  ESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQ----SIEINELLPLRAA 249
             S VN+I+KL    +LF G F  L+  +   T    + T   Q    +IE N L  LR +
Sbjct: 198  GSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYS 257

Query: 250  TWNTXXXXXXXXXAFICPNSQKEAWSVPSTS-----GSLEASLPYESYPKKVRIYNSPEE 304
            T  +          FICP S  ++W VP +      G L   + +   P K+RIYNS + 
Sbjct: 258  TITSDGHLDKG--KFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKN 315

Query: 305  HNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRL 364
             N + LFRI+T PS  IMN+TY+DP +GEL  CDA+CPLM + +L +  A    + V RL
Sbjct: 316  GNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVARL 375

Query: 365  DNN-LTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSL 423
             N+    I+W+ DYQ+FAF+N+I + +++F+AL SYG+ VGL   +L+Q     Y N++L
Sbjct: 376  VNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTL 435

Query: 424  NEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMN 483
            N+  C    ++  S  ++  W QG    SYL A+     E+ P V   P I ++G YT+N
Sbjct: 436  NQPNCGEQQLSPFSTTANI-WHQGATDASYLSANV---VESNPMVNVKPVIPHSGTYTLN 491

Query: 484  LYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLT 543
            LYTPGC  D TC  R IVNVT+ +   G+ L +  ++QNN  +KYD +Y+GHL+  P + 
Sbjct: 492  LYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVR 550

Query: 544  LEYYSPISPNNPSNVVVADRLEVIVESVDILKN-QTDETIPLNGMFQYQLSNFTNSTDSK 602
            +E+ SPI+      ++VADR+  I++S+D L + +      LNG+FQY     T +  S 
Sbjct: 551  MEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQY-----TPAGSSL 605

Query: 603  PSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXXXXXXXXELDE--DLHVSSTAKYA 660
             +     +N     + P+  SL   +Y+  L               +  D +     +  
Sbjct: 606  DNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQD 665

Query: 661  TGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDEL 720
              G++ GIS YS G++  G FNLSS P S L ++G FGSF +L +   +  N++    EL
Sbjct: 666  VPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTIDGSEL 725

Query: 721  LVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS 780
            L+FNN++++             F LS  SA  N  +D LF+G++   +    +G+ ++ +
Sbjct: 726  LLFNNKFIY-NTSTSQMLTSSMFQLSALSAAANSNNDLLFTGSIADIKHGSAHGAVALDA 784

Query: 781  NSSV--AHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK--EGPWTWF----- 831
              ++  +     +GA+ +   +LND+ TAYAY   S +      G   E P   F     
Sbjct: 785  EGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNN 844

Query: 832  -GTINSMRYSKNSTILAIGTDGSTDEP-ILSLFNLTSFDVLANTTISENGTISSMVFFDR 889
              T+  M Y K +  L I T+     P  L L++L +   +A   ++    I+S+V F  
Sbjct: 845  IATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIVLFGE 904

Query: 890  NSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMN 949
            +++LLVGG +      C  LCLYN+ ++ W+ FA+  I+G I ++Q   + +L+  G+M 
Sbjct: 905  DNTLLVGGSFE--KDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGSMT 962

Query: 950  VANKTSVNLLSFNMSNYEVNPLVWDSNGPI-----------KSFIAEDNDIITWNETSLS 998
            V ++ ++  L+F++    V       NG               ++AED   + W+     
Sbjct: 963  VQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQV-WH----- 1016

Query: 999  GYSDGDWQNLEFDNSSLISI--VDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYPQ 1055
             YS  +W+ +   +   I I  + ++ +    + +KR    +  + +++ GQ N +EY +
Sbjct: 1017 -YSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGN--ELVVIHGQMNSSEYGE 1073

Query: 1056 --ASIYNFQRWLPYY--VANKADDE-DPSRTTFFTNQDDSQLYDSQNLLXXXXXXXXXXX 1110
              A  YNF+ W PYY  + + A +E +  R   F NQD S+   +   L           
Sbjct: 1074 INAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPPT- 1132

Query: 1111 XXXXXXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSGY 1170
                                 K+ +G+VVLI L LAL T+ ++GI GV+LA  F  H+ Y
Sbjct: 1133 ----------------AEPKRKLAKGYVVLIALGLALATIALLGIIGVILAYAFGDHNAY 1176

Query: 1171 EQVDPRADESEMIDTVPPEKLLKFL 1195
            + + PR +E EM+ TVPPEKL+KF+
Sbjct: 1177 QPLKPRINEDEMLKTVPPEKLMKFI 1201

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1235 (33%), Positives = 644/1235 (52%), Gaps = 69/1235 (5%)

Query: 2    YGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQY 58
            Y LL L F +  L+  SQ+  + N   I     P LD        L +F  F    +  Y
Sbjct: 6    YTLLVLSFVA-GLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTY 64

Query: 59   EGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPXXXXXXXXXXXXXXXX 118
            +GQ+ FTG  +   +S  ++YYSN+T+++L      + ++KIVP                
Sbjct: 65   KGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEG 122

Query: 119  XXXXRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWXX 178
                 QL+YNLS   +  I +  L  V  IL D  V YFGG F++++G+  GHSV  W  
Sbjct: 123  HRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDA 182

Query: 179  XXXXXXXXPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLI-TNENTSKTNHSQS 237
                    PF GFG+ S+VN+IIKLD  NILF G+F T+D+  LL   N ++S  ++S +
Sbjct: 183  TDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTN 242

Query: 238  IEINELLPLRAATWNTXXXXXXXXXAFICPNSQKEAWSVP-STSGSLEASLPYESYPKKV 296
            IE N L  LR ++            AF+CP    ++W++P ST G L   +  +  P K+
Sbjct: 243  IETNALASLRFSSL--VHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKI 300

Query: 297  RIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANG 356
            RIYNS + +N V+LFRI+T PS  IMN+TYVDP++G L  CDA+CPL     L     N 
Sbjct: 301  RIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENS 360

Query: 357  NTSQVVRL-DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTL 415
             +S +    +NN   ++W+  YQ+FAFVN++ + +L F+A+ S+G  VGL   +L+Q   
Sbjct: 361  TSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEY 420

Query: 416  TTYANNSLNEVGCESNDIASTSALS-DSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAI 474
             TY NN+LN+  C+S      S +S D+ W QGL  QSY+   F  G+   P VT  P+I
Sbjct: 421  DTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSI 477

Query: 475  NYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSG 534
             Y G YT+NL TPGC +D TC  R IVNVT+ ++ G  +++   ++QNNE +KYD ++ G
Sbjct: 478  PYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNR-WIYQNNENLKYDPLFRG 536

Query: 535  HLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDIL--KNQTDETIPLNGMFQYQL 592
            +L+ +P + LE+  PI P   +NV+VADR+  I++S++ L  KN T  +  LNG+FQY  
Sbjct: 537  YLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAA 596

Query: 593  SNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWXXXXX----XXXXXXELD 648
            SNFTN T+    + +T ++ Y V+N P ++SLF  +YN+TL+               + D
Sbjct: 597  SNFTN-TNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDD 655

Query: 649  EDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLR 708
             +  +       T G V GI  YS+G+ L    N ++   S+L+FNG   +         
Sbjct: 656  WNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNM-ASSLSFNGSISTIFRSNAPSL 714

Query: 709  TYTNVSFQQDELLVFNNEYVFXXXXXXXXXXXXTFGLSLWSAGRNQFDDTLFSGAV--TK 766
            +  N++    E+LVF+N YV+            T  LSL SAG N  DD + +G V  TK
Sbjct: 715  SILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTK 774

Query: 767  NQFPGLYGSASIYSNSS---VAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQ------ 817
            +  P   G+ +I ++S+    +     +    Y    +NDS +AYAY   S+        
Sbjct: 775  HFVPN--GAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIV 832

Query: 818  LYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLF--NLTSFDVLANTTI 875
            +Y ++  E   T   T+N M Y K+S +LA+ T G T + + SL+  +L++       T 
Sbjct: 833  VYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSG-TSQGLASLYIHDLSADFAPIKETF 891

Query: 876  SENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQ 935
                 I++MV F RN +LLVGG +  +   C  LCLYNY    WT+F + +ITG+I ++Q
Sbjct: 892  EIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQ 949

Query: 936  LSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSN-GPIKSFIAEDN---DIIT 991
              +   L+++G +  ++   + L+  ++SN E+   +  +N G  +  +   N   ++I 
Sbjct: 950  FLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIA 1009

Query: 992  WNETSLSGYSDGDWQNLEFDNSSLISIVDVIAVKTE----PALDKRQTFSSTFDAILVAG 1047
             +   +  + DG W+N+  D S    I  +  + T+     ++ KR       + ++V  
Sbjct: 1010 HDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVG---NELVVIN 1066

Query: 1048 QNYAEYPQASI----YNFQRWLPYYVANKAD---DEDPSRTTFFTNQDDSQLYDSQNLLX 1100
             N++      I    Y+F  W PYY +   +   DE   +   F N+D S    SQ  L 
Sbjct: 1067 GNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYL- 1125

Query: 1101 XXXXXXXXXXXXXXXXXXXXXXKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLL 1160
                                    +  + + K+ + FVVLI LALAL TV ++G+ GVL 
Sbjct: 1126 --------SNDNDNDDTPAASEPATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLF 1177

Query: 1161 ALVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL 1195
            A +F  H+ YE + PR +E+EM+ TVPPEKL+KF+
Sbjct: 1178 AYLFGDHNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212

>TPHA0M02060 Chr13 (423979..425589) [1611 bp, 536 aa] {ON} Anc_6.369
           YNR045W
          Length = 536

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 580 ETIPLNGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFPKN-ASLFSSMYNNTL 633
           + IPLNG +    +NFTNS  S   + N  L ++ +  +PKN   L  S+YNN +
Sbjct: 241 DKIPLNGFYSLWKTNFTNSIKSFSEVQNLKLPNWRI--YPKNLQKLCESLYNNDM 293

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 12/79 (15%)

Query: 788 SLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILA 847
           S +NG   +A+C  +  +  +  R GSV+Q +F +  +        IN++++ K+   LA
Sbjct: 244 SAENGTNTFASCGSDGYIYLWDVRTGSVAQTFFVSDSD--------INAVQFFKDGNALA 295

Query: 848 IGTDGSTDEPILSLFNLTS 866
            G    +D+ I+ LF+L S
Sbjct: 296 SG----SDDGIIRLFDLRS 310

>AFL206C Chr6 complement(46599..48545) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR341C and
           YHR091C (MSR1)
          Length = 648

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 79/201 (39%), Gaps = 38/201 (18%)

Query: 773 YGSASIYSNSSVA-HFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWF 831
           YGS  +  N  V   FS  N A+P+ A HL  ++       G +S LY   G E      
Sbjct: 175 YGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIG-----GFLSNLYEKMGWE------ 223

Query: 832 GTINSMRY----SKNSTILAIGTD--GSTD----EPILSLFNLTSFDVLANTTISENGTI 881
             +  M Y     K   +LA+G +  GS +    +PI  LF++    V  N  I + G  
Sbjct: 224 --VIRMNYLGDWGKQFGLLAVGFEKYGSEEALEKDPINHLFDVY---VRVNKDIEQEG-- 276

Query: 882 SSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNI-TEMQLSESY 940
            S+   +  +         + D D   L       K W KF   SI   I T  +L+  Y
Sbjct: 277 DSLPLEESTNGRARAYFKKMEDGDPEAL-------KIWQKFRELSIQKYIDTYARLNIQY 329

Query: 941 DLLISGAMNVANKTSVNLLSF 961
           D+  SG   V  ++  N L  
Sbjct: 330 DVY-SGESQVKKESMENALKL 349

>NDAI0C03920 Chr3 (890187..892775) [2589 bp, 862 aa] {ON} Anc_5.285
          Length = 862

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 876 SENGTISSMVFFDRNSSLLVG-GDYHISDADCSGLCLYNYDQKQWTKFANNS 926
           S++G  +S+V  +R++S+++   D+  +++D SG+ + +Y  ++W KF+  +
Sbjct: 499 SKDGVDNSLVLNERSTSVVLKDADFFKANSDQSGIYITSYSDERWAKFSKQA 550

>NCAS0A11640 Chr1 (2315022..2316227) [1206 bp, 401 aa] {ON}
           Anc_3.459 YPR124W
          Length = 401

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 581 TIPLNGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNN 631
           ++ ++GM Q  +S+ TNS+DS  S+ N  +NSY  + +     LF  ++ N
Sbjct: 89  SMAMDGMGQMSMSSGTNSSDSMASM-NMEMNSYLTRKYKNYPVLFEKLHAN 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 127,207,926
Number of extensions: 5659693
Number of successful extensions: 16855
Number of sequences better than 10.0: 57
Number of HSP's gapped: 16993
Number of HSP's successfully gapped: 61
Length of query: 1195
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1074
Effective length of database: 39,606,813
Effective search space: 42537717162
Effective search space used: 42537717162
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)