Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038208.255ON68768737090.0
ZYRO0C01826g8.255ON69969224690.0
Suva_2.2688.255ON69567823110.0
YDR108W (TRS85)8.255ON69868522750.0
Smik_4.3548.255ON69868122460.0
NCAS0B038808.255ON70669622440.0
Skud_4.3698.255ON69868322280.0
Kpol_392.118.255ON67567021910.0
NDAI0J014108.255ON71669021620.0
KAFR0B055708.255ON66967920530.0
CAGL0B01705g8.255ON67266620060.0
TPHA0B032608.255ON71470819780.0
KLTH0G13860g8.255ON70871418610.0
SAKL0H17226g8.255ON71973518450.0
Kwal_56.235838.255ON70071218190.0
KNAG0H032708.255ON64870416320.0
TBLA0E043808.255ON88965115140.0
Ecym_43168.255ON62367013640.0
AGR096C8.255ON62366813411e-177
KLLA0F18953g8.255ON64768213431e-177
KAFR0D017905.190ON1942113850.17
TPHA0P015103.19ON84765781.0
KNAG0C065305.690ON897101761.8
YJL073W (JEM1)1.297ON64578742.6
AGL114C8.400ON78671724.7
TDEL0A056908.623ON85093716.0
Kpol_1011.28.72ON584135716.3
YLR233C (EST1)8.415ON69976716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03820
         (687 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...  1433   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   955   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   894   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   880   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   869   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   868   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   862   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   848   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   837   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   795   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   777   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   766   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   721   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   715   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   705   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   633   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   587   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   530   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   521   e-177
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   521   e-177
KAFR0D01790 Chr4 complement(355461..361289) [5829 bp, 1942 aa] {...    37   0.17 
TPHA0P01510 Chr16 complement(306713..309256) [2544 bp, 847 aa] {...    35   1.0  
KNAG0C06530 Chr3 complement(1264404..1267097) [2694 bp, 897 aa] ...    34   1.8  
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    33   2.6  
AGL114C Chr7 complement(490370..492730) [2361 bp, 786 aa] {ON} S...    32   4.7  
TDEL0A05690 Chr1 (1000974..1003526) [2553 bp, 850 aa] {ON} Anc_8...    32   6.0  
Kpol_1011.2 s1011 complement(2303..4057) [1755 bp, 584 aa] {ON} ...    32   6.3  
YLR233C Chr12 complement(607425..609524) [2100 bp, 699 aa] {ON} ...    32   6.9  

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score = 1433 bits (3709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/687 (100%), Positives = 687/687 (100%)

Query: 1   MVKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDS 60
           MVKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDS
Sbjct: 1   MVKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDS 60

Query: 61  LYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDA 120
           LYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDA
Sbjct: 61  LYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDA 120

Query: 121 TQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLY 180
           TQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLY
Sbjct: 121 TQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLY 180

Query: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240
           HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV
Sbjct: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240

Query: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILH 300
           FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILH
Sbjct: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILH 300

Query: 301 QPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQP 360
           QPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQP
Sbjct: 301 QPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQP 360

Query: 361 RRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLS 420
           RRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLS
Sbjct: 361 RRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLS 420

Query: 421 DYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVE 480
           DYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVE
Sbjct: 421 DYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVE 480

Query: 481 TYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETIL 540
           TYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETIL
Sbjct: 481 TYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETIL 540

Query: 541 AECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIV 600
           AECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIV
Sbjct: 541 AECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIV 600

Query: 601 TRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKET 660
           TRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKET
Sbjct: 601 TRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKET 660

Query: 661 LKNVEIDSRTIAPPKDQVHVEEKVITD 687
           LKNVEIDSRTIAPPKDQVHVEEKVITD
Sbjct: 661 LKNVEIDSRTIAPPKDQVHVEEKVITD 687

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/692 (67%), Positives = 550/692 (79%), Gaps = 37/692 (5%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           +KLSYENYMNLL HLDHG + VP DIA+RIVSNA+SPVI V+STPELDRHI++T+HLDSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 62  YMLLRFFGDCVGDRDQAHECTS----------AGSPS-GDDRAEKSSSSTLAVASGPS-- 108
           YM LRFFGDCV DRDQA+E             A  PS  D+  E S  S+L V S  S  
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 109 --------------RKRSNSLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESF 154
                         RKRSNSLFQRD TQSQY+RFTRP+ DL+ES+D+NDMLFDYH+LE F
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 155 LENILLLIEKSTNDKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPI 214
           LEN L L+E+ T+D TP +LLKKSLYH+FFSLAISST YLSPYETFNHPVVSLIA+DI  
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 215 GQGYEEARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLK 274
           GQGYEEARDLL KFKNLNHT +NFP+F++T D+LPVFLLCYN +SE++   CQ L  +LK
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 275 KQLFVEGILLPLWKDNYKTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVL 334
           KQLFVE +LLPLWK +Y    +V LHQPIM+SL+E+LYFL+ P+   L L+LIN  Y++L
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360

Query: 335 EILINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDA 394
           E L+  LM+PFM+RKISFWEETILQPR+SLFHG+ F K+ MSK ++G+N HQ  S+ KD 
Sbjct: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420

Query: 395 NGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSV 454
           NG EYFV+SS EFLMRKLADWSMMLSD+KTAYSTY+SL HDLE++PKYLASC EWC+VSV
Sbjct: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480

Query: 455 LMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFL 514
           LMGAQNIVT KM+K DIDPLIQRA+ETYENCA  D   +G +      PVRSYETRCMFL
Sbjct: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAA-DEDSTGEEL---YVPVRSYETRCMFL 536

Query: 515 ASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVN 574
           ASELFLSLSDTWTSTPYAL +LETIL ECRLGPCS+IMIWERLS+CY QRID RIRHK +
Sbjct: 537 ASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTS 596

Query: 575 -DGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWC 633
             GA +  +++  +++S +E     IVTRGLTR RKAAFF+LIAANKW EQKQW+QA WC
Sbjct: 597 AQGAKAMTDELAPDEESNEE-----IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWC 651

Query: 634 LKDTEDAYAGIEFVNRKDLALAKLKETLKNVE 665
           LK+ E+AYAG++FVNR+DL LA+LK  +   +
Sbjct: 652 LKEIEEAYAGLDFVNREDLILARLKRQMNEAQ 683

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/678 (63%), Positives = 536/678 (79%), Gaps = 16/678 (2%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNLL HLDH  + VP +IAKRIVSNAI+PVI VTSTP  D+HIQE + +DSLYM
Sbjct: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECT-----SAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQR 118
           LLRFFG CV DRDQA+E          SPS +  ++  +    +     SR RSNSLFQR
Sbjct: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122

Query: 119 DATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178
           D+TQSQY+RFTRPL DL+E+ DTNDMLF+YH+LE FL+N L L+  +T++K PH LLKKS
Sbjct: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKS 182

Query: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNF 238
           +YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T++F
Sbjct: 183 IYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESF 242

Query: 239 PVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTA--TQ 296
           P+F+NTN++LPVFLLCYN +S+E++E CQ+L KKLKKQLFVE ILLPLWKD++     + 
Sbjct: 243 PIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVENSN 302

Query: 297 VILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEET 356
           + LHQP+M+SL+E+L+FLR P++ +LSL LINSIYD+L+ L+  LMIPFM+RKISFWEET
Sbjct: 303 IQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEET 362

Query: 357 ILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWS 416
           ILQPR+SLF+G+KF K+FM+K     N HQ  S+ KD  G EYF SSS+EFLMRKLADWS
Sbjct: 363 ILQPRKSLFNGAKFFKKFMNKAPVNGN-HQHNSLTKDNQGNEYFASSSSEFLMRKLADWS 421

Query: 417 MMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQ 476
           MMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI+PLI+
Sbjct: 422 MMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIE 481

Query: 477 RAVETYENCALYDTQLSGSKK---SNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYAL 533
           RA+ TYENC+    Q   SK+   S  + PVRSYETRCM LASELFLSLSDTWTSTPYA+
Sbjct: 482 RALATYENCS--RMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539

Query: 534 RNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVND--GAMSNEEKVENEDDSE 591
           + LETIL EC+LGPCSQIM+WERLS+CY  R+D R++HKV     ++ N E + N+D+ +
Sbjct: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYD 599

Query: 592 KEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRK 650
            +H T  DI++ GLTR RKAAFF+L+AA KWAEQKQWRQ SWCLKD E+ Y+ I+F++  
Sbjct: 600 TDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGN 659

Query: 651 DLALAKLKETLKNVEIDS 668
            L L+ LK  L + ++DS
Sbjct: 660 GLILSNLKNQLNSKDVDS 677

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/685 (62%), Positives = 531/685 (77%), Gaps = 27/685 (3%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNLL HLD+  + VP +IAKRI+SNAI+PVI VTSTP  D+HIQET+ +DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECTSA--------GSPSGDDRAEKSSSSTLAVASGPSRKRSNSL 115
           LLRFFG CV DRDQA+E             S S D   +  +     ++   SR RSNSL
Sbjct: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122

Query: 116 FQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLL 175
           FQRD+TQSQYIRFTRPL DL+E+ D NDMLF+YH+LE FL+N L L+  +T++  PH LL
Sbjct: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLL 182

Query: 176 KKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTT 235
           KKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T
Sbjct: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242

Query: 236 KNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDN--YKT 293
           +NFP+F+NTN++LPVFLLCYN DS+E++E CQ+L KKLKKQLFVE ILL LWKD+  Y  
Sbjct: 243 ENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYDE 302

Query: 294 ATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353
            + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+SFW
Sbjct: 303 NSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFW 362

Query: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413
           EETILQPR+SLF+G+KF K+FM+K     N HQ  S+ +D+ G EYF SSS+EFLMRKLA
Sbjct: 363 EETILQPRKSLFNGAKFFKKFMNKNPVNGN-HQHNSLTRDSQGNEYFASSSSEFLMRKLA 421

Query: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473
           DWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI+P
Sbjct: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481

Query: 474 LIQRAVETYENCALYDTQLSGSKKSNSM---APVRSYETRCMFLASELFLSLSDTWTSTP 530
           LI+RA+ TYENC+    Q    K+SNS+    PVRSYETRCM LASELFLSLS+TWTSTP
Sbjct: 482 LIERALATYENCS--RIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTP 539

Query: 531 YALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDS 590
           YA++ LETIL EC+LGPCSQIM+WERLS+CY  R+D RI+H+V  GAM  + K  + +D 
Sbjct: 540 YAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRV--GAMKKDAK--DTEDL 595

Query: 591 EKEH-------THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAG 643
             EH       T  DI++ GLTR RKAAFF+LIAA KWAEQKQWRQ SWCLKD E  Y+ 
Sbjct: 596 RGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSE 655

Query: 644 IEFVNRKDLALAKLKETLKNVEIDS 668
           I+F++   L L+KLK  L   ++DS
Sbjct: 656 IKFLHGNGLILSKLKNQLNLKDVDS 680

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/681 (63%), Positives = 529/681 (77%), Gaps = 19/681 (2%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNLL HLD+  + VP +IAKRIVSNAI+PVI VTSTP  D+HIQE + +DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECTSAGSPS--GDDRAEK---SSSSTLAVASGP---SRKRSNSL 115
           LLRFFG CV DRDQA+E          GD  A     S S  L V + P   SR RSNSL
Sbjct: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122

Query: 116 FQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLL 175
           FQRD+TQSQYIRFTRPL DL+E+ DTNDMLF+YH+LE FL+N L L+  +T++  PH LL
Sbjct: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLL 182

Query: 176 KKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTT 235
           KKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T
Sbjct: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242

Query: 236 KNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTA- 294
           +NFP+F+NTN++LPVFLLCYN +S+E++E CQ+L KKLKKQLFVE +LL LWKD++  A 
Sbjct: 243 ENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEAN 302

Query: 295 -TQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353
            + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+SFW
Sbjct: 303 NSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFW 362

Query: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413
           EETILQPR+SLF+G+KF K+FM+K  S  N H   S+  D  G EYF SSS+EFLMRKLA
Sbjct: 363 EETILQPRKSLFNGAKFFKKFMNKNPSNGN-HHHNSLTSDNQGNEYFASSSSEFLMRKLA 421

Query: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473
           DWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ IVT KM+K DI+P
Sbjct: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINP 481

Query: 474 LIQRAVETYENCA-LYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYA 532
           LI++A+ TYENC+ +  ++   S  SN++ PVRSYETRCM LASELFLSLSD WTSTPYA
Sbjct: 482 LIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPYA 541

Query: 533 LRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMS----NEEKVENED 588
           ++ LETIL EC+LGPC QIMIWERLS+CY  R+D RI+H+V  GAM     + E +   D
Sbjct: 542 IQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRV--GAMKKGIRDTEDLRGGD 599

Query: 589 DSEKEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFV 647
            +  +H T  DI++ GLTR RKAAFF+LIAA KWAEQKQWRQ SWCLKD E  Y+ I+F+
Sbjct: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659

Query: 648 NRKDLALAKLKETLKNVEIDS 668
           N   L L+KL   L   +++S
Sbjct: 660 NGDGLILSKLHNQLNLKDLNS 680

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/696 (60%), Positives = 529/696 (76%), Gaps = 39/696 (5%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           +  SYE+YMNLL HLD+G + VP++IAKRIVSNAISPVI VTST ELD HI ET+++DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 62  YMLLRFFGDCVGDRDQAHEC--TSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRD 119
           YMLLRFF  CV DRDQA+E   +     S ++     ++S L       R RSNSLFQRD
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRD 120

Query: 120 ATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSL 179
           +TQSQYIRFT+PL D++ + + NDMLFDYH+LE +L+N L LI+K+T+D TP++LLKKS+
Sbjct: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180

Query: 180 YHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFP 239
           YH FFSLAISST  LSPYE FNHPVVSLIA+DI +GQ Y++ RDLL  FKNLN +T NFP
Sbjct: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240

Query: 240 VFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVIL 299
           +F+NTND+LPV LLCY+    EQ+E CQ+LTKK+KKQLFVE I LPLWKD+Y +  QV L
Sbjct: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300

Query: 300 HQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQ 359
           HQP+M+SL+E++YFL +P  + L  ELI SIY++L+ L+  LMIPFM+RKI+FW+ETILQ
Sbjct: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360

Query: 360 PRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMML 419
           PR+SLFHG+KFLK+FM+KT      HQ+  + KDA G EYF S+S+EFLMRKLADWSMML
Sbjct: 361 PRKSLFHGAKFLKKFMTKTALT---HQENLLTKDAQGNEYFTSASSEFLMRKLADWSMML 417

Query: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479
           SD+KTAY+TY+SL+HDLE +PKY ASCLEWC+VS+LMGAQNIVT KMLK DI+PLI++A+
Sbjct: 418 SDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKAL 477

Query: 480 ETYENCALYDTQLSGSKKSNS----MAPVRSYETRCMFLASELFLSLSDTWTSTPYALRN 535
            TYENCA   T L  + K N+    + PVRSYETRCM LASELFLSLSDTWTSTPYA+  
Sbjct: 478 STYENCA---TVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISY 534

Query: 536 LETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSN--------------- 580
           LETIL EC+LG CSQIMIWERLS+CY+ R+D RI+HK   G ++N               
Sbjct: 535 LETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAA-GTIANTSSPKKSSESDMQGH 593

Query: 581 --------EEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASW 632
                   +E V N+ +++   T  DIV++G TR RKAAFF+L+AA KWAEQK+WRQ SW
Sbjct: 594 VMTPSPLTKEDVSNDANND---TDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650

Query: 633 CLKDTEDAYAGIEFVNRKDLALAKLKETLKNVEIDS 668
           CL+  +D Y+ I   +R DL L K++  LK  E ++
Sbjct: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETET 686

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/683 (62%), Positives = 531/683 (77%), Gaps = 23/683 (3%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNLL HLD+ ++ VP +IAKRIVSNAI+PVI VTSTP  D+HIQET+++DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSS-------STLAVASG---PSRKRSN 113
           LLRFFG CV DRDQA+E      P+  + ++ S S         L V +     SR RSN
Sbjct: 63  LLRFFGGCVSDRDQANE--GKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 114 SLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHK 173
           SLFQRD+TQSQYIRFTRPL DL+E+ DTNDMLF+YH+LE +L+N L L+ ++TN+  PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 174 LLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNH 233
           LLKKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 234 TTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY-- 291
            T+NFP+F+NTN++LPVFL+CYN +S+E++E CQ+L KKLKKQLFVE I LPLWK+++  
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 292 KTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKIS 351
              + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+S
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 352 FWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRK 411
           FWEETILQPR+SLF+G+KF K+FM+K  +  + HQ  S+ +D  G EYF SSS+EFLMRK
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGS-HQHNSLTRDRQGNEYFSSSSSEFLMRK 419

Query: 412 LADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDI 471
           LADWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI
Sbjct: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 479

Query: 472 DPLIQRAVETYENCALYDTQLSGSKKSNSMA-PVRSYETRCMFLASELFLSLSDTWTSTP 530
           +PLI+RA+ TYE C+           S+S+  PVRSYETRCM LASELFLSLSDTWTSTP
Sbjct: 480 NPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTP 539

Query: 531 YALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNE----EKVEN 586
           YA++ LETIL EC+LGPCSQIMIWERLS+CY  R+D RI+H+V  G M       E + N
Sbjct: 540 YAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRV--GVMKKSFKETEDLRN 597

Query: 587 EDDSEKEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIE 645
            D+   +H    DI++ GLTR RKAAFF+LIAA KWAEQK WRQ SWCLKD E  Y+ I+
Sbjct: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657

Query: 646 FVNRKDLALAKLKETLKNVEIDS 668
           F++  D  L+KLK  L   ++DS
Sbjct: 658 FLHCNDSILSKLKSQLNLKDLDS 680

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/670 (61%), Positives = 516/670 (77%), Gaps = 18/670 (2%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           ++ SYENYMNL+ HLD  ++ VP DI+KRIVSNAI+PVI V ST ELD+H+Q+++++DSL
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 62  YMLLRFFGDCVGDRDQAHE------CTSAGSPSGDDR--AEKSSSSTLAVASGP--SRKR 111
           Y+L+R+FG C+ DRDQA+E        +      +D+   E+ +S+TL +      SR R
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123

Query: 112 SNSLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTP 171
           SNSLFQRD+TQS YIRFT+P+ DL+ S D++DMLFDYH+LE +LE  L LI+K+TND+T 
Sbjct: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183

Query: 172 HKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNL 231
           HK LK SL+HRFFS AISST YLSPYE+FNHP++SL+ALDI  GQ YE+ARDLL KFKN 
Sbjct: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243

Query: 232 NHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY 291
           N+  + FP F++TND+L VFLLCY+GDSEEQ EICQ + KKLKKQLF E ++LPLW  ++
Sbjct: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303

Query: 292 KTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKIS 351
               QV LHQP M+SLDE+LYF   PS  EL L LIN+IYD++E L+  LMIPFMQRKIS
Sbjct: 304 SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKIS 363

Query: 352 FWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRK 411
           FWEETILQPR+SLFHG+K  ++FM++++S T  +Q  +I KD+ G EYF SSS EFL+RK
Sbjct: 364 FWEETILQPRKSLFHGNKLFRKFMNRSSSQT-ANQYNNIVKDSRGNEYFTSSSPEFLLRK 422

Query: 412 LADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDI 471
           LADWSMM+SD+KTAYSTY++L  DLE +PKYLASCLEWC++S+LMGAQNIVTAKM+K D+
Sbjct: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482

Query: 472 DPLIQRAVETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY 531
           +PLI+R+++TYE C++   Q S         PVRSYETRCM L SELFLSL+DTWTSTPY
Sbjct: 483 NPLIERSLDTYEQCSIL-AQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPY 541

Query: 532 ALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSE 591
           AL NLETILAEC+LG CSQIMIWERLS+CY  R D RIRH+V         K+EN +  +
Sbjct: 542 ALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVT-----KIENNEGGQ 596

Query: 592 KEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKD 651
           +  T  DIV++GL R RKAAFF+L+AA KWAEQKQWRQ SWCL+D E  Y  + F  R +
Sbjct: 597 QLQTD-DIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPE 655

Query: 652 LALAKLKETL 661
           L   KLK+ L
Sbjct: 656 LIYQKLKDEL 665

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/690 (60%), Positives = 520/690 (75%), Gaps = 35/690 (5%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNLL HLDH  + VP +IAKRIVSNAI+PVI VTSTP+LD HIQET+++DSLYM
Sbjct: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSS-STLAVASGP---------SRKRSN 113
           LLR+FG CV DRDQA+E               S+  S+L V SG           R RSN
Sbjct: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122

Query: 114 SLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHK 173
           SLFQRD+TQSQYIRFT+P+ D+V    +NDMLFDYH+LE +LE  L LI  +TN+ TP++
Sbjct: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182

Query: 174 LLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNH 233
           LLK S+YH FFSLAISST  LSPYETFNHP+VSLIA+DI +GQ Y++ RDLL +FKNLN 
Sbjct: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242

Query: 234 TTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKT 293
           TT NFP+F+NTND+LP+FLLCY+ + +EQ+EICQSLTK+LKKQLFVE ++LPLW + Y+ 
Sbjct: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302

Query: 294 ATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353
             +V LHQPIM+SL+E++YFL+ P   +LS+ LINSIY++L+ LI  LM+PFM+RK+ FW
Sbjct: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLLFW 362

Query: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413
           EETILQPRRSLFHG+KFLK+FM+K  +G    Q+  + KD+ G EYF  SS E LMRKLA
Sbjct: 363 EETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDSEGNEYFAFSSTELLMRKLA 419

Query: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473
           DWSMM+SD+KTAYSTY+SLS DL+ +PKYLASCLEWC+ S+LMGAQ+IVT KM+K DI+P
Sbjct: 420 DWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINP 479

Query: 474 LIQRAVETYENCALYDTQLSGSK--KSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY 531
           LI+RA++TYENCA+   Q + +K     S+ P+RSYETRCM L SELFLSLSDTWTSTPY
Sbjct: 480 LIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPY 539

Query: 532 ALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDG--------------- 576
           A+  LETIL EC+LGPCSQI IWERLS+CY+ RID RIR+K+ND                
Sbjct: 540 AITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKV 599

Query: 577 ----AMSNEEKVENEDDSE-KEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQAS 631
               +    + ++ E D E K  +  +I+++G TR RK+AFF+LIAA KWAEQKQWRQ +
Sbjct: 600 VATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVA 659

Query: 632 WCLKDTEDAYAGIEFVNRKDLALAKLKETL 661
           WCLKD E  Y   +   R DL +AKL+  L
Sbjct: 660 WCLKDMESIYDATDLGKRDDLIVAKLRNLL 689

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/679 (59%), Positives = 516/679 (75%), Gaps = 20/679 (2%)

Query: 1   MVKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDS 60
           M+  SYE+YMNLL HL+  D+ +P++IA+RIVS+AI+PVI VTSTPELD+HIQ+T+ +DS
Sbjct: 1   MINFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDS 60

Query: 61  LYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDA 120
           LYMLLRFFG CV DRDQA E + A +P        SSSS     +  +R RSNSLFQRD+
Sbjct: 61  LYMLLRFFGGCVSDRDQASE-SKANAP-------HSSSSLTTTKTTRARSRSNSLFQRDS 112

Query: 121 TQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLY 180
           TQSQYIRFTRPL DLVE  D NDMLFD+H+LES+L   L L+EK T D T H+LLKKSLY
Sbjct: 113 TQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLY 172

Query: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240
           H FFSLAISST  LSP+E+FNHP++SLIALDI   Q YE+A+ LL KFKNL++T   FP+
Sbjct: 173 HNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPI 232

Query: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILH 300
           ++NT D+LPVFLLCYN DS E+ + C+ L+ K+KKQLFVE I LPLWK++Y+T   + LH
Sbjct: 233 YINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLH 292

Query: 301 QPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQP 360
           QP+M+SLDE++YFL+   +  L +EL N+ YD+LE L+  L+IPFMQRKI+FWEET+LQP
Sbjct: 293 QPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQP 352

Query: 361 RRSLFHGSKFLKRFMSKTTSGTNIHQQASI-AKDANGKEYFVSSSAEFLMRKLADWSMML 419
           ++S+FHGSKFLK+ MS+ ++ +  HQQ +I  KD +G EYF SSS E L+RKLADWS+ML
Sbjct: 353 KKSIFHGSKFLKKLMSRASTSS--HQQQNILTKDHDGNEYFASSSPELLLRKLADWSIML 410

Query: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479
           SD+KT Y+TY+ LSHDLE +PKYLASCLEW +VS+LMGAQNIVT KM+K DI PLI RA+
Sbjct: 411 SDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRAL 470

Query: 480 ETYENCA----LYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRN 535
           + Y+ CA    L + ++  + +S S+ PV SYETRC+ L+SELFLSLSDTWTSTPYA+  
Sbjct: 471 DAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINY 530

Query: 536 LETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSN--EEKVENED---DS 590
           LE+IL E RLGPCS+IMIWERLS+CY  R+D RI+ KV      +  EE  +NE    +S
Sbjct: 531 LESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNS 590

Query: 591 EKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRK 650
           + +   ++IV++GLTR RKAAFF+L+AA  WAEQ QW+Q  WCL +  D Y+ +  VNR 
Sbjct: 591 QDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRD 650

Query: 651 DLALAKLKETLKNVEIDSR 669
           DL L +L+E       DS+
Sbjct: 651 DLILTRLREEYNIAVSDSK 669

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/666 (56%), Positives = 496/666 (74%), Gaps = 11/666 (1%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            SYE+YMNL+ HLD  ++ VP+DIAKR+VSNA++PVI VTST  LDRHI+ET+ +DSLYM
Sbjct: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62

Query: 64  LLRFFGDCVGDRDQAHECT--SAGSPSGDDRAE--KSSSSTLAVASGPS-RKRSNSLFQR 118
           LLRFFG CV DRDQA+E    + G    ++  E  K  ++ L V      R  SNSL+QR
Sbjct: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122

Query: 119 DATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178
           DATQSQY+RFT+PL DL+ + D NDMLFDYH+LE +L+  L +++K  +   PH LLK S
Sbjct: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTS 182

Query: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNF 238
           +YH FF+LAISST+ LSP+E FNHP+VSL+A+DI   + YE A + L +FK++N+   +F
Sbjct: 183 IYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSF 242

Query: 239 PVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVI 298
           P F+NTND+LPVFLLCYN D+E ++E CQ+L  KLKKQLFVE I+LPLW   +     V 
Sbjct: 243 PSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVS 302

Query: 299 LHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETIL 358
           LHQP+M+S++E+++FL+ P   +L L+L+N IYD +++++  LM PFM+RK++FWEETIL
Sbjct: 303 LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETIL 362

Query: 359 QPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMM 418
            PR+SLFHG+KF K+FM+K+T    + Q  S+ K+ +G  Y  S+S EFLMRKLADWSMM
Sbjct: 363 TPRKSLFHGAKFFKKFMNKSTQA--LSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM 420

Query: 419 LSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRA 478
           +SD+KTAY+TY+SL  D E  PKYLASC EWC+VS+LMGAQNIVTAKMLK +I+P I+RA
Sbjct: 421 VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA 480

Query: 479 VETYENCALYDTQLSGSKKSNSM-APVRSYETRCMFLASELFLSLSDTWTSTPYALRNLE 537
           +  YE CA           S+ + APVRSYETRCMFLASELFLSLSDTWTSTP+A+  LE
Sbjct: 481 LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE 540

Query: 538 TILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKE--HT 595
           TIL EC+LGP S+IMIWERLS+CY  RID RI+H++ +  +  ++K EN DD +     T
Sbjct: 541 TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELL-QKKEENMDDPKNADVFT 599

Query: 596 HADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALA 655
             DI+++GLTR RKAA F+LIAA KW EQKQWR+ SWCL D E  Y+ ++  N+++L   
Sbjct: 600 TEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYT 659

Query: 656 KLKETL 661
           +L+  L
Sbjct: 660 RLRNEL 665

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/708 (54%), Positives = 478/708 (67%), Gaps = 52/708 (7%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
            +YENYMNL+ HLD   + VP DI+KRIVSNAI+PVI VT+T ELD HI E + +DS Y 
Sbjct: 3   FTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSFYT 62

Query: 64  LLRFFGDCVG-------------DRDQAHECTSAGSPS---------GDDRAE---KSSS 98
           LLR+FG C+              D  ++H        +          D++ E   +S  
Sbjct: 63  LLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQSDQ 122

Query: 99  STLAVASGPS-------------------------RKRSNSLFQRDATQSQYIRFTRPLR 133
           + +   + P+                         R RSNSLFQRD+TQSQ+IRFTRP+ 
Sbjct: 123 NVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRPIE 182

Query: 134 DLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYHRFFSLAISSTAY 193
           DL+ S  T DMLFDYHTLE FL + L ++EK T D   HK L+KSLYHRFFS AISST  
Sbjct: 183 DLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISSTNC 242

Query: 194 LSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLL 253
           LSPYE+FNHP+VSLIA+DI  GQ YE ARDLL  FKN N T  NFP+F++TND+LPVF+L
Sbjct: 243 LSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVL 302

Query: 254 CYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILHQPIMTSLDEVLYF 313
           CYNG S E+ E    L+KK+KKQLF E I +PLW   Y     V LHQP M+SLDE+LY 
Sbjct: 303 CYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEMLYV 362

Query: 314 LREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKR 373
            +     +L L LIN IYD LEIL N LMIPFMQRKI+FWEETILQP++SLF G+K  ++
Sbjct: 363 FQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRK 422

Query: 374 FMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLS 433
           FM +  S TN  Q+    KD  G EYF S+S  FL+RKLADWSMM+SD+KTAY+T++SL 
Sbjct: 423 FMGR-PSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLL 481

Query: 434 HDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLS 493
            D+E YPKYLASCLEWC+V +LMGAQNIVT KM+K D++PLI+R+++ Y NCAL    ++
Sbjct: 482 EDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSIA 541

Query: 494 GSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMI 553
            S++S    PVRSYETRCM + SELFLSLSDTWTSTPYAL NLETIL+EC+LG CSQIMI
Sbjct: 542 ESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMI 601

Query: 554 WERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFF 613
           WERLS+CY  R D R++HK+    +S     E  ++  K+   + IV +GLTR RKA+FF
Sbjct: 602 WERLSDCYNLRTDPRVKHKLRSN-ISTSSVSEVSEEEIKKQDVSSIVLKGLTRQRKASFF 660

Query: 614 QLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETL 661
           +L+AA KWAEQ QWRQ SWCL D  + Y    F  R+ L   KLK  L
Sbjct: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/714 (51%), Positives = 477/714 (66%), Gaps = 69/714 (9%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           + LS+  YMNL  HLD   + VP +I+++IVS+A+SPV+ VTST  LD HIQE++ +DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121
           YMLLR+FGDCV DRDQA      G+ SG +R               +R RSNSLFQR A 
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNR---------------NRARSNSLFQRQA- 104

Query: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYH 181
            S Y+RFTRPL DL++  ++ D+LFDYH+LE FLE  L L+E +T   TPH LL+ S+YH
Sbjct: 105 -SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYH 163

Query: 182 RFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVF 241
           +FF+ AISSTA+LSPYE+FNHPV SL+ALDI   QGYEEARDLL  FKN+++TT +FP F
Sbjct: 164 KFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAF 223

Query: 242 LNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQV--IL 299
           +N ND+LPVFLLCY  DS EQ+E+CQSL+K +KKQLFVE +LLP W  N         IL
Sbjct: 224 INVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRIL 283

Query: 300 HQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQ 359
           HQPIM+SL+E +Y + + S I L L LIN IYD L  LI+ LMIPFM+RKISFW+E+ILQ
Sbjct: 284 HQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQ 343

Query: 360 PRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMML 419
           PR+S+F  SKF ++ +SKT +       A+ ++   G  YF ++S EF++RKLADWS ML
Sbjct: 344 PRKSIFPNSKFFRKLISKTPAPPPASDSATHSQ--QGVAYFAATSNEFILRKLADWSFML 401

Query: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479
           SD+K AYSTY+ LS D E  P+YLASCLEWC++SVLMGAQ+IVT KM+K DIDPLI RA+
Sbjct: 402 SDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRAL 461

Query: 480 ETYENCALYDTQLSGSKKSNSMAP-----------------------------------V 504
           ++YE  A    + +   KS+++A                                     
Sbjct: 462 KSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSA 521

Query: 505 RSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQR 564
           +SYETRCM LA+ELFLSLSDTWT+TPYA++ LETIL EC LG  S+I++WERL+ CY  R
Sbjct: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALR 581

Query: 565 IDHRIRHKVN--DGAMSNEEK----VENEDDSEKEHTHAD-------IVTRGLTRMRKAA 611
           +D R++ K+   DG     EK     E  D+S+ E    D       + + GL R RK+ 
Sbjct: 582 VDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLARRRKST 641

Query: 612 FFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETLKNVE 665
            F+LIA  KW E KQWRQA W LKD E  Y+ ++F NR DL L KL++ +   E
Sbjct: 642 LFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE 695

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/735 (52%), Positives = 485/735 (65%), Gaps = 105/735 (14%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVP--ADIAKRIVSNAISPVICVTSTPELDRHIQETHHLD 59
           + LSYENYMNLL H+DH  + V   +++AK+IVSNA+SPV+ VTST  LD H+QE + L 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 60  SLYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRD 119
           S+YMLLRFFGDCV DRDQ +E  +                     +   R RSNSLFQR+
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETET---------------------NFKGRPRSNSLFQRE 99

Query: 120 ATQSQYIRFTRPLRDLVE-SADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178
           +  S ++RFTRPL DLV+     + MLFDYH+LE FL+  L L++   +  TPH+LLK S
Sbjct: 100 S--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHS 157

Query: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKN- 237
           +YH+FF+ AISSTAYLSPYE+FNHPV+SL+ALDI  G  YE ARDLL +FKN+N  TK+ 
Sbjct: 158 IYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSA 217

Query: 238 --FPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKD--NYKT 293
             FP F+N ND+LPVFLLCYN  S EQ+E CQSL K LKKQLFVE ILLPLW+D  +Y  
Sbjct: 218 ASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDA 277

Query: 294 A-TQVILHQPIMTSLDEVLYFL--REP--------------SRIELSLELINSIYDVLEI 336
              + ILH PIM+SL+E+LYFL    P              S  EL L L+ +IYD L +
Sbjct: 278 EEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNL 337

Query: 337 LINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANG 396
           LI  LMIPFM+RKISFWEETILQPR+S+F  +KFL+RF+SK+   T     A I   ++G
Sbjct: 338 LITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPAT---PAAPINSKSDG 394

Query: 397 ----KEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSV 452
                 +F +SS EFL+RKLADWS MLSDY+TAY+TYD+LS DLEH+ +YLA CLEWC+V
Sbjct: 395 AVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAV 454

Query: 453 SVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCA--LYDTQLSGSKKSNSMAPVRSYETR 510
           SVLMGAQ+IVT KM+K DIDPLI ++++ YE CA  L    ++ +       P +SYETR
Sbjct: 455 SVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETR 514

Query: 511 CMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIR 570
           CM L++ELFLSLSDTWT+TPYA++ LETIL  C LGP SQ+++WE+L+ CY+ R+D R+ 
Sbjct: 515 CMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVS 574

Query: 571 H-----------------KVNDGA---------------MSNEEKVENED-------DSE 591
           H                 K N+ A                 N+E+  + D       + E
Sbjct: 575 HIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNRE 634

Query: 592 KEHT---------HADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYA 642
           KEH          + DI   GLTR RKAAFF+LIAANKW EQKQW+QASW L+D +  Y+
Sbjct: 635 KEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYS 694

Query: 643 GIEFVNRKDLALAKL 657
           G+ F  RK L L +L
Sbjct: 695 GLVFSYRKGLILERL 709

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/712 (50%), Positives = 475/712 (66%), Gaps = 71/712 (9%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           + LSYE YMNL+ HLD   + VP++I+++IVSNA+SPV+ VTS+  LD+HIQE++ LDSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121
           YMLLR+FGDC+ DRDQA     +G      RA               R RS SLFQR A 
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEPNKSRA---------------RSRSGSLFQRQA- 104

Query: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYH 181
            SQ++RFTRPL D++ + +T D+LFDYH+LE FL+  L L++  T+  TPH LL+ S+YH
Sbjct: 105 -SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSIYH 163

Query: 182 RFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVF 241
           +FF+ AISSTA+LSPYE FNHPV SL+ALDI   +GYE+ARDLL  FKN+++ T +FP F
Sbjct: 164 KFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFPSF 223

Query: 242 LNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY--KTATQVIL 299
           +N ND+LPVFLLCY   S EQ+E CQSL K +KKQLFVE +LLP W  N+  K     +L
Sbjct: 224 INVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTRVL 283

Query: 300 HQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQ 359
           HQPIM+SL+E ++ + + S  +L L  I  IYD L  L++ LMIPFM+RKISFWEE+ILQ
Sbjct: 284 HQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESILQ 343

Query: 360 PRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMML 419
           PRRS+F  SKF ++ +SK  + +  +  A+ ++   G  YF ++S E L+RKLADWS ML
Sbjct: 344 PRRSIFPNSKFFRKLISKAPTPSTNNDSATHSE--QGLAYFAATSNELLLRKLADWSFML 401

Query: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479
           SD+KTAYSTY+ LS D E +P+YLA CLEWC++SVLMGAQ+IVT KM+K DIDPLI RA+
Sbjct: 402 SDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRAL 461

Query: 480 ETYENCA-------------------------------LYDTQLSGSK----KSNSMAPV 504
           ++YE CA                                +D ++SG+      S      
Sbjct: 462 KSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPSQSA 521

Query: 505 RSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQR 564
           +SYETRCM LA+ELFLSLSDTWT+TPYA++ LETIL +C +G  S+I+IWERL+ CY  R
Sbjct: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALR 581

Query: 565 IDHRIRHKVNDGAMS--------NEEKVENEDDSEKEH-------THADIVTRGLTRMRK 609
           +D R++ ++    +         +EE   +++DS  E        + + I + GLTR RK
Sbjct: 582 VDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCIASSGLTRKRK 641

Query: 610 AAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETL 661
           A  F+LIA  KW E KQWRQA W  +D E  Y+ + F NR+DL L KL++ +
Sbjct: 642 ATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/704 (48%), Positives = 447/704 (63%), Gaps = 96/704 (13%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           +  SYE+YMNLL HL+   + VP DIA+RIVS+A++PVI VTS+  LD HI E++ + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121
           Y+L R FG C+ DRDQ  E  +      DD      SST     G +RKRSNSLFQRDAT
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTL-----DD------SST----GGRTRKRSNSLFQRDAT 105

Query: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKST--------------- 166
           QSQ+IRF +PL DL+ S      LFD  +LE +L + L  I+K T               
Sbjct: 106 QSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELT 165

Query: 167 -------NDKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYE 219
                      PHKLL+ ++YH FF+LA+SST  +SP+ETFN PV++LIA+D+  GQ YE
Sbjct: 166 PSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYE 225

Query: 220 EARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFV 279
             RDL+T FKNLN   ++FPVF+N ND+LP+ +LCY+   E Q   C+ L +K+KK LFV
Sbjct: 226 VVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFV 285

Query: 280 EGILLPLWKDNYKTATQVILHQPIMTSLDEVLYFLREP-------------SRIELSLEL 326
           + I L LW ++ ++   V LH+PIM+SLDE++ F                 SR  L L +
Sbjct: 286 DSIPLALWDEDPESPL-VPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNI 344

Query: 327 INSIYDVLEILINGLMIPFMQRKISFWEETILQPRRSLFHGS-KFLKRFMSKTTSGTNIH 385
           I  +Y  L++L++ ++IPFM RK  +WEE ILQPR+S+FHGS  F K+F+ KTT+     
Sbjct: 345 ITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT----- 399

Query: 386 QQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLAS 445
                 +D +  ++F +SS E L+RKLADWS+MLSD+KTAY TYDSLS+DL++ P YLAS
Sbjct: 400 -----QRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLAS 454

Query: 446 CLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLSGSKKSNSMAPVR 505
           CLEWC+VS+L+GAQNIVT KM+KT+I PLI+RAV TY             ++  S     
Sbjct: 455 CLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYR------------QQGRS----- 497

Query: 506 SYETRCMFLASELFLSLSDTWTSTPYALRNLETILAEC-RLGPCSQIMIWERLSNCYQQR 564
           SYETRCM L++ELFL+L DTWTSTPYA+R LETIL +C +LG CSQ+MIWERLS+CYQ R
Sbjct: 498 SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSR 557

Query: 565 IDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQ 624
            D R+   ++        +  NE           I+ +G TR RKAAFF+LIAA KWAEQ
Sbjct: 558 TDPRVASALSTNTSPGSAQPGNE-----------ILAQGFTRKRKAAFFRLIAAKKWAEQ 606

Query: 625 KQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETLKNVEIDS 668
            QWRQ  WCL D +D Y      ++K L + +L     N E+ S
Sbjct: 607 GQWRQVQWCLHDIKDIYTASALYDKKGLLIDRL-----NTEVQS 645

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/651 (49%), Positives = 421/651 (64%), Gaps = 88/651 (13%)

Query: 108 SRKRSNSLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTN 167
           +RKRSNSLFQRD+TQSQYIRFT+P+ DLV + D  D LFD+ +LE+ L+  L +IE +T 
Sbjct: 184 TRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTT 243

Query: 168 DKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTK 227
              PH  LKKSLYHRFFS+ ++ST  L P+E+F+HP+VSL+++D+ + Q Y+ A+++L K
Sbjct: 244 PDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIK 303

Query: 228 FKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLW 287
           FKN++  T NFPV+LN ND+LPVFLLCY+  S EQ +I + ++ K+KKQLF E ILLPLW
Sbjct: 304 FKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLW 363

Query: 288 KDN-YKTATQVILHQPIMTSLDEVLYFLRE-------PSRIELSLELINSIYDVLEILIN 339
            D  Y     V LH+P+M+S+DE LYFL++        +  +L L L+  IY+++  L  
Sbjct: 364 NDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSV 423

Query: 340 GLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNI--------------H 385
            L+IPFMQRKI FW+ETILQPR+S+F   K  K FM++ ++ ++               H
Sbjct: 424 NLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSISKH 482

Query: 386 QQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLAS 445
             + + KD+NG EYF + S EF +RKLADWSMM+SD+KTAY+TY+SLS DLE+  KY+AS
Sbjct: 483 HHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMAS 542

Query: 446 CLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYE-------NCALYDTQLS----- 493
           CLEW +VS+LMGAQNIVTAKMLK D+DPLI+ A+E+YE       N  L    ++     
Sbjct: 543 CLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSR 602

Query: 494 -----GSKKSNSMA----PVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECR 544
                 +K   S+      +RSYE RCM L SELFLSLSDTWTSTPYALR LETIL++ +
Sbjct: 603 SSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSDYK 662

Query: 545 LGPCSQIMIWERLSNCYQQRIDHRIRHK-----VNDGAMSN------------EEKVENE 587
           LGPCSQ ++WERLS CY  R+D RI+ K     +N G  +              EK  N+
Sbjct: 663 LGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRND 722

Query: 588 DDSEKEHTHA------------------DIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQ 629
              EK                       DI++ G TR RKAAFF+LIAA KW+EQKQWRQ
Sbjct: 723 GKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQ 782

Query: 630 ASWCLKDTEDAYAGIEFVNRKDLALAKLKETLKNVEI---------DSRTI 671
             WCLKD E+ Y  + F +RKDL L KLK+ L    I         DSR+I
Sbjct: 783 LDWCLKDIENVYKEVGFSDRKDLILIKLKDQLNKYYIKNNIKCTKEDSRSI 833

 Score =  122 bits (307), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 66/77 (85%)

Query: 4  LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
           SYENYMNLL HLD  ++ +P DIAKRIV N+I+P+I VT+TPELD+H+Q+++++DSLYM
Sbjct: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62

Query: 64 LLRFFGDCVGDRDQAHE 80
          LLR+FG C+ DRDQ HE
Sbjct: 63 LLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/670 (43%), Positives = 414/670 (61%), Gaps = 52/670 (7%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
           LSYE YMNLL + D     VP +I+++++ NA+SP I V ST  L++H++E   + SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDATQS 123
           LLR+FGD + DRDQ  +  SA                  +     R+R NSLFQR++  S
Sbjct: 62  LLRYFGDYIQDRDQLDDKISA-----------------KLQPNNRRQRQNSLFQRNS--S 102

Query: 124 QYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYHRF 183
           +YIRF  PL D++   D + +  +++ LE  L   L  IE+ T + +P +LLK S++H+F
Sbjct: 103 RYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKF 160

Query: 184 FSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVFLN 243
            ++  S+T  LSPY +FNHP+++L+ALDI  G+ YE AR+LL +FKNL +T   FP F+N
Sbjct: 161 ITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFIN 218

Query: 244 TNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILHQPI 303
           TNDVLPVF+LC++  S +Q+E  QSL K +KKQLFVE + LP++  N++  + ++LH PI
Sbjct: 219 TNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFT-NFRDRS-IVLHPPI 276

Query: 304 MTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQPRRS 363
             SL E LY    P  ++L   L+  IYD +  ++  LMIPFM RKISFW+ETILQPR+S
Sbjct: 277 TNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKS 336

Query: 364 LFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYK 423
           +FH +K LKRF+SK++        AS+    +G  +F++SS EFL+RKLADW  MLSDYK
Sbjct: 337 IFHSNKLLKRFISKSSGSPT----ASMPTSPDG--HFLASSNEFLLRKLADWCFMLSDYK 390

Query: 424 TAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYE 483
           TAYS Y+ L  D E+YP Y++SC E+ ++S+LMGA +IVTAKM+K DIDPLI + ++   
Sbjct: 391 TAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDYAV 450

Query: 484 NCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAE- 542
           N  +   Q+                 RCM   +ELFLSLSDTWTS P+A++ LE IL + 
Sbjct: 451 NNIISLDQI-----------------RCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKE 493

Query: 543 -CRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTH-ADIV 600
             +LGP  + +IWER+S  Y+ RID RI H  +D     +  +E E        H   I 
Sbjct: 494 NLKLGPVCRNLIWERISFAYRLRIDPRI-HADDDSTSDCDHDLEEELYLNPHKLHCGKIQ 552

Query: 601 TRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKET 660
            +G TR RK A FQL+AA KW +  Q RQ +W LK     Y  + F N +   L++L + 
Sbjct: 553 NQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADA 612

Query: 661 LKNVEIDSRT 670
           + + E   R 
Sbjct: 613 VVDSENSQRA 622

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  521 bits (1341), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 293/668 (43%), Positives = 413/668 (61%), Gaps = 63/668 (9%)

Query: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63
           LSYE YMNL+ + +H    VP +I++R++ NA+SP + V ST  L+ H+ E     SLYM
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDATQS 123
           LLR+F D V +R +       GS SG                   ++R  S++QR    S
Sbjct: 62  LLRYFADYVRERGE-----EVGSVSG-------------------QRRPGSVYQRQT--S 95

Query: 124 QYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYHRF 183
           +Y+RF RPL +++E+ +   +  D+  LE  L   L  IE  T +++P +LLK S++H+F
Sbjct: 96  RYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSELLKHSIFHKF 153

Query: 184 FSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVFLN 243
            ++ +SSTA LSPY T NHP+++L+ALD+  G+ Y  AR+LL +FKNL   +  FP ++N
Sbjct: 154 ITM-LSSTA-LSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSYIN 211

Query: 244 TNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILHQPI 303
           TNDVLPVF+LC++  S EQ+E  Q+L K +KKQLFVE + LP++  NY++   V+LH PI
Sbjct: 212 TNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFT-NYES-DPVVLHPPI 269

Query: 304 MTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQPRRS 363
             SL E +Y    P  + L  +L++ IY+ +  ++  LMIPFM RKISFW+ETILQPR+S
Sbjct: 270 TNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPRKS 329

Query: 364 LFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYK 423
           +FHG+KFLKRFM+KT S        +++  ++G  YF++SS EFL+RKLADWS MLSDYK
Sbjct: 330 IFHGNKFLKRFMNKTNSSA----AGTLSTSSDG--YFLASSNEFLLRKLADWSFMLSDYK 383

Query: 424 TAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYE 483
           TAYS Y  L  D E YP+YL+SC E+ ++S+LMGA +IVT KM+K DIDPLI + +++  
Sbjct: 384 TAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDSTV 443

Query: 484 NCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILA-- 541
               Y  +                  RC+   +ELFLSLSDTWTS P+A++ LE IL   
Sbjct: 444 ASLNYLGKF-----------------RCLVYMAELFLSLSDTWTSAPFAIKYLELILQNE 486

Query: 542 ECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDD----SEKEHTHA 597
           + +LGP S+ M+WER+S  YQ RID RI H  ++    N  ++  EDD      K H H 
Sbjct: 487 QLKLGPLSRTMLWERISYAYQLRIDPRI-HTDDEYLSDNFMELTTEDDFCMNPNKLH-HW 544

Query: 598 DIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKL 657
            I + GLTR RK A F+L+AA KW E    RQ +W LK     Y  + F N     L++L
Sbjct: 545 RIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGTLLSRL 604

Query: 658 KETLKNVE 665
            + + + E
Sbjct: 605 VDMVVHEE 612

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  521 bits (1343), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 292/682 (42%), Positives = 413/682 (60%), Gaps = 60/682 (8%)

Query: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61
           ++ SYE YMNL+ + +H  + +P +I+K+++ N +SP ICV S  ELD H+++ +++DS+
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121
            ML R+FGD + DRDQ    T    P              +V+SG  R RS+SLFQR A 
Sbjct: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPG-------------SVSSG--RHRSDSLFQRQA- 106

Query: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDK-TPHKLLKKSLY 180
            S+ +RFTR L DL+ S D+ D +     ++SFL   L  +E   N+  TP KLLK S+Y
Sbjct: 107 -SECVRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIY 164

Query: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240
           HRFF + +SS   LS Y +F+HPVV+L+ LDI  GQGYE AR++L  FKNLN+T +NFP 
Sbjct: 165 HRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPE 222

Query: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLW--KDNYKTATQVI 298
           F+N ND+LPVF+LCY+ +S EQ+E  Q+LTK LKKQLFVE + + L+   DN K+ T   
Sbjct: 223 FININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKSTT--- 279

Query: 299 LHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETIL 358
           LH PI  SL E ++ +  P+ I +   L+  IYD +  ++  +MIPFM RK+ FW+ET+L
Sbjct: 280 LHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVL 339

Query: 359 QPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMM 418
           QPR+S+F  +KF +RF+S  ++    H+       A G   F +SS EFL+RKLADWS M
Sbjct: 340 QPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFM 399

Query: 419 LSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRA 478
           LSD+K AYS YD L+ D E YP+YLA CLE+ ++S+LMGAQNI+TAK +KT++DPL+ RA
Sbjct: 400 LSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRA 459

Query: 479 VETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLET 538
           +E Y             KK +    +R     C+   S+L LSLSDTW S+P A+  L  
Sbjct: 460 IEQY-------------KKQDEKHSLRV--IHCILTFSDLLLSLSDTWVSSPLAVNYLTY 504

Query: 539 ILAECRLGPCSQIMIWERLSNCYQQRIDHRI----------RHKVNDG-AMSNEEKVENE 587
           I     LGP + ++I ER++  Y+  ID R+           +K ++  A  N +K EN 
Sbjct: 505 IQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKGENG 564

Query: 588 ---DD-----SEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTED 639
              DD     +E +    ++ + GLTR RK + +QL+AA KW E  +  QA WC+     
Sbjct: 565 LEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAP 624

Query: 640 AYAGIEFVNRKDLALAKLKETL 661
           AY  +    R D    +L   L
Sbjct: 625 AYEKLSLSKRPDGLFHRLSMEL 646

>KAFR0D01790 Chr4 complement(355461..361289) [5829 bp, 1942 aa] {ON}
           Anc_5.190 YGR184C
          Length = 1942

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 9/113 (7%)

Query: 109 RKRSNSLFQRDATQSQYIRFTRPLRDLVESADT--NDMLFDYHTLESFLENILLLIEKST 166
           RK    +   D +   Y+ +T  +  ++++ +   ND +F+   L   L +I LL    +
Sbjct: 638 RKEGEHVLHEDQSFIPYLEYTTSIYSIIQTIENTLNDNMFNEQLL---LNSIKLLNSYLS 694

Query: 167 NDKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYE 219
           +    +KL+K S     F+++    AY++P  TF     S +   +P+ +GYE
Sbjct: 695 HRSLTYKLVKDSYEVVKFTVSSDRVAYMNPIHTF----FSFLIEKVPLAKGYE 743

>TPHA0P01510 Chr16 complement(306713..309256) [2544 bp, 847 aa] {ON}
           Anc_3.19 YNL321W
          Length = 847

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 428 TYDSLSHDLEHYPKYLASCLEWCSV-SVLMGAQNIVTAKMLKTDI---DPLIQRAVETYE 483
           T++ L+H +  + K L++ +  C+V SVL     I+   +L  DI   DPL+QR ++ Y+
Sbjct: 141 THELLNHKISIFAK-LSNLMWLCTVGSVLFLVLMIIRTLLLILDIFVMDPLLQRFIDCYK 199

Query: 484 NCALY 488
           N A Y
Sbjct: 200 NFAYY 204

>KNAG0C06530 Chr3 complement(1264404..1267097) [2694 bp, 897 aa]
           {ON} Anc_5.690 YOR081C
          Length = 897

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query: 48  LDRHIQETHHLDSLYMLLRFFGDCVGDRDQAHE----CTSAGSPSGDDRA---------- 93
           LD ++ ET   +SL +LLR   +   + DQ  E    CT+  S S   R           
Sbjct: 624 LDDNLLETESTNSL-LLLRENPNVNNNGDQLQEKLNGCTAGRSQSAHRRKSDSGANANLR 682

Query: 94  EKSSSSTLAVASGPSRK-RSNSLFQRDATQSQYIRFTRPLR 133
           +K SS + ++ S PSR   SNS +QR AT   + R T   R
Sbjct: 683 KKYSSKSFSITSPPSRILSSNSYYQRHATNHGFSRTTHGKR 723

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 522 LSDTWTSTPYALRNL-ETILAECRLGPCSQI--MIWERLSNCYQQRIDHRIRHKVNDGAM 578
           LSD W S P+ L  +  +IL + R  P SQ    ++++++  +Q   D+ +    N   M
Sbjct: 430 LSDVWNSNPHLLMYMVNSILNKSRSKPHSQFKKQLYDQINKFFQ---DNGLSESTNPYVM 486

Query: 579 SNEEKVENEDDSEKEHTH 596
            N   ++ +  + KEH H
Sbjct: 487 KNFRLLQKQLQTYKEHKH 504

>AGL114C Chr7 complement(490370..492730) [2361 bp, 786 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR241W
          Length = 786

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%)

Query: 542 ECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIVT 601
           E +L  C Q + +E L +  +  +  R+     + A+   +  E++   E EH + +I  
Sbjct: 280 ELKLSDCPQELRYEELYSREEFSLRGRVSGAPAEDAIEQSQSSEDQSRGENEHLYNEIQL 339

Query: 602 RGLTRMRKAAF 612
           +G  +MR   F
Sbjct: 340 KGRPKMRIGLF 350

>TDEL0A05690 Chr1 (1000974..1003526) [2553 bp, 850 aa] {ON}
           Anc_8.623 YOR208W
          Length = 850

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 20/93 (21%)

Query: 286 LWKDNYKTATQVILHQPIMT-------------SLDEVLYFLREPSRIELSLELINSIYD 332
           +W +N+K     I H P++              +LD +L  L EP+    S+++ N   D
Sbjct: 740 VWPENFKKTNASITHPPLLVHCSAGCGRTGVFITLDFLLNVLNEPTNTSNSIDVWNMSQD 799

Query: 333 VLEILINGL------MIPFMQRKISFWEETILQ 359
           ++ I IN L      M+  + + I+ + E+ILQ
Sbjct: 800 LIFITINELRKQRISMVQNLTQYITCY-ESILQ 831

>Kpol_1011.2 s1011 complement(2303..4057) [1755 bp, 584 aa] {ON}
           complement(2303..4057) [1755 nt, 585 aa]
          Length = 584

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 64/135 (47%), Gaps = 8/135 (5%)

Query: 119 DATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178
           D  + QYI   + + +L E      +L DY   E+  ++ L+++++ T D  P +  ++ 
Sbjct: 264 DEDKEQYIGLKKNVVNLTEKIKR--VLSDYK--ENEFKDDLIIVKEQTVD--PLEKKRRD 317

Query: 179 LYHRFFSLAISSTAYLSPYETFNHPV--VSLIALDIPIGQGYEEARDLLTKFKNLNHTTK 236
           +Y  +FS+  S   +++ +ET+   +     I  +I   +  E+ +DL+ K         
Sbjct: 318 IYKEYFSVKESFLEFINKFETYKELLDKREKIKQEIKDRRAKEQQKDLIPKLSKEEIDRI 377

Query: 237 NFPVFLNTNDVLPVF 251
           N  +  N ND+L  +
Sbjct: 378 NKILNKNGNDILAKY 392

>YLR233C Chr12 complement(607425..609524) [2100 bp, 699 aa] {ON}
           EST1TLC1 RNA-associated factor involved in telomere
           length regulation as recruitment subunit of telomerase;
           has G-quadruplex promoting activity that is required for
           telomere elongation; possible role in activating
           telomere-bound Est2p-TLC1-RNA
          Length = 699

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 300 HQPIMTSLDEVLYFLREPSRIELSLELINS--IYDVLEILINGLMIPFMQRKISFWEETI 357
           H+P  + L       RE S I  +L   N   +YD  +++ N +  P + + +S  EE +
Sbjct: 484 HRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKVLSPKEECV 543

Query: 358 LQPRRSLFHGSKFLKR 373
           L+ R  +F G KFL++
Sbjct: 544 LRIRSIIFSGMKFLEK 559

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,039,616
Number of extensions: 3296930
Number of successful extensions: 12733
Number of sequences better than 10.0: 51
Number of HSP's gapped: 13024
Number of HSP's successfully gapped: 56
Length of query: 687
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 570
Effective length of database: 40,065,477
Effective search space: 22837321890
Effective search space used: 22837321890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)