Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F038108.254ON65665631400.0
Smik_12.1428.254ON66365019970.0
YLR083C (EMP70)8.254ON66764719730.0
Suva_10.1678.254ON68467619630.0
NDAI0B023708.254ON72265519630.0
NCAS0B049708.254ON66665419510.0
ZYRO0C01848g8.254ON64765019190.0
KNAG0G019908.254ON66766519210.0
YDR107C (TMN2)8.254ON67265219210.0
Skud_12.1518.254ON66465119180.0
Kpol_543.358.254ON65866019130.0
Suva_2.2678.254ON67266519100.0
Skud_4.3688.254ON67265818680.0
KAFR0B026808.254ON66465018640.0
Smik_4.3538.254ON69065918590.0
TBLA0E043708.254ON67666118480.0
KLLA0F18931g8.254ON66564917900.0
SAKL0H17248g8.254ON66065017880.0
CAGL0B01683g8.254ON69168517820.0
TBLA0H014508.254ON67365717390.0
TPHA0A018408.254ON68569017260.0
Kwal_56.235778.254ON68366417210.0
NCAS0B038908.254ON66366617100.0
KLTH0G13882g8.254ON68768117020.0
AGR097W8.254ON65364915590.0
NDAI0J014208.254ON61962014940.0
Ecym_43178.254ON60564512681e-167
NDAI0A015107.411ON6796633507e-34
ZYRO0B03784g7.411ON6585983251e-30
KNAG0C034307.411ON6802582502e-21
NCAS0A145207.411ON6702492332e-19
KLLA0E20835g7.411ON6762392323e-19
Smik_5.2587.411ON7062442234e-18
TDEL0C027107.411ON6782572234e-18
SAKL0F12914g7.411ON7072352191e-17
KLTH0C06226g7.411ON6942822128e-17
CAGL0G03487g7.411ON7042542128e-17
YER113C (TMN3)7.411ON7063052129e-17
Suva_5.2347.411ON7062381984e-15
Kwal_27.107467.411ON6902421966e-15
KAFR0K019507.411ON6642521968e-15
Skud_5.2667.411ON7072371879e-14
Ecym_71437.411ON6762331663e-11
AGL295C7.411ON6572371636e-11
TBLA0I003307.411ON7132161583e-10
TPHA0K007307.411ON7332671413e-08
Kpol_1045.287.411ON6812131064e-04
SAKL0A09812g2.545ON75142742.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03810
         (656 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...  1214   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   773   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   764   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   760   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   760   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   756   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   743   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   744   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   744   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   743   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   741   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   740   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   724   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   722   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   720   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   716   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   694   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   693   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   691   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   674   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   669   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   667   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    663   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   660   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   605   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   580   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   493   e-167
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   139   7e-34
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   129   1e-30
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   100   2e-21
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...    94   2e-19
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    94   3e-19
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...    91   4e-18
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...    91   4e-18
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...    89   1e-17
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    86   8e-17
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    86   8e-17
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...    86   9e-17
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...    81   4e-15
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    80   6e-15
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    80   8e-15
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...    77   9e-14
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    69   3e-11
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    67   6e-11
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    65   3e-10
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    59   3e-08
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    45   4e-04
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    33   2.6  

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/656 (90%), Positives = 593/656 (90%)

Query: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60
           MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD
Sbjct: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60

Query: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120
           KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS
Sbjct: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120

Query: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN 180
           VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN
Sbjct: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN 180

Query: 181 GAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ 240
           GAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ
Sbjct: 181 GAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ 240

Query: 241 TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXX 300
           TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWF     
Sbjct: 241 TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISC 300

Query: 301 XXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXX 360
                       HMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNK      
Sbjct: 301 VIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSV 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKG 420
                                 FNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKG
Sbjct: 361 LVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKG 420

Query: 421 PYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLA 480
           PYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLA
Sbjct: 421 PYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLA 480

Query: 481 GSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSL 540
           GSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSL
Sbjct: 481 GSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSL 540

Query: 541 WFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFI 600
           WFHQFFYMFGFSM                  YHSLCLENWQWQWRSFIVGGLGSAVYIFI
Sbjct: 541 WFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFI 600

Query: 601 HSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           HSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD
Sbjct: 601 HSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/650 (57%), Positives = 453/650 (69%), Gaps = 6/650 (0%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
           + ++A +LPG++PT Y    EI L VNHLTPS ++QHKD++GNN+  DKE++LYSYDYYN
Sbjct: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
           S+ HFCKPE V +Q ESLGS++FGDR+YNSPF+L MLE+K CVSLCK  IPG DA FINK
Sbjct: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREET-- 190
           LIKNGF  NWL+DGLPA   ++++R  ++    GF LG VE+ QG  + A     E T  
Sbjct: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQ 193

Query: 191 GI---SAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246
           G+   +  G N+V   E P+  NHYDI I+YH+   G YR+VGV V P SIK++   +CE
Sbjct: 194 GVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE 253

Query: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXX 306
             G  + L E+ DNEV +TYSV++V    +WATRWD Y   YD ++QWF           
Sbjct: 254 TDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVL 313

Query: 307 XXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXX 366
                 H LLRALKSDFARYNELNLDD+F E+SGWKLSHGDVFR P++            
Sbjct: 314 LSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGV 373

Query: 367 XXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426
                           F +  SR  L T+ F+LYALFGFVGSY SMG+Y+FF GPY K N
Sbjct: 374 QLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKAN 433

Query: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486
           +ILTP L+PG IL+ II+LNFFL+  HSS  IP S LF +V LW + S+PLS AGSL A 
Sbjct: 434 LILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVAR 493

Query: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546
           K C WD+HPTKTNQIARQIPFQPWYLKT+PA L+AG+FPF SIAVELYFIY SLWF++ F
Sbjct: 494 KKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIF 553

Query: 547 YMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606
           YMFGF                    YHSLCLENW+WQWR FIVGG G A+Y+FIHSI FT
Sbjct: 554 YMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFT 613

Query: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           +FKL GFTTIVLYVGYS +IS+LCCL TG++GF SSMF +RKI+SS+KVD
Sbjct: 614 KFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/647 (57%), Positives = 451/647 (69%), Gaps = 6/647 (0%)

Query: 16  RASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKL 75
           +A +LPG++PT Y     I L VNHLTPS ++QHKD+DGNN+  DKE++LYSYDYY ++ 
Sbjct: 21  KAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRF 80

Query: 76  HFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIK 135
           HFC+PE V +Q ESLGSV+FGDR+YNSPF+LNML++K C SLCK+VIPG+DA FINKLIK
Sbjct: 81  HFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIK 140

Query: 136 NGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVH-----NGAMATPREET 190
           NGF  NWL+DGLPA   + + R  ++    GF LG V++ QG        GA  T ++  
Sbjct: 141 NGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAETTDKDVE 200

Query: 191 GISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCEFTG 249
             + +  N+V   ELP+  NH+DI I+YH+   G YR+VGV VEP SIK++S  +CE TG
Sbjct: 201 LETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETTG 260

Query: 250 EQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXX 309
             + L E  DNEV +TYSV++   + +WATRWD Y   YD ++QWF              
Sbjct: 261 SPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSS 320

Query: 310 XXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXX 369
              H LLRALKSDFARYNELNLDD+F E+SGWKL+HGDVFR P++               
Sbjct: 321 VVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLF 380

Query: 370 XXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMIL 429
                        F +  SR  L T+ F+LYALFGFVGSY SMG+Y+FF GPY K N+IL
Sbjct: 381 LMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLIL 440

Query: 430 TPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTC 489
           TP L+PG ILL II+LNFFL+  HSS  IP S LF +V LW + S+PLS AGSL A K C
Sbjct: 441 TPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRC 500

Query: 490 SWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMF 549
            WD+HPTKTNQIARQIPFQPWYLKT+PA L+AGIFPF SIAVELYFIY SLWF++ FYMF
Sbjct: 501 HWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMF 560

Query: 550 GFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFK 609
           GF                    YHSLCLENW+WQWR FI+GG G A+Y+FIHSI FT+FK
Sbjct: 561 GFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFK 620

Query: 610 LRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           L GFTTIVLYVGYS +IS+LCCL TG++GF SSM  VRKI+SS+KVD
Sbjct: 621 LGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/676 (55%), Positives = 454/676 (67%), Gaps = 27/676 (3%)

Query: 8   LSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYS 67
           L  + + +RA +LPG++PT Y    EI L VNHLTPS ++QH+D+DGNN+  DKEH+LYS
Sbjct: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYS 68

Query: 68  YDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDA 127
           YDYY  K HFCKPE+V +Q ESLGS++FGDR+YNSPF+LNML++K CVSLCK+VIPG+DA
Sbjct: 69  YDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128

Query: 128 AFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN------- 180
            FINKLIKNGF  NWL+DGLPA   +++ R  +     GF LG VE+ Q V +       
Sbjct: 129 KFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188

Query: 181 ---------GAMATPREETGISA----------HGSNVVVNLELPHLNNHYDITIQYHEP 221
                     A      E G S+           G N+V   E P+  NH+DI I+YH+ 
Sbjct: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDR 248

Query: 222 EAGKYRIVGVEVEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATR 280
             G YR+VGV V P SIK++S  +CE  G  + L E  DNEV +TYSV++     +WATR
Sbjct: 249 GEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATR 308

Query: 281 WDNYRFSYDTTVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESG 340
           WD Y   YD ++QWF                 H LLRALKSDFARYNELNLDD+F E+SG
Sbjct: 309 WDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSG 368

Query: 341 WKLSHGDVFRMPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLY 400
           WKL+HGDVFR P++                            F +  SR  L T+ F+LY
Sbjct: 369 WKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILY 428

Query: 401 ALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPF 460
           ALFGFVGSY SMG+Y+FF GPY K N+I+TP LIPG ILL II+LNFFL+  HSS  IP 
Sbjct: 429 ALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPA 488

Query: 461 SALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALV 520
           S LF +V LW + S+PLS AGSL A K C WD+HPTKTNQIARQIPFQPWYLKTLPA L+
Sbjct: 489 STLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLI 548

Query: 521 AGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENW 580
           AGIFPF SIAVELYFIY SLWF++ FYMFGF                    YHSLCLENW
Sbjct: 549 AGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENW 608

Query: 581 QWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFF 640
           +WQWR F VGG+G A+Y+FIHSI FT+FKL GFTTIVLY+GYS +IS+LCCL TG++GF 
Sbjct: 609 KWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFI 668

Query: 641 SSMFLVRKIFSSVKVD 656
           SSMF +RKI+SS+KVD
Sbjct: 669 SSMFFIRKIYSSIKVD 684

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/655 (55%), Positives = 454/655 (69%), Gaps = 11/655 (1%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
           +++RA +LPG++PT Y    EI L VNHLTPS +FQHK++DG  +KSDKE +LYSYDYY 
Sbjct: 68  SLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYY 127

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
            + HFC+PE++ +Q ESLGS++FGDR+YNSPF++NML+DK+CVSLCK+ IPG+DA FINK
Sbjct: 128 DRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINK 187

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMAT-----PR 187
           LIKNGF  NWL+DGLPA   + + R  +     GF LG V+++QG   G  A      P 
Sbjct: 188 LIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNANTVAKKPT 247

Query: 188 EETGI-----SAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-T 241
              G+      A    ++ N ELP+  NH+DI ++YH+     YR+VGV V P SIK+ T
Sbjct: 248 TNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRST 307

Query: 242 SNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXX 301
             +CE +G  + LSEDQDN+V +TYSV+++     WATRWD Y   YD  +QWF      
Sbjct: 308 PGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINFS 367

Query: 302 XXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXX 361
                      H LL+ALKSDFARYNELNLDD+F EE+GWKL HGDVFR+P++       
Sbjct: 368 VVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVL 427

Query: 362 XXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGP 421
                                F +  SR  L T+ F+LYALFGFVGSY SMGVY+FF GP
Sbjct: 428 VGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGP 487

Query: 422 YPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAG 481
           Y KVNM+LTP L+PGLI   I++LN FLL  HSS  IP   LF ++LLW + S+PL+LAG
Sbjct: 488 YWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAG 547

Query: 482 SLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLW 541
           SL A K C+WD+HPTKTNQIARQIPFQPWYLKT PA L+AGIFPF SIAVELYFIY+SLW
Sbjct: 548 SLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLW 607

Query: 542 FHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIH 601
           F++ FYMFGF +                  YHSLCLENW WQWR FI+GG+G A+Y+FIH
Sbjct: 608 FNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIH 667

Query: 602 SIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           SI FT+FKL GFTTIVLYVGYS +IS+L C+ TGA+GF SSMF +RKI+SS+KV+
Sbjct: 668 SILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/654 (55%), Positives = 455/654 (69%), Gaps = 12/654 (1%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
           +++RA +LPG++PT Y    EI L VNHLTPS +FQ  D +G +   +KEH+LYS+DYY 
Sbjct: 15  SLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYF 72

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
            +LHFCKPE++ +Q ESLGS++FGDR+YNSPF+L MLE+K+CVSLCKS IPG+DA FINK
Sbjct: 73  DRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINK 132

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMAT--PREET 190
           LIKNGF  NWL+DGLPA T + + +  S     GF LG VE  Q +   A AT  P++ T
Sbjct: 133 LIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTT 192

Query: 191 --GIS-----AHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TS 242
             G+      A    +V N+E+ +  NHYDI ++YH+   G YR+VGV V P SIK+ T 
Sbjct: 193 NEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTP 252

Query: 243 NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXX 302
            +CE TG+ + LSED DN+V +TYSV++V     WATRWD Y  +YD T+QWF       
Sbjct: 253 GTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSI 312

Query: 303 XXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXX 362
                     H L++ALKSDFARYNE NL+D+F E++GWKL HGDVFR+P+K        
Sbjct: 313 IVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLV 372

Query: 363 XXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPY 422
                               F +  SR  L T+ F+LYALFGFVGSY SM VY+FFKGPY
Sbjct: 373 GSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPY 432

Query: 423 PKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGS 482
            KVNM+LTPF+IPG I LTI+ LNFFL+ AHSS  +P   LF ++LLW I S+PL+ AGS
Sbjct: 433 WKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGS 492

Query: 483 LTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWF 542
           L A K C+WD+HPTKTNQIARQIPFQPWYLKT PA ++AGIFPF SIAVELYFIY SLWF
Sbjct: 493 LIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWF 552

Query: 543 HQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHS 602
           ++ FYMFGF +                  YHSLCLENWQWQWR FIVGG+G A+Y+F+HS
Sbjct: 553 NKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHS 612

Query: 603 IFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           I FT+FKL GF TIVLYVGYS +IS+L C+ TGA+GF SS+  VRKI+S++KVD
Sbjct: 613 ILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/650 (56%), Positives = 460/650 (70%), Gaps = 12/650 (1%)

Query: 8   LSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYS 67
           + LL ++ +A +LPG++PT Y +  EI L VNHLTPS +FQH+D+DGN +K DKEHYLYS
Sbjct: 9   VCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYS 68

Query: 68  YDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDA 127
           YDYY SK HFCKPENV+ Q  SLGSV+FGDR++NSPFKLNMLE+K CV LC S IPGEDA
Sbjct: 69  YDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDA 128

Query: 128 AFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPR 187
            F+NKLIKNGF+ NWL+DGLPAG  I++ R +S     GF LG V++ +G  +    +  
Sbjct: 129 KFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSD----SND 184

Query: 188 EETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246
           EE         ++  LE+P+L NHYDI I+YH+     YR+VGV V+P SIK++S +SC+
Sbjct: 185 EE-------KKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ 237

Query: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXX 306
           +    ++LSE ++NEV +TYSV++++    WATRWD Y   YD T+QWF           
Sbjct: 238 YNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVA 297

Query: 307 XXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXX 366
                 HMLLRALK+D +RYNE NLD+EFHE+SGWKLSHGDVFR+P +            
Sbjct: 298 LSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGV 357

Query: 367 XXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426
                           F +  SR  LPT+ F+LYALFGFVGSY SM +Y+FFKGP  KVN
Sbjct: 358 QLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVN 417

Query: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486
           ++LTP L+PG I +TII LNFFL+   SS AIP   LF ++LLW + S+PLS AGSL A 
Sbjct: 418 LLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAH 477

Query: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546
           K C  D HPTKTNQIARQIP QPWYLKT+P +L+AG+FPFASIAVELYFIY SLWF++ F
Sbjct: 478 KRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIF 537

Query: 547 YMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606
           YMFGF +                  YHSLCLENW+WQWRSFI+GG G A+Y+FIHSI FT
Sbjct: 538 YMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFT 597

Query: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           +FKL GFTT+VLY+GYS LIS+LCC+ TG++GF SSMF +RKI+SSVKVD
Sbjct: 598 KFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/665 (55%), Positives = 467/665 (70%), Gaps = 11/665 (1%)

Query: 2   HFFFTALSLLWAVSR--ASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKS 59
           H     L+LLWA  +  A +LPG++PT Y A  EI L VNHL+PS ++QH+ +DG N+K 
Sbjct: 4   HTVHLGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKG 63

Query: 60  DKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCK 119
           DK  YLYSYDYY  + HFC+PE ++++ ESLGS++FGDR+YNSP+++ MLE+K+CV LC 
Sbjct: 64  DKSRYLYSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCN 123

Query: 120 SVIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVH 179
           ++IPG+DA FINKLIKNGF  NWL+DGLPA  +++++  +S    NGF LGSVE++Q V 
Sbjct: 124 TIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA 183

Query: 180 NGAMATPREETGISAHGS-------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVE 232
             A   P+E+   SA  S        ++ N+ELP+  NH+DIT++YH+   G  R+VGV 
Sbjct: 184 Q-AKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVT 242

Query: 233 VEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTT 291
           V+P SIK++S  +C+ +G+ + L E  DNEV +TYSVR+V     WATRWD Y  +YD T
Sbjct: 243 VDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPT 302

Query: 292 VQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRM 351
           +QWF                 HMLL+AL+SDFARYNELNLD+EF E+SGWKL+HGDVFR+
Sbjct: 303 IQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRI 362

Query: 352 PNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYAS 411
           P+K                            F +  SR  L T+ F+LYALFGFVGSY S
Sbjct: 363 PSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTS 422

Query: 412 MGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWL 471
           MGVY+FF+GPY K NMILTP L+PG +LL+I+ LN FLL AHSS  IP   LF +VLLW 
Sbjct: 423 MGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWF 482

Query: 472 IISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAV 531
           +ISVP +LAGSL A K CSWD+HPTKTNQ+ARQ+PFQPWYLKT+ A  +AGIFPF SIAV
Sbjct: 483 VISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAV 542

Query: 532 ELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGG 591
           ELYFIY SLW+++ FYMFGF                    YHSL LENWQWQWRSFIVGG
Sbjct: 543 ELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGG 602

Query: 592 LGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFS 651
           +G A+Y+F+HSI FT+ KL GF TIVLYVGYS +IS+LCCL TG++GF SSMF VR+I+S
Sbjct: 603 VGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYS 662

Query: 652 SVKVD 656
           S+KV+
Sbjct: 663 SIKVE 667

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/652 (54%), Positives = 449/652 (68%), Gaps = 15/652 (2%)

Query: 20  LPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCK 79
           LPG+SPT Y +  EI L VN LTPS +FQH+D++GN++  DKEH+LYSYDYYN + HFC+
Sbjct: 21  LPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCR 80

Query: 80  PENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFL 139
           PE+V +Q ESLGSV+FGDR+YNSPF+LNMLE+K CV+LCKS IPG+DA FIN LIK+GF 
Sbjct: 81  PEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFF 140

Query: 140 HNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNV 199
            NWLVDGLPA     + R  + +   GF LG  ++ Q V   A+ +  EE    A   +V
Sbjct: 141 QNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200

Query: 200 VVN--------------LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NS 244
           +++              +ELP+  NH+DI +++H+     YR+VGV V P SI+++S  +
Sbjct: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGA 260

Query: 245 CEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXX 304
           C  TG+ + L ED+DNEV +TYSV++V     WATRWD Y   YD  +QWF         
Sbjct: 261 CSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIV 320

Query: 305 XXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXX 364
                   H LLRALKSD ARYNELNLD+EFHE+SGWKL HGDVFR P+K          
Sbjct: 321 ILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGS 380

Query: 365 XXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPK 424
                               +  SR  LPT+ FVLYALFGFVGSYASMGVY+FF+GPY K
Sbjct: 381 GMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWK 440

Query: 425 VNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLT 484
            NMILTP L+PG I L I+ +NFFLL AHSS  IP  +LF ++LLW ++SVPLS AGS+ 
Sbjct: 441 ANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIV 500

Query: 485 AIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQ 544
           A K C+WD+HPTKTNQIARQIP+QPWYL+T  A L+AGIF F SIAVELYFIY+SLWF++
Sbjct: 501 AHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNK 560

Query: 545 FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIF 604
            FYMFGF +                  Y+SLCLENW WQWRSFI+GGLG ++Y FIHSI 
Sbjct: 561 IFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSIL 620

Query: 605 FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           FT+FKL G  T+VLY+GYS++IS LCC+ TGA+GFFSSMF +RKI+S++KV+
Sbjct: 621 FTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/651 (54%), Positives = 444/651 (68%), Gaps = 7/651 (1%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
           + ++A +LPG++PT Y    EI L VNHLTPS ++QH+D+ GN++  DKE++LYSYDYY 
Sbjct: 14  SATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYY 73

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
            + HFC+P++V +Q ESLGSV+FGDR+YNSPF+LNML++K CV LC + IPG DA FINK
Sbjct: 74  DRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINK 133

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPRE---- 188
           LIKNGF  NWL+DGLPA   + + R  +     GF LG VE+ QG  +       E    
Sbjct: 134 LIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNE 193

Query: 189 --ETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQT-SNSC 245
             E G  A   ++V   E P+  NH+DI I+YH+   G YR+VGV V P SIK++ + +C
Sbjct: 194 GLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTC 253

Query: 246 EFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXX 305
           E     + L E++DNEV +TYSV++   + +WATRWD Y   YD ++QWF          
Sbjct: 254 ETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVV 313

Query: 306 XXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXX 365
                  H LLRALKSDFARYNELNL+D+F E+SGWKL+HGDVFR P+            
Sbjct: 314 LLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSG 373

Query: 366 XXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKV 425
                            F +  SR  L T+ F+LYALFGFVGSY SMG+Y+FF GPY K 
Sbjct: 374 VQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKA 433

Query: 426 NMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA 485
           N++LTP L+PG ILL I++LNFFL++ HSS  IP   LF +V LW + S+PLS  GSL A
Sbjct: 434 NLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIA 493

Query: 486 IKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQF 545
            K C WD+HPTKTNQIARQIPFQPWYLKT+PA L+AGIFPF SIAVELYFIY SLWF++ 
Sbjct: 494 RKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI 553

Query: 546 FYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFF 605
           FYMFGF                    YHSLCLENW+WQWR FIVGG+G A+Y+FIHSI F
Sbjct: 554 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILF 613

Query: 606 TEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           T+FKL GF TIVLYVGYS +IS+LCCL TG++GF SSMF +R+I+SS+KVD
Sbjct: 614 TKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/660 (55%), Positives = 450/660 (68%), Gaps = 8/660 (1%)

Query: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60
           M   F  LS+  A++ A +LPG++PT Y    EI L VNHLTPS +FQHKD  GN+IK +
Sbjct: 3   MKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGN 62

Query: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120
           KEH+LYS+DYY  KLHFCKPE+V +Q ESLGS+LFGDR+YNSPF + MLE++ C SLCK 
Sbjct: 63  KEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKV 122

Query: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN 180
            IP +DA FINKLIKNGF  NWL+DGLPA   +++ +  S     GFPLG+V + Q V  
Sbjct: 123 TIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV-- 180

Query: 181 GAMATPR---EETGISAHG-SNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPK 236
           G +A+ +   E     A   +N+V N+E+P L NHYDI ++YH+   G YR+VGV V+PK
Sbjct: 181 GGLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPK 240

Query: 237 SIKQTSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFX 296
           S   T + C      + L E +DNEV ++YSVR++     WATRWD Y   YD T+QWF 
Sbjct: 241 S--STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFS 298

Query: 297 XXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXX 356
                           H L+RALKSDFARY E NLDD F ++SGWKL HGDVFR+P+K  
Sbjct: 299 LINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSM 358

Query: 357 XXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYR 416
                                       +  SR  LP+  F+LYALFGF GSY SMGVY+
Sbjct: 359 LLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYK 418

Query: 417 FFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVP 476
           FF GPY K NMILTP L+PGL+ ++I+ LNFFLL + SS  IP +AL  V++LW IIS+P
Sbjct: 419 FFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIP 478

Query: 477 LSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFI 536
           LSLAGSL A K C+W +HPTKTN+IARQIPFQPWYLKT+PA L+AG+FPF SIAVELYFI
Sbjct: 479 LSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFI 538

Query: 537 YNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAV 596
           Y+SLWF++ FYMFGF                    Y+SL LENW+WQWRSFIVGG+G A 
Sbjct: 539 YSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAF 598

Query: 597 YIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           YIF+HSI FT+FKL GFTTIVLYVGYS++IS LC + TGA+GF SSM  V+KI+SSVKVD
Sbjct: 599 YIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/665 (54%), Positives = 450/665 (67%), Gaps = 15/665 (2%)

Query: 7   ALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66
           AL L  A+++A  LPG+SPT Y A  EI L VN LTPS +FQHKD++G ++ SDKEH+LY
Sbjct: 8   ALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLY 67

Query: 67  SYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGED 126
           SYDYYN K HFCKPE+V +Q ESLGSV+FGDR+YNSPF+L MLEDK CV+LCKS IPG+D
Sbjct: 68  SYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKD 127

Query: 127 AAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP 186
           A FIN LIKNGF  NWLVDGLPA   + + R  + +   GF LG  ++ Q V    + + 
Sbjct: 128 AKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPST 187

Query: 187 REE-------TGISAHGS-------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVE 232
            EE       TG +           N+V  +EL H  NH++I ++YH+   G YR+VGV 
Sbjct: 188 MEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVT 247

Query: 233 VEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTT 291
           V P SI+++S  +C  TGE ++L ED+DN+V +TYSV+++     WATRWD Y   YD  
Sbjct: 248 VNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQ 307

Query: 292 VQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRM 351
           +QWF                 H +LRA++SDFARYNELNLD+EFHE++GWKL HGDVFR+
Sbjct: 308 IQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRI 367

Query: 352 PNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYAS 411
           P K                              +  SR  LPT+ FVLYALFGFVGSY S
Sbjct: 368 PPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTS 427

Query: 412 MGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWL 471
           MGVY+FF GPY K N+I+TP L+PG I L I+++NFFLL AHSS  IP   LF ++ LW 
Sbjct: 428 MGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWF 487

Query: 472 IISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAV 531
            +S+PLS AGS  A K C WD+HPTKTNQIARQ P QPWYL+T+ A L+AGIF F SIAV
Sbjct: 488 SVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAV 547

Query: 532 ELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGG 591
           ELYFIY+SLWF++ FYMFGF +                  YHSLCLENW WQWRSFI+GG
Sbjct: 548 ELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGG 607

Query: 592 LGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFS 651
           LG +VY+FIH+I FT+FKL GF T+VLYVGYS +IS LCC+ TGA+GFFSSM  +RKI+S
Sbjct: 608 LGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYS 667

Query: 652 SVKVD 656
            +KV+
Sbjct: 668 RIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/658 (53%), Positives = 446/658 (67%), Gaps = 15/658 (2%)

Query: 14  VSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNS 73
           V++A  LPG+SPT Y +  EI L VN LTPS +FQH+D++GN+I SDKEH+LYSYDYYN 
Sbjct: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74

Query: 74  KLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKL 133
           + HFC+PE+V +Q ESLGSV+FGDR+YNSPF+L MLE+K CV+LCK  IPG DA FIN+L
Sbjct: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134

Query: 134 IKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGIS 193
           I +GF  NWLVDGLPA   + + R  + +   GF LG  +++Q V +  +    EE  + 
Sbjct: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194

Query: 194 AHGS--------------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIK 239
           A  +              N V  +ELP+  NH++I +++HE     YRIVGV V P SI+
Sbjct: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254

Query: 240 QTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXX 298
           ++S  SC  T + ++L ED+DNEV +TYSV++V  +  WATRWD Y   YD  +QWF   
Sbjct: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314

Query: 299 XXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXX 358
                         H LLRALKSD  RYNELNL++EFHE++GWKLSHGDVFR P K    
Sbjct: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374

Query: 359 XXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFF 418
                                     +  SR  L T+ F+LYALFGFVGSY SMGVY+FF
Sbjct: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434

Query: 419 KGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLS 478
            GPY K N+I+TP L+PG ILL I+++N FLL AHSS  IP  +LF ++ LW ++S+PLS
Sbjct: 435 HGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494

Query: 479 LAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYN 538
             GS+ A K CSW++HPTKTNQIARQIP QPWYL+T  A +VAGIF F SIAVELYFIY+
Sbjct: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554

Query: 539 SLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYI 598
           SLWF++ FYMFGF +                  YHSLCLENW WQWRSFI+GGLG ++Y+
Sbjct: 555 SLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYM 614

Query: 599 FIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           FIHSI FT+FKL GF T+VLY+GYS ++S+LCC+ TGA+GFFSSM  +RKI+ +VKV+
Sbjct: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/650 (54%), Positives = 446/650 (68%), Gaps = 8/650 (1%)

Query: 15  SRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSK 74
           +RA +LPG++PT Y    EI L VNHL+PS ++QHK+ +G ++ SDK  YLYSYDYY  +
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 75  LHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLI 134
            HFC+PE + +Q ESLGS++FGDR+YNSPF+LNMLE+K C SLCKS IPG DA FINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 135 KNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP-------R 187
           KNGF  NWL+DGLPA    ++ R  +    +GF LG V+++Q V      T         
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194

Query: 188 EETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246
           E     A     + N+EL +  NHYDI I+YH+   G YR+VGV V P SI+++S  SCE
Sbjct: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254

Query: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXX 306
            TG+ ++L ED+DN+V +TYSV +V    +WATRWD Y   YD T+QWF           
Sbjct: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLL 314

Query: 307 XXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXX 366
                 H LL+ALK+DFARYNE NLDDEF E++GWKL HGDVFR+P+K            
Sbjct: 315 LSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGV 374

Query: 367 XXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426
                           F +  SR +L T+ F+LYALFGFVGSY SMGVY+FF+GPY K N
Sbjct: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434

Query: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486
           M+LTP L+PG I +TII++NFFL+  HSS  IP   LF +VLLW + S+P + AGSL A 
Sbjct: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494

Query: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546
           K C+W++HPTKT QIARQIPFQPWYLKT+PA  +AGIFPF SIAVE+YFIY SLW+++ F
Sbjct: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554

Query: 547 YMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606
           YMFGF                    YHSLCLENW WQWRSFIVGG+G A+Y+FIHSI FT
Sbjct: 555 YMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614

Query: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           +FKL GFTT+VLY+GYS +IS+LCC+ TG++GF SSMF VRKIFSS+KVD
Sbjct: 615 KFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/659 (52%), Positives = 440/659 (66%), Gaps = 15/659 (2%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
            +++A  LPG+SPT Y    EI L VN LTPS +FQH+D++G +I SDKEHYLYSYDYYN
Sbjct: 32  GLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYN 91

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
            + HFC+PE+V  Q ESLGS++FGDR+YNSPF+L MLE K CV+LC++ IPG+DA FINK
Sbjct: 92  ERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINK 151

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREE--- 189
           LIK+GF  NWLVDGLPA   + + R  + +   GF LG   +   +    + +  EE   
Sbjct: 152 LIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDS 211

Query: 190 ----TGISAHGS-------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSI 238
               TG +           N+V  +ELP+  NH+DI +++H+     YR+VGV V P SI
Sbjct: 212 ETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSI 271

Query: 239 KQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXX 297
           +++S +SC    + + L E+ DNE+ +TYSV++V     WATRWD Y   YD  +QWF  
Sbjct: 272 ERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSL 331

Query: 298 XXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXX 357
                          H LLRAL SD +RYNELNLD+EFHE+SGWKL HGDVFR P K   
Sbjct: 332 INFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSML 391

Query: 358 XXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRF 417
                                      +  SR  LPT+ FV YALFGFVGSY SMGVY+F
Sbjct: 392 LSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKF 451

Query: 418 FKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPL 477
           F GPY K N+ILTP L+PG I + I+++NFFLL AHSS  IP S LF ++ LW  +S+PL
Sbjct: 452 FHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPL 511

Query: 478 SLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIY 537
           S AGS+ A K C+WD+HPTKTNQIARQ+P+QPWYL+T+ A L+AGIF F SIAVELYFIY
Sbjct: 512 SFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIY 571

Query: 538 NSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVY 597
           +SLWF++ FYMFGF +                  YHSLCLENWQWQWRSFI+GGLG +VY
Sbjct: 572 SSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVY 631

Query: 598 IFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           +FIHSI FT+FKL GF TIVLY GYS +IS LCC+ TGA+GFFS M  +RKI+S+VK++
Sbjct: 632 MFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/661 (52%), Positives = 442/661 (66%), Gaps = 17/661 (2%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
           +V+   +LPG++PT Y     I L VNHLTPS  F+HKD DGN + SDKE++LYSYDYY 
Sbjct: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75

Query: 73  SKLHFCKP--ENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFI 130
           SKLHFCKP    + +Q ESLGS+LFGDR+YNSPF+L ML D++C  LC + IPG+DA FI
Sbjct: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135

Query: 131 NKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNG-AMATPR-- 187
           N LIK+GFL NWL+DGLPA   + ++   S+   +GF LGSVE++Q V    +  TP+  
Sbjct: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQP 195

Query: 188 -----------EETGISAHGSNVVVN-LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEP 235
                      EE       + ++V+ +E  +  NH+DI I+YH+    +YRIVGV V P
Sbjct: 196 IVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNP 255

Query: 236 KSIKQTSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWF 295
            S+K+ S  C+    +++LSE  D +V++TYSV + +    WATRWD Y   YD T+QWF
Sbjct: 256 ISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWF 315

Query: 296 XXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKX 355
                            H L +ALK+DF RYNE NL+D F E+SGWKL+HGDVFR+P K 
Sbjct: 316 SLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKS 375

Query: 356 XXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVY 415
                                      F +  +R  LPTI F+LYA+FGFVGSY SMGVY
Sbjct: 376 MLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVY 435

Query: 416 RFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISV 475
           RFF GPY K NMILTP ++PG I + IIS+N FL+  HSSD +P   L  +VLLW+++S+
Sbjct: 436 RFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSL 495

Query: 476 PLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYF 535
           PLS AGSL + K C+W  HPTKTN++ RQIPFQPWYLKT+PA L+ GIFPF SIAVELYF
Sbjct: 496 PLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYF 555

Query: 536 IYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSA 595
           IY+SLWF++ FYMFGF +                  YHSLCLENW+WQWRSFI+GG+G +
Sbjct: 556 IYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCS 615

Query: 596 VYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKV 655
           +YIFIHSI FTEFKL GF TIVLYVGYS LI+ILC + TGA+GF S+MF V+KI+SS+KV
Sbjct: 616 IYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKV 675

Query: 656 D 656
           +
Sbjct: 676 E 676

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/649 (51%), Positives = 428/649 (65%), Gaps = 12/649 (1%)

Query: 16  RASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKL 75
            A +LPG++PT Y    ++ L VNHLTPS+ ++H D D ++   DKE +LYSYDYY  K 
Sbjct: 21  EAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYKKF 79

Query: 76  HFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIK 135
           HFC+P  + +Q ESLGS++FGDR+YNSPFKL +L++  C SLCKSVIPG+DA FINKLI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 136 NGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIM-------QGVHNGAMATPRE 188
           NGF  NW++DGLPA   + + + +     NGF LG V+++       + +H+        
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYEPDTRSLHDELELQLNA 199

Query: 189 ETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCEF 247
           +  + + G  V    E+P+  NHYDI I+YH+     YRIVGV V P SIK+ S +SCE 
Sbjct: 200 KKNVLSPGDKVT---EIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCES 256

Query: 248 TGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXX 307
           TG+ + LSE +DNEV +TYSV++++    WATRWD Y   YD  +QWF            
Sbjct: 257 TGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLL 316

Query: 308 XXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXX 367
                H L  ALK+D ARYNELNLD +F EE+GWKL HGDVFR PNK             
Sbjct: 317 SSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQ 376

Query: 368 XXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNM 427
                          F +  SR  L T+ F+LYA+FG  GS+ SM  Y+FF G   ++N+
Sbjct: 377 LALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNL 436

Query: 428 ILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIK 487
           +LTP L+PG IL  ++ LNFFL+  HSS AIPF  +  +VLLW +IS+PLS  GS+ A K
Sbjct: 437 VLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWK 496

Query: 488 TCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFY 547
            C+W++HPTKTNQIARQIPFQPWYLKT+P AL+AGIFPF SIAVELYFIY+SLWF++ +Y
Sbjct: 497 KCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYY 556

Query: 548 MFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTE 607
           MFGF                    YHSLC+ENW+WQWRSF++GG G A Y+F HSI FT+
Sbjct: 557 MFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTK 616

Query: 608 FKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           F+L G TTIVLY+GYS+LIS LCCL TGA+GF SS+ LVRKI+S VKVD
Sbjct: 617 FRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/650 (52%), Positives = 431/650 (66%), Gaps = 8/650 (1%)

Query: 14  VSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNS 73
           ++ A +LPG++PT Y    EI L VNHLTPS +FQH D++G+ +  DKE +LYSYDYY  
Sbjct: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71

Query: 74  KLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKL 133
           K HFC+PEN+I+Q ESLGS++FGDR+YNSPF+LNMLE+K+CV LCKS IP +DA FINKL
Sbjct: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131

Query: 134 IKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGIS 193
           I+NGF HNWLVDGLPA   +++ R +S    NGF LG V+++  + +       E   I 
Sbjct: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191

Query: 194 AHGSNVVVN------LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCE 246
              ++  +        EL +  NH+DI I+YH+     YR+VGV V P SIK+ +S+SC+
Sbjct: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251

Query: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXX 306
             GE + LSED DN V +TYSV +V     WATRWD Y   YD  +QWF           
Sbjct: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVIL 311

Query: 307 XXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXX 366
                 H L RALK+D +RYNELNLDDEF EE+GWKL HGDVFR P +            
Sbjct: 312 LSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371

Query: 367 XXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426
                             +  SR  L T+ F+LYALFG  GSY SM VY+FF G   K+N
Sbjct: 372 QLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431

Query: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486
           MILTP LIP +I ++++ LN FL+  HSS AIPF  + A+V+LW + S+PLS+AGS+ + 
Sbjct: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491

Query: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546
           K   WD+ PT TNQIARQIPFQPWYLKT+PA+L+AG FPF SI VELYFIY+SLWF++ F
Sbjct: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550

Query: 547 YMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606
           YMFGF                    Y+SLC+ENW+WQWR F +GG G A Y+F+H+I FT
Sbjct: 551 YMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610

Query: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           +FKL G TT+VLY+GYS++IS LCCL TGAVGF SS++ VRKI+ S+KVD
Sbjct: 611 KFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/685 (49%), Positives = 424/685 (61%), Gaps = 35/685 (5%)

Query: 7   ALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66
            LSL  A +   +LPG +P  Y     I L VNHLTPS +FQH D DGN IK DK   LY
Sbjct: 7   VLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLY 66

Query: 67  SYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGED 126
            YDYYN KLHFC+PE + +Q ESLGSV+FG+++YNSPF + MLED  CV LC + IPG+D
Sbjct: 67  PYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKD 126

Query: 127 AAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP 186
           A FINKLIKNGF+ NWL+DGLPA   +++ R ++     GF LG VE+ Q V    ++  
Sbjct: 127 AKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSES 186

Query: 187 REETGISAHGS---------------------------------NVVVNLELPHLNNHYD 213
            +E  +S   +                                 N+V N+E+P   NH+D
Sbjct: 187 EKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFD 246

Query: 214 ITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCEFTGE-QISLSEDQDNEVLYTYSVRYV 271
           I ++YH+   G +R+VGV V P S+    S SC    + ++ L E++DNEV++TYSV++ 
Sbjct: 247 IEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFT 306

Query: 272 RFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNL 331
                WATRWD Y   YD  +QWF                 H LLRALKSD +RYNE NL
Sbjct: 307 PSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNL 366

Query: 332 DDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREV 391
            DEF E+SGWKL HGDVFR P                                +  SR  
Sbjct: 367 GDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGS 426

Query: 392 LPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLI 451
           LPT  F+ YA+FGFVGSY SMG+Y+FFKGPY K NMILTP L+PG+I LT+I +N  L  
Sbjct: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYF 486

Query: 452 AHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWY 511
             SS+ IP + L  +V LW++ S+PL+ AGSL + K C+WD+HPTKTN+I RQIPFQPW+
Sbjct: 487 VGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWF 546

Query: 512 LKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXX 571
           LKT+PA L+ G+  F SIAVELYFIY+SLWF++ FYMFGF +                  
Sbjct: 547 LKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIIT 606

Query: 572 YHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCC 631
           Y +LC ENW WQWRSF +GGLG ++YIFIHSI FT+FKL GF TIVLYVGYS LIS L C
Sbjct: 607 YRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTC 666

Query: 632 LTTGAVGFFSSMFLVRKIFSSVKVD 656
           + TGA+GF  SMF VR+IF+S+KVD
Sbjct: 667 IVTGAIGFICSMFFVRRIFASIKVD 691

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/657 (49%), Positives = 422/657 (64%), Gaps = 19/657 (2%)

Query: 15  SRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSK 74
           S A ++PGIS   Y     I L VN LTPS +F+H D++G ++ +DKEH+LYSYDYY  K
Sbjct: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78

Query: 75  LHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLI 134
            HFC+PE V  ++ESLGSVLFGDR+YNSPF+L MLE K CV LCK+ IP +DA FINKLI
Sbjct: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138

Query: 135 KNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP-------- 186
           KNGF +NWL+DGLP+   I + +  S   ++GFPLGSV +        +  P        
Sbjct: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198

Query: 187 -------REETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIK 239
                  RE   + A    ++   E+ +  NH++I I+YH+     YR+VGV V+P SIK
Sbjct: 199 AVKAYKKREAKNVPA---GLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIK 255

Query: 240 QTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXX 298
           +    SC  TG Q+ L+E+ +N+VL+TYSV +++    WATRWD Y  +YD ++QWF   
Sbjct: 256 RDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLI 315

Query: 299 XXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXX 358
                         H LLRALK D +RY +LNLD+ F E+SGWKL+HGDVFRMP K    
Sbjct: 316 NFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVL 375

Query: 359 XXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFF 418
                                   F +   R  LPT  FVLYA+FGFVGSY SMGVY+FF
Sbjct: 376 SIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFF 435

Query: 419 KGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLS 478
            GPY K NMILTP L+PG +LL II LNFFLL  HSS  IP S +  ++ LWL++SVPLS
Sbjct: 436 HGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLS 495

Query: 479 LAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYN 538
             GS  A K C+W+ +PT  N+I R+IP QPWY++++P  L++GI PF +IAVELYFIY+
Sbjct: 496 FLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYS 555

Query: 539 SLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYI 598
           SLW+++ FYMFGF +                  YHSLCLENW+WQWRSF+ GGLG A YI
Sbjct: 556 SLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYI 615

Query: 599 FIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKV 655
           F++SI FT FK  GF +I+LY+GYS LI ++ CL TGAV F  +MF V++IF+S+KV
Sbjct: 616 FLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/690 (48%), Positives = 432/690 (62%), Gaps = 39/690 (5%)

Query: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60
           M   +  ++ L +   A +LPG++P+ Y+   E+ L VNHLTPS ++Q KD  G  ++S 
Sbjct: 1   MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES- 59

Query: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120
           +E  LYS+DYY  KLHFCKPE +++Q +SLGS+LFGDR+YNSPF + ML+ ++ V LC  
Sbjct: 60  REKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSI 119

Query: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN 180
            IPG DA FINKLIKNGF  NWL+DGLPA   I +    +     GFPLG VEI + V  
Sbjct: 120 TIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNV-- 177

Query: 181 GAMATP----------------------------------REETGISAHGSNVVVNLELP 206
           G +  P                                  ++E       S +V N+E P
Sbjct: 178 GGLGIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFP 237

Query: 207 HLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTSNSCEFTGEQISLSEDQDNEVLYTY 266
           +L NHY I ++ H+   G YR+VGV V+P S   ++N  +  G ++ L E +DNEV ++Y
Sbjct: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEK--GNKLFLDEKKDNEVTFSY 295

Query: 267 SVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARY 326
           SV ++     WATRWD Y  +Y+ T+QWF                 + LL+ALKSDFARY
Sbjct: 296 SVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARY 355

Query: 327 NELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNA 386
            E NLD+ F+E+SGWKL HGDVFR+P++                              + 
Sbjct: 356 EEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISP 415

Query: 387 GSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLN 446
            SR  LP+  F  YALFGF GSY SM VY+FFKGPY K NMILTP L+PG IL++I+ LN
Sbjct: 416 SSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLN 475

Query: 447 FFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIP 506
           FFLL  HSS  IP +AL  +V++W +IS+PLS  GSL A K  +W +HPTKTNQIARQIP
Sbjct: 476 FFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIP 535

Query: 507 FQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXX 566
           FQ WYLKT+PA L+AGIFPF +IAVELYFIY SLWF++ FYMFGF               
Sbjct: 536 FQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLV 595

Query: 567 XXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLI 626
                Y SLC+ENW WQWRSF +GG+G ++YIFIHSI FT+FKL GFTT++LY+GY++L+
Sbjct: 596 TVLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLL 655

Query: 627 SILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           SIL C+ TGAVGF SSM  VRKI+S+V+VD
Sbjct: 656 SILSCIVTGAVGFISSMIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/664 (50%), Positives = 420/664 (63%), Gaps = 27/664 (4%)

Query: 19  FLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFC 78
           +LPG++PT Y     I L VNHLTPS +F+H D DG +   D+E +LYSYDYY  K HFC
Sbjct: 21  YLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKFHFC 79

Query: 79  KPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGF 138
           KPE + +Q ESLGS++FGDR+YNSPFKL ML+DK C +LC S IP  DA FINKLI NGF
Sbjct: 80  KPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGF 139

Query: 139 LHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------MQG-----VHNGAMATP- 186
             NWLVDGLPA     +ER  S   T GF LG +++      M G      H      P 
Sbjct: 140 FQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPV 199

Query: 187 -------------REETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEV 233
                         E+         +V  LE  +  NH++I +QYH+   G YR+VGV V
Sbjct: 200 AQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIV 259

Query: 234 EPKSIKQ-TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTV 292
            P+SIK+ +SNSC  TGE + LSE+++  V ++YSV++      WATRWD Y   YD  +
Sbjct: 260 NPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVYDPKI 319

Query: 293 QWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMP 352
           QW+                 H L R L+ D +RYN+LNLDD+F EE+GWKL HGDVFR P
Sbjct: 320 QWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFRTP 379

Query: 353 NKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASM 412
            K                              +  SR  L T+ F+LYALFG +GSY SM
Sbjct: 380 TKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGSYTSM 439

Query: 413 GVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLI 472
             Y+FF G Y KVNMILTP L+PGL+   ++ LNFFL++  S+ AIPF  + A+VLLW +
Sbjct: 440 ATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFV 499

Query: 473 ISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVE 532
            S+PLSLAGSL A K C W++HPTKT QI RQIPFQPWYLKT PAAL+AGIFPF SIAVE
Sbjct: 500 FSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIAVE 559

Query: 533 LYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGL 592
           LYF+Y+SLWF++ FYMFGF                    Y+SLCLENW+WQWR F +GG 
Sbjct: 560 LYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFWIGGA 619

Query: 593 GSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSS 652
           G A+Y+F+H+I FT+FKL GF TIVLYVGYS++IS+L CL TGAVGF SS++ VR+I+SS
Sbjct: 620 GCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIYSS 679

Query: 653 VKVD 656
           +KVD
Sbjct: 680 IKVD 683

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/666 (47%), Positives = 428/666 (64%), Gaps = 13/666 (1%)

Query: 1   MHFFFTALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSD 60
           M++   +L    +V  A  LPG+ P  Y    +I L VNHLTPS HF HK+++G +I + 
Sbjct: 1   MNYVILSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTA 60

Query: 61  KEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKS 120
           K++ ++SYDYY  K HFC+P ++ +   S+GS+LFGDR+YNSPF+LNMLE+K+CV LC+S
Sbjct: 61  KKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCES 120

Query: 121 VIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQ---- 176
           +IPG+DA FINKLIKNG+  NW +DGLPA   + ++R  S+   NGF LG VEI Q    
Sbjct: 121 IIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGD 180

Query: 177 -----GVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
                 VH+ +    R+   +     N++  +E+P+  NH+DI I+YHE   G YR+VG 
Sbjct: 181 KLLPDSVHDISDLAKRDAKNLV---QNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGA 237

Query: 232 EVEPKSI-KQTSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDT 290
            V P SI ++++  C  TG+ ++L+E++DN V  TYSV +V    +W TRWD Y   YD 
Sbjct: 238 TVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDP 297

Query: 291 TVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFR 350
            +QWF                 + LL+ALKSDFARYN +NLDD+  EESGWKL HG VFR
Sbjct: 298 KIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFR 357

Query: 351 MPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYA 410
           +P                                +   R  LPT   +LY LFGF+ SY 
Sbjct: 358 IPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYV 417

Query: 411 SMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLW 470
           SMGVY+FFKGPY KVNM+LTP L+PGLI++T ++LN FL+ + SS  +P   +  ++LLW
Sbjct: 418 SMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLW 477

Query: 471 LIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIA 530
             +S+PLS+AGSL A K C WD+HPT TNQIA+ IP Q WYLKT+PA+L+ G+F F SI+
Sbjct: 478 FAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSIS 537

Query: 531 VELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVG 590
           V+LYFIY SLWF+  FYM+GF +                  YHSLC ENW+WQWR F +G
Sbjct: 538 VQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIG 597

Query: 591 GLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIF 650
           GLG ++Y+ +HS+FF E KL GFT I+LY+GYS +++ L  L TG+VGF SSMF +++IF
Sbjct: 598 GLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIF 657

Query: 651 SSVKVD 656
           SSVKVD
Sbjct: 658 SSVKVD 663

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/681 (49%), Positives = 429/681 (62%), Gaps = 33/681 (4%)

Query: 8   LSLLWAVSRASF-LPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66
           LS+LWA   + F LPG++PT Y     I L VNHLTP+ ++QH D+DGN++  DKE  LY
Sbjct: 8   LSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLY 66

Query: 67  SYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGED 126
           SYDYY  K HFC+PE + +Q ESLGS++FGDR+YNSPF++ ML++K C SLC   IP +D
Sbjct: 67  SYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADD 126

Query: 127 AAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------------ 174
           A FINKLI NGF  NWLVDGLPA     + R  S   T GF LG V I            
Sbjct: 127 AKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGG 186

Query: 175 -MQGVHNGAMATPRE-----------------ETGISAHGSNVVVNLELPHLNNHYDITI 216
              G  +G+  + +E                 +    ++   +V  LE P+  NH++I +
Sbjct: 187 SQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEV 246

Query: 217 QYHEPEAGKYRIVGVEVEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSH 275
           QYH+   G YR+VGV V P SIK+ S ++C+ TGE + LSE +  EV ++YSV++     
Sbjct: 247 QYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSET 306

Query: 276 TWATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEF 335
            WATRWD Y   YD  +QWF                 H L   L  D +RYN++NLDD+F
Sbjct: 307 VWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDF 366

Query: 336 HEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTI 395
            EE+GWKL HGDVFR P +                              +  SR  L T+
Sbjct: 367 QEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTV 426

Query: 396 FFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSS 455
            F+LYALFG  GSY SM  Y+FF GPY KVNM+LTP L+PGL+   +++LNFFL++  S+
Sbjct: 427 MFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESA 486

Query: 456 DAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTL 515
            AIPF  +  +VLLW + S+PLS+AGSL A K C WD+HPTKT QI RQIPFQPWYLKT+
Sbjct: 487 GAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTV 546

Query: 516 PAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSL 575
           PA+L+AGIFPF SIAVELYFIY+SLWF++ FYMFGF                    Y+SL
Sbjct: 547 PASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSL 606

Query: 576 CLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTG 635
           CLENW+WQWR F +GG G A+Y+FIH+I FT+F+L GFTTIVLYVGYS+++S+L CL TG
Sbjct: 607 CLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITG 666

Query: 636 AVGFFSSMFLVRKIFSSVKVD 656
            VGF SS++ VR+I+SSVKVD
Sbjct: 667 TVGFLSSLWFVRRIYSSVKVD 687

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/649 (47%), Positives = 415/649 (63%), Gaps = 12/649 (1%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
            +++  +LPG +PT Y     I L VNH+TP+      D+ G + + DKE YLY+YDYY 
Sbjct: 12  GLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYY 69

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
            +LH C+P+ + + +ESLGS++FGDRL+NSPF+L MLE+KSCV+LC+  +P EDA FIN+
Sbjct: 70  PRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQ 129

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPRE---- 188
           LI++GF HNWLVDGLPAG  +++ R ++     GF LG V  ++G  +     P E    
Sbjct: 130 LIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV--IRGTEDRNQEEPGEIELQ 187

Query: 189 ETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCEF 247
              +   G +VV    +P+  NH++IT+ YH+    + R+VGV V P+S++    + C  
Sbjct: 188 TRRVLQPGESVVA---VPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCAN 244

Query: 248 TGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXX 307
           +G  + LSE  D +V +TYSVR+     +WATRW  Y   YD  VQW+            
Sbjct: 245 SGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLLL 304

Query: 308 XXXXXHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXX 367
                H L RALK+D  RYN+ NLD+EF E+ GWKL H DVFR P+K             
Sbjct: 305 SSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQ 364

Query: 368 XXXXXXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNM 427
                          F +  SR  L TI FVLYA+FG  GSY SM  Y+ F G   KVNM
Sbjct: 365 LFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNM 424

Query: 428 ILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIK 487
           +LTP L+PG+I  T++ +NFFL++  SS A+PF  + A+V+LW ++S+P+S+ GSL A K
Sbjct: 425 VLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARK 484

Query: 488 TCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFY 547
             +WDQHPTKT+QIA+QIP QPWYL+T PAA +AG+FPF +IAVELYFIY S+WF+  FY
Sbjct: 485 KNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMFY 544

Query: 548 MFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTE 607
           MFGF                    Y+SLC+ENW WQWRSFI+GG+G + Y+FI+SI FT+
Sbjct: 545 MFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTK 604

Query: 608 FKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           F+L GF TIVLYVGYS+LIS L CL TG +GF SS++ VRKI+SS+KVD
Sbjct: 605 FRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/620 (48%), Positives = 386/620 (62%), Gaps = 11/620 (1%)

Query: 46  HFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFK 105
           H+ HK+++G +I +D +  +YSYDYY  KLHFCKPE+V +   S+GSVLFGDRLYNSPF+
Sbjct: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQ 61

Query: 106 LNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITN 165
           LNML++K+C  LC S I G DA FINKLIKNG+  NWL+DGLPA   + + R  S    N
Sbjct: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGN 121

Query: 166 GFPLGSVEIMQGVHNGAMATPRE-ETGISAH---GSNVVVNL----ELPHLNNHYDITIQ 217
           GF LG VEI Q    G    P   +T    H     N+V NL    E+P+  NH+DI I+
Sbjct: 122 GFELGLVEIRQT--TGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIE 179

Query: 218 YHEPEAGKYRIVGVEVEPKSIKQTSNS-CEFTGEQISLSEDQDNEVLYTYSVRYVRFSHT 276
           YH+     YR+VGV V P SI ++ +  C+ TG+ +SLSE + N + +TYSV ++     
Sbjct: 180 YHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETA 239

Query: 277 WATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXXXXXHMLLRALKSDFARYNELNLDDEFH 336
           W TRWD Y   YD T+QW                    LL+ALKSDF+RY ELNLD+   
Sbjct: 240 WVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIK 299

Query: 337 EESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNNAGSREVLPTIF 396
           E++ WKL HGDVFR P+                                 GSR  LPT+ 
Sbjct: 300 EDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVM 359

Query: 397 FVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSD 456
           F+LY  F F+ S+ SMGVY+FF G    +N ILTPFL+PGL+LL II LN FL+  HSS 
Sbjct: 360 FLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSG 419

Query: 457 AIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLP 516
            IP +   +++LLW  I VPLS+ GSL A KTC WD HPTKTN +++ IP Q WYL+T+P
Sbjct: 420 VIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIP 479

Query: 517 AALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLC 576
           A+L+ G+F F S++VELYF+Y SLWF++ FYM+GF                    Y+SL 
Sbjct: 480 ASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLS 539

Query: 577 LENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGA 636
            ENWQWQWRSF++ GLG + Y+F+HS+ FTE KL GFT  +LY+GYS +I+ L  + TGA
Sbjct: 540 AENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGA 599

Query: 637 VGFFSSMFLVRKIFSSVKVD 656
           +GF SSM  VR I+S+VKVD
Sbjct: 600 LGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  493 bits (1268), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 261/645 (40%), Positives = 367/645 (56%), Gaps = 52/645 (8%)

Query: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72
            VS   + PG+SP  Y    EI L VN+L+                     +L++ DYY+
Sbjct: 12  GVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYS 52

Query: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132
             +  CKP  + EQ+ESLGSV+FGDRLYNSPFK++ML++  CV LC + I   D A  N 
Sbjct: 53  DSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNT 109

Query: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGI 192
                + +NWLVDGLP   ++  +  S A+              G HN +        G 
Sbjct: 110 FFGYRYSYNWLVDGLP---VLGIDGTSDAN--------------GYHNNS----ELFMGY 148

Query: 193 SAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQT-SNSCEFTGEQ 251
            A         E  ++ NH+DI I Y++   G+YR+V  E +P S+ +T S  C    + 
Sbjct: 149 QAD--------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAKP 200

Query: 252 ISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFXXXXXXXXXXXXXXXX 311
           + +       + +TYSV + +   +W+TRWD Y   YD  +Q                  
Sbjct: 201 VPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVL 260

Query: 312 XHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXX 371
            H L R LK D A Y+E NLDDEF ++  WK+ HG+VFR P+K                 
Sbjct: 261 VHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFM 320

Query: 372 XXXXXXXXXXXFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTP 431
                      F +  +R  L T+ FVLYALFG VGSY SM +Y+FF G   K+N+ILTP
Sbjct: 321 ALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTP 380

Query: 432 FLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSW 491
            LIP  + +T + LNFFL+ A SS A+PF  +  +++LW I+SVP+S+ GSL + K   W
Sbjct: 381 LLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRW 440

Query: 492 DQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGF 551
           D+HP KTNQIARQ+P QPWY+KT  A  +AG+FPF ++AVELY+IY S+W    F+M+GF
Sbjct: 441 DEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGF 500

Query: 552 SMXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLR 611
                               Y+SLC+ENW+WQWRSFI+GG+G +VY+F+HS+FF +FK  
Sbjct: 501 LFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFP 560

Query: 612 GFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656
           GF ++VLY+GYS ++SI+CCL TG++GF ++++ VRKI+S++KVD
Sbjct: 561 GFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  139 bits (350), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 163/663 (24%), Positives = 273/663 (41%), Gaps = 86/663 (12%)

Query: 41  LTPSRHFQHKDKD--GNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFG 96
           L P+ +FQ  + +   N ++SD     Y+Y      L F  P  + ++    SL  ++ G
Sbjct: 41  LQPNFYFQGDEVELIVNKVESDLTQLPYAY----YDLPFTCPPTMHKKPLHLSLNEIIRG 96

Query: 97  DRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINN 155
           DR + S + L   +D +C  LC      E      KL+++G++  WL+D  LPA T   +
Sbjct: 97  DRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFIS 156

Query: 156 ERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDIT 215
             +   +  +GFPLG V+               +TG               +LN H  + 
Sbjct: 157 TIDQKKYYASGFPLGFVD--------------PDTGKV-------------YLNTHVMLV 189

Query: 216 IQYHEPEAGKYRIVGVEVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVL--YTYSVRY 270
           I+Y+  +  K+ IVG EV PKS+        S  +   +I + E+ D+     +TYSV +
Sbjct: 190 IRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYW 249

Query: 271 VR-FSHTWATRWDNY----RFSYDTTVQ--WFXXXXXXXXXXXXXXXXXHMLLRALKSDF 323
              +   W  RWD Y      S + T Q  W                   +LLR+ KS  
Sbjct: 250 REEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSR 309

Query: 324 ARYNELNLDDEFHEESGWKLSHGDVF--RMP--NKXXXXXXXXXXXXXXXXXXXXXXXXX 379
               ++N  +E      ++++   +   R P  N                          
Sbjct: 310 DISTDINKSEEHRNGLVYEVARNWIINERTPLANLLILFVSMGVQFLFTVLGSLTISCSL 369

Query: 380 XXXFNNAGSREVLPTIFFVLYALFG-FVGSY-------ASMGVYRFFKGPYPKVNMILTP 431
               +   S   +  + FVL A    ++GS        A+M      KG +    ++   
Sbjct: 370 NKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGS 429

Query: 432 FLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSL-----------A 480
           FL PG++++  + LN  +    S+ A+PF  +   + ++ I+ +PLS+            
Sbjct: 430 FL-PGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTK 488

Query: 481 GSLTAIK-TCSWDQHPTKTNQIA--RQIPFQPWYLKTLPAAL---VAGIFPFASIAVELY 534
           GSLT  K   S  +     N++   + I      LK++  AL   ++GIFPF  I VEL 
Sbjct: 489 GSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQ 548

Query: 535 FIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCL---ENWQWQWRSFIV 589
           ++Y S+W  +  F+Y +GF                    Y  L +    N  W+W SF +
Sbjct: 549 YVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFM 608

Query: 590 GGLGSAVYIFIHSIFFTEFKL--RGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVR 647
           G    A Y+ ++S+++  F L  RGF++I + V Y  L + LC    G++   +S F V 
Sbjct: 609 GS-SCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVE 667

Query: 648 KIF 650
           K++
Sbjct: 668 KLY 670

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  129 bits (325), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 143/598 (23%), Positives = 235/598 (39%), Gaps = 73/598 (12%)

Query: 89  SLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-L 147
           SL  ++ GDR + S +KL + +D  C  LC      E       LIK+G++  W++D  L
Sbjct: 89  SLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWMIDDDL 148

Query: 148 PAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPH 207
           PA T   +  ++  +   GFPLGSV+            PR                    
Sbjct: 149 PAATTYISTTDNLKYYAPGFPLGSVD------------PRSSR---------------VF 181

Query: 208 LNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTSNSCEFTGEQISLSEDQD---NEVLY 264
            NNH  + I+Y+  ++ K  IVG E  PKS+  +   C    +     E  D    E++Y
Sbjct: 182 FNNHVMLVIRYNLVDSDKVTIVGFEAYPKSV--SDYHCPGASKDFKPFEITDPPLEEIVY 239

Query: 265 ---TYSVRYVRFSHT-WATRWDNY------RFSYDTTVQWFXXXXXXXXX---XXXXXXX 311
              TYSV +   +   W+ RW  Y        S  +T  W                    
Sbjct: 240 IPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIVN 299

Query: 312 XHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKXXXXXXXXXXXXXXXXX 371
             M+ R            +  D F+  + W L     F++ N+                 
Sbjct: 300 LIMIFRNPNEQLESKENEDSSDIFNVANNW-LRARQGFQL-NRLIVCVSMGIQVMFMILG 357

Query: 372 XXXXXXXXXXXFNNAGSREVLPTIFFVLYALFG-FVGSYASM----GVYRFFKGPYPKVN 426
                       N   S   +  + FV  A    FVG++  M      Y F    Y  V 
Sbjct: 358 PLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTF----YNPVF 413

Query: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486
            +L    +PG I++  +SLN  + I  S+ A+PF  +   V  + ++ + +SL G   A 
Sbjct: 414 AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVAA 473

Query: 487 ---KTCSWDQHPTKT---NQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSL 540
              ++   D  P  T    ++ R+       L    A L++G  PF  I VEL ++Y S+
Sbjct: 474 QMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYKSV 533

Query: 541 WFHQ----FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLC---LENWQWQWRSFIVGGLG 593
           W  +    + Y F F+                      L    + +  W+WR F++   G
Sbjct: 534 WLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWRCFVIST-G 592

Query: 594 SAVYIFIHSIFFTEF--KLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKI 649
            + Y+ I+S+++  F   + G + + + V YS + ++LC L TG++G+ +S + V+KI
Sbjct: 593 CSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKKI 650

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 131/258 (50%), Gaps = 39/258 (15%)

Query: 433 LIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLS-LAGSLTA------ 485
           L+PG+++LT I LN  + +  S++ +PF+ +  ++ ++ I+ +PLS L GS+ A      
Sbjct: 420 LLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEE 479

Query: 486 --------IKTCS-------WDQHPTKTNQIARQIPFQ-PWYLK-------TLPAALVAG 522
                   IK  S        D+      +  R++ ++  W LK       T+ + L +G
Sbjct: 480 YSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASG 539

Query: 523 IFPFASIAVELYFIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENW 580
           IFPF  I VEL F+Y S+W+ +  F+Y +GF +                  Y  + + + 
Sbjct: 540 IFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSK 599

Query: 581 Q----WQWRSFIVGGLGSAVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTT 634
                W+W++F +     A Y+  +SI+  F    +R F++I++ V YS+L + LC L  
Sbjct: 600 DNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAM 658

Query: 635 GAVGFFSSMFLVRKIFSS 652
           G++G+ +S++ V++++ S
Sbjct: 659 GSIGYLASLWFVKRVYRS 676

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 112/253 (44%), Gaps = 42/253 (16%)

Query: 41  LTPS--RHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFG 96
           LTP+  RH    +   N I+SD       Y YY+  L F  P  V ++    SL  V+ G
Sbjct: 33  LTPTIYRHGDPVEIIVNKIESDATQL--PYGYYD--LPFTCPPTVDKKPLHLSLNEVIRG 88

Query: 97  DRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINN 155
           DR + S ++L   +D  C  LC      +    ++K IK  ++  W +D  LPA T   +
Sbjct: 89  DRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQWFIDKELPAATTFIS 148

Query: 156 ERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDIT 215
             +   +  +GFPLG V+              EETG               ++NNH  + 
Sbjct: 149 TVDQKKYYGSGFPLGFVD--------------EETG-------------KVYVNNHVMMV 181

Query: 216 IQYHEPEAGKYRIVGVEVEPKSIKQ---TSNSCEFTGEQISLSE--DQDNEVLYTYSVRY 270
           I+YH  +   + IVG E+ PKS+        S ++   ++ + E  ++D  + +TYSV +
Sbjct: 182 IRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVVPEIANEDTFIPFTYSVYW 241

Query: 271 V-RFSHTWATRWD 282
              F   W  R++
Sbjct: 242 REEFDVEWKDRYN 254

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 121/249 (48%), Gaps = 24/249 (9%)

Query: 422 YPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAG 481
           YP V  +L   L+P  ++L  + LN  +    S+ A+PF  +  ++ ++ ++ +PLSL G
Sbjct: 420 YP-VFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLLG 478

Query: 482 SLTAIKTCSWDQHPTKTNQIA---------RQIPFQPWYLKTLP----AALVAGIFPFAS 528
              A+K  S +  P+ +  I          + I   P  L   P    A L  G+FPF  
Sbjct: 479 GYIAVK--STNSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPFII 536

Query: 529 IAVELYFIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXY---HSLCLENWQWQ 583
           I VEL ++Y SLW  +  F+Y +GF +                  +   +S    +  W+
Sbjct: 537 IYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNWR 596

Query: 584 WRSFIVGGLGSAVYIFIHSIFFTEFKL--RGFTTIVLYVGYSMLISILCCLTTGAVGFFS 641
           W SF +G    A Y+ ++S+++  F L  RGF++I + V Y  L +I+C   TG++   +
Sbjct: 597 WTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLT 655

Query: 642 SMFLVRKIF 650
           S + V+KI+
Sbjct: 656 SHWFVQKIY 664

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 104/239 (43%), Gaps = 40/239 (16%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFGDRLYNSPFKLNMLEDK 112
           N ++SD     Y+Y      L F  P  + ++    SL  ++ GDR + S + LN  ED 
Sbjct: 58  NKVESDLTQLPYAY----YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILNFGEDD 113

Query: 113 SCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGS 171
            C  LC      E      +L+KNG++  WL+D  LPA T   +  +   +  +GFPLG 
Sbjct: 114 QCHILCTRKTTKEGMKEAQELVKNGYVVQWLIDDELPAVTTFISTTDHKKYYASGFPLGF 173

Query: 172 VEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
           V+               ETG +             +LN H  I I+Y+  +  K+ I G 
Sbjct: 174 VD--------------PETGKT-------------YLNTHVMIVIRYNTVDTNKHTIFGF 206

Query: 232 EVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVL--YTYSVRYV-RFSHTWATRWDNY 284
           E+ PKS         S ++   ++ + E+ D+     +TYSV +   +   W  RWD Y
Sbjct: 207 ELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLY 265

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 109/239 (45%), Gaps = 38/239 (15%)

Query: 51  DKDGNNIKSDKEHYLYSYDYYNSKLHF-CKPENVIEQAE-SLGSVLFGDRLYNSPFKLNM 108
           D   N ++SD  H+  SY YY+  LHF C P   ++    +   +L+G++ + S ++L  
Sbjct: 69  DITVNKVESDLTHF--SYGYYD--LHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTF 124

Query: 109 LEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLV-DGLPAGTLINNERESSAHITNGF 167
            +D+ CV LC     GE      +LIK  ++  WL  D LP  T   N ++   + ++GF
Sbjct: 125 GKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGF 184

Query: 168 PLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYR 227
           PLG  +            P  +                 ++NNH  I I+YH  + GK  
Sbjct: 185 PLGQYD------------PETDEA---------------YINNHVMIVIRYHTIDQGKNT 217

Query: 228 IVGVEVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVR-FSHTWATRWD 282
           IVG EV PKS+        S ++T  +I  + +    + +TY+V +   F   W  RW+
Sbjct: 218 IVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWN 276

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 129/290 (44%), Gaps = 42/290 (14%)

Query: 401 ALFGFV-GSYASMGVYRFFKGPYPK---VNMILTPFLIPGLILLTIISLNFFLLIAHSSD 456
           A+F F+ GS+ S  +    +G   +   VN I+    +PG+ L+ ++ LN+ L   ++++
Sbjct: 381 AVFLFISGSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAAN 440

Query: 457 AIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIA----RQIPFQPWYL 512
            +P   +  +   + I+ VP+S+ G   A +    +   T  N  A     +   +P Y+
Sbjct: 441 TLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYV 500

Query: 513 KT-----------LPAALVAGIFPFASIAVELYFIYNSLWFHQ--FFYMFGFSMXXXXXX 559
           ++           +   L  G+ PFA I VEL F Y SLW  +   +Y++GF +      
Sbjct: 501 ESKNSIPFVLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIV 560

Query: 560 XXXXXXXXXXXXYHSLCLEN------WQ------------WQWRSFIVGGLGSAVYIFIH 601
                       Y  L   N      W             W+W++F +GG   A Y+  +
Sbjct: 561 CICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAY 619

Query: 602 SIFFTEF--KLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKI 649
           SI +  F  + R F +  L+V YS L +ILC    G++ + SS++ + K+
Sbjct: 620 SILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 121/244 (49%), Gaps = 25/244 (10%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA-------- 485
           +PG+I+++   LN  +    S++A+PF  +   + ++ I+ +PLSL G + A        
Sbjct: 466 LPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 486 -IKTCSWDQHPTKTNQIARQIPFQPWYLKTL--PAALVAGIFPFASIAVELYFIYNSLWF 542
            +   + D+  +K N++   +P  P     L      + G+FP   I VE+ ++Y SLW 
Sbjct: 526 WLSGITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWL 583

Query: 543 HQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXY--HSLCLENW----QWQWRSFIVGGLGS 594
            +  F+Y +GF                    Y     C E+      W+W+ F +G  G 
Sbjct: 584 EKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG- 642

Query: 595 AVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSS 652
            VY+ ++S++  F    + GF++I++ + YS+L +I+C L  GA+ + ++ + + KI+  
Sbjct: 643 GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-H 701

Query: 653 VKVD 656
           VKV+
Sbjct: 702 VKVN 705

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 108/238 (45%), Gaps = 42/238 (17%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFGDRLYNSPFKLNMLEDK 112
           N ++SD     Y+Y      L F  P  + +     SL  ++ GDR + S +KL   ED 
Sbjct: 68  NKVESDLTQLPYAY----YDLPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDN 123

Query: 113 SCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGS 171
            C  LC      E    ++KLI+ G++  WL+D  LPA T   +  +   +  +GFPLG 
Sbjct: 124 PCEVLCARKTTKEGMQTLDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGF 183

Query: 172 VEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
           ++               +TG +             +L+NH  + I++H  + GK  IVG 
Sbjct: 184 MD--------------PDTGKT-------------YLHNHVMLVIRFHSGDNGKNTIVGF 216

Query: 232 EVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVLY---TYSVRYV-RFSHTWATRWD 282
           EV P+S+        S  +   +I++ ED+ NE+ Y   TYSV +   F   W  RWD
Sbjct: 217 EVYPRSVSDYHCPGASKTYEQYEITIPEDE-NELTYLPFTYSVYWREEFEVDWNHRWD 273

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 120/257 (46%), Gaps = 42/257 (16%)

Query: 428 ILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAG------ 481
           IL    +PGL++++   LN+ +    SS A+PF  +   V ++ +I +PLSL G      
Sbjct: 427 ILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIPLSLLGEEVSHR 486

Query: 482 -------------SLTA--IKTCSWDQHPT--KTNQIARQIPFQPWYLKTLPAALVAGIF 524
                        SL A  IK C   + PT     +I+ ++ F            + G  
Sbjct: 487 VHRKQAQNFPILSSLGARSIKPC---RAPTTLAPRKISERLTFD------FATFAICGFL 537

Query: 525 PFASIAVELYFIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXY-----HSLCL 577
           PFA I VEL +IY S+W  +  F+Y++GF +                  Y     H    
Sbjct: 538 PFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKRVA 597

Query: 578 ENWQWQWRSFIVGGLGSAVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTTG 635
               W+W+ F++G    A Y+ ++S++  F   K+ GF +I + V YS++ +I+C    G
Sbjct: 598 TFDSWRWKCFMMGT-SCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCGMG 656

Query: 636 AVGFFSSMFLVRKIFSS 652
           ++G+ +S +LV ++F +
Sbjct: 657 SLGYLTSCWLVNRVFCT 673

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 103/245 (42%), Gaps = 36/245 (14%)

Query: 45  RHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPF 104
           R   H +   N ++SD   +   Y YY+        E+      SL  ++ GDR + S +
Sbjct: 47  RWGDHVELLVNKVESDLTQF--PYGYYDLPFTCPPTEDKKPLHLSLNEIIRGDRKWESDY 104

Query: 105 KLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHI 163
           KL   +D SC +LC             +L++ G++  WL+D  LPA T   +  +   + 
Sbjct: 105 KLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQWLIDQELPAATTFISTIDHKKYY 164

Query: 164 TNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEA 223
            +GFPLG V+                            + E  +LN H  + I+Y+  + 
Sbjct: 165 VSGFPLGFVD---------------------------PDTEKTYLNTHVMMVIRYNAIDP 197

Query: 224 GKYRIVGVEVEPKSIKQTSNSCEFTG-EQISL----SEDQDNEVLYTYSVRYV-RFSHTW 277
             + IVG EV PKS+          G EQ  L    +ED+   + +TYSV +   F   W
Sbjct: 198 ETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDW 257

Query: 278 ATRWD 282
           + RW+
Sbjct: 258 SHRWN 262

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 113/235 (48%), Gaps = 38/235 (16%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHF-CKPENVIEQAE-SLGSVLFGDRLYNSPFKLNMLEDK 112
           N I+SD   + Y+Y     +L F C P NV +    SL  ++ GDR + S + L+  +D+
Sbjct: 72  NKIESDLTQFPYAY----YELPFTCPPTNVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDE 127

Query: 113 SCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGS 171
            C+ LC      +     ++LIK G++  WL+D  LPA T   + ++   +  +GFPLG 
Sbjct: 128 HCLRLCDRKTSPDALRKAHELIKQGYVVQWLIDDELPAATTFISTKDHKKYYASGFPLGF 187

Query: 172 VEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
           ++              ++TG +             +LNNH  + I+YH  +  K+ IVG+
Sbjct: 188 MD--------------KDTGKT-------------YLNNHVMLVIRYHTVDINKFTIVGL 220

Query: 232 EVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVLYTYSVRYV-RFSHTWATRWD 282
           EV PKS+        S  F   +++  E +   + +TYS+ +   F+  W  RW+
Sbjct: 221 EVYPKSVSDYHCPGASKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWN 275

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 124/292 (42%), Gaps = 77/292 (26%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKT---C- 489
           +PG  L  ++ LN  +    S+ A+PF  +  ++ ++ I+ +PLS+ G ++A  T   C 
Sbjct: 420 LPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRKCL 479

Query: 490 ----------------SWDQHPTKTNQI-------ARQIPF---QPWYLKTLPAALVAGI 523
                            +D  P   N++         ++P    QP  L      +++GI
Sbjct: 480 SLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLMLRQPVLL-----TVISGI 534

Query: 524 FPFASIAVELYFIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSL------ 575
            PF  I VEL F+Y SLW  +  F+Y++GF +                  Y +L      
Sbjct: 535 VPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVSPD 594

Query: 576 ----------------------------C---LENWQWQWRSFIVGGLGSAVYIFIHSI- 603
                                       C   L   QW+W+SF +GG   A Y+  +S+ 
Sbjct: 595 EFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQIGG-SVAWYLEAYSLY 653

Query: 604 -FFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVK 654
            F T  K+R F++I+L+  YS L + LC  + GA+G+ S  + V +I ++ K
Sbjct: 654 YFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 117/282 (41%), Gaps = 38/282 (13%)

Query: 7   ALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66
           A+ LLW+V ++  L    P  Y    E       + P+ + +    D    K + E    
Sbjct: 14  AVVLLWSVWQSQSLRARRPREYLPPRE----TGWIKPNVYKRGDKVDLTVNKVESEITNL 69

Query: 67  SYDYYNSKLHFCKPENVIEQAE-SLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGE 125
            Y YY+ +   C P    +    SL  V+ GDR + S + L     + C  LC      +
Sbjct: 70  PYGYYDLRF-VCPPSETKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPD 128

Query: 126 DAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMA 184
                ++LI+  ++ +WL+DG LPA T   + R      T GFPLG V+           
Sbjct: 129 GLRQADRLIRENYMVHWLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD----------- 177

Query: 185 TPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ---T 241
               ET             +  HL+NH  + I+Y   +  +Y IVG EV P+S+      
Sbjct: 178 ---HET-------------DKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCP 221

Query: 242 SNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHT-WATRWD 282
             S  F    I+  E +   + +TYSV +   S+  W+ RW+
Sbjct: 222 GASKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWN 263

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 129/317 (40%), Gaps = 82/317 (25%)

Query: 406 VGSYASMGVYRFFKGPYPKVNM---ILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSA 462
           +G+Y S  V      P PK+N+   +L    +P L L+ +   N  + I  SS A+PF  
Sbjct: 374 LGAYTSSLVGSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGT 432

Query: 463 LFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYL---------- 512
           L A++  + +I +PLS  G  +A K  S   +     Q   ++PF   +L          
Sbjct: 433 LLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQ--SKVPFS--FLLSIEYHEYNL 488

Query: 513 ------KTLPAAL--------VAGIFPFASIAVELYFIYNSLWFHQ--FFYMFGFSMXXX 556
                 K +PA L        V G  PF     EL F+Y SLW  +   + ++GF +   
Sbjct: 489 LPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNF 548

Query: 557 XXXXXXXXXXXXXXXY-----------------------HSLC---------LENW---- 580
                          Y                        S+C         L+N+    
Sbjct: 549 IFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMAST 608

Query: 581 --QWQ-------WRSFIVGGLGSAVYIFIHSIFFTEF--KLRGFTTIVLYVGYSMLISIL 629
             +W+       W++F+ G    A Y  ++S+++  F   LR F++I+L+V Y+ L +++
Sbjct: 609 ARRWKASFSSWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLM 667

Query: 630 CCLTTGAVGFFSSMFLV 646
           C    GA+G+ + ++ +
Sbjct: 668 CWCAFGALGYLTCLWFL 684

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 122/254 (48%), Gaps = 36/254 (14%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQ 493
           +PGL+++   SLN  +L   S++A+PF     +V ++ +  +PLSL G + A+  C  D 
Sbjct: 453 LPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLALN-CKVDS 511

Query: 494 HPT-------KTNQIARQIP---------FQPWYLK------TLPAALVAGIFPFASIAV 531
           + T       + N I+R+           +Q           T   AL  G F F  I V
Sbjct: 512 YNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWV 571

Query: 532 ELYFIYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSLCLENWQ-----WQW 584
           EL ++Y S+W  +  F+Y +GF +                  Y  L  +N +     W W
Sbjct: 572 ELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGW 631

Query: 585 RSFIVGGLGSAVYIFIHSIFFTEF--KLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSS 642
           +SF++G    A Y+ ++S+++  F   ++GF++I + V YS+L + +C    G++ + +S
Sbjct: 632 KSFLMGS-SCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTS 690

Query: 643 MFLVRKIFSSVKVD 656
             LV +I+   KVD
Sbjct: 691 YMLVTQIY---KVD 701

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 98/236 (41%), Gaps = 38/236 (16%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE-SLGSVLFGDRLYNSPFKLNMLEDKS 113
           N ++SD     Y+Y  Y+     C P    +    SL  +  GDR + S +KL+   D  
Sbjct: 67  NKVESDLTQLPYAY--YDLPF-ICPPTKEKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSP 123

Query: 114 CVSLCKSVIPGEDAAFINKLIKNGFLHNWLVD-GLPAGTLINNERESSAHITNGFPLGSV 172
           C  LC      E      +L++ G++  WL+D  LPA T   +    + +   GFP+G V
Sbjct: 124 CEILCARKTKKEGMIKAKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYV 183

Query: 173 EIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVE 232
           +              + TG +              LNNH  + I+YH     ++ IVG E
Sbjct: 184 D--------------DRTGKT-------------FLNNHVMLVIRYHPVSEEEFTIVGFE 216

Query: 233 VEPKSIKQ----TSNSCEFTGEQISLSEDQDNEVL-YTYSVRYV-RFSHTWATRWD 282
           V PKS+       +N      E I   +D +   + +TYSV +   F   W  RW+
Sbjct: 217 VYPKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWN 272

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 136/305 (44%), Gaps = 43/305 (14%)

Query: 384 NNAGSREVLPTIFFVLYALFG-FVGSYASMGVY------------RFFKGPYPKVNMILT 430
           N   S   +  +FFVL A    FVG+  SM               R+ K  Y K + I T
Sbjct: 401 NVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKD-YKKFSPIFT 459

Query: 431 PFL---IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA-- 485
                 +PG+++++   LN  +    S+ A+PF  +   + ++ I+ +PLSL G + A  
Sbjct: 460 ILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANN 519

Query: 486 -------IKTCSWDQHPTKTNQI---ARQIPFQPWYLKTLPAALVAGIFPFASIAVELYF 535
                  +   + D+  +  N +     +  F P          + GIFP   I VE+ +
Sbjct: 520 IPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYVEMQY 576

Query: 536 IYNSLWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXY--HSLCLENW----QWQWRSF 587
           +Y SLW  +  F+Y +GF                    Y     C E+      W+W+ F
Sbjct: 577 VYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCF 636

Query: 588 IVGGLGSAVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFL 645
            +G  G  VY+ ++S++  F    + GF++I++ + YS++ +++C L  GA+ + ++ + 
Sbjct: 637 EMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWF 695

Query: 646 VRKIF 650
           + KI+
Sbjct: 696 INKIY 700

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 117/265 (44%), Gaps = 44/265 (16%)

Query: 30  AKSEIALYVNHLTPS--RHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQA 87
           + S+  LY   +TP+  R     +   N ++SD     Y+Y      L F  P  + ++ 
Sbjct: 41  SSSQKNLYDGWITPNFYRKGDPLELIVNKVESDLTQLPYAY----YDLPFTCPPTMHKKP 96

Query: 88  E--SLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVD 145
              SL  ++ GDR + S +KL   ED  C +LC      E    ++KL++ G++  WL+D
Sbjct: 97  LHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQWLID 156

Query: 146 G-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLE 204
             LPA T   +  +   +  +GFPLG ++                            + +
Sbjct: 157 DELPAATTFISTTDHKKYYASGFPLGFID---------------------------PDTD 189

Query: 205 LPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ---TSNSCEFTGEQISLSEDQDNE 261
             +L+NH  + I++H  +  K  IVG EV P+S+        S  +   +I + ED+ NE
Sbjct: 190 KTYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDE-NE 248

Query: 262 VLY---TYSVRYV-RFSHTWATRWD 282
           + Y   TYSV +   F   W  RWD
Sbjct: 249 LTYLPFTYSVYWREEFEVDWNHRWD 273

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 108/238 (45%), Gaps = 42/238 (17%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFGDRLYNSPFKLNMLEDK 112
           N ++SD     Y+Y      L F  P  + ++    SL  ++ GDR + S + L   ED 
Sbjct: 68  NKVESDLTQLPYAY----YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDN 123

Query: 113 SCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGS 171
           +C +LC      E    ++KL++ G++  WL+D  LPA T   +  +   +  +GFPLG 
Sbjct: 124 ACQTLCARKTTKEGMQSLDKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGF 183

Query: 172 VEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
           V+               +TG +             +L+NH  + I++H  +  +  IVG 
Sbjct: 184 VD--------------PDTGKT-------------YLHNHVMLVIRFHSGDNDQNTIVGF 216

Query: 232 EVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVLY---TYSVRYV-RFSHTWATRWD 282
           EV P+S+        S  +   +I + ED+ NE+ Y   TYSV +   F   W  RWD
Sbjct: 217 EVYPRSVSDYHCPGASKNYEQYEIVVPEDE-NELTYLPFTYSVYWREEFEVDWNHRWD 273

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 116/241 (48%), Gaps = 26/241 (10%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA-------- 485
           +PGL++++   LN  +    S++A+PF  +   + ++ I+ +PLSL G   A        
Sbjct: 466 LPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRH 525

Query: 486 -IKTCSWDQHPTKTNQI---ARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLW 541
            +   + D+    ++++     +  F P          + G+FPF  I VEL ++Y S+W
Sbjct: 526 WLSGITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVW 582

Query: 542 FHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXYHSL--CLENWQ----WQWRSFIVGGLG 593
             +  F+Y +GF +                  Y  +  C E+      W+W+ F +G  G
Sbjct: 583 LEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG 642

Query: 594 SAVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFS 651
             VY+ ++S++  F    + GF++ ++ + YS+L +I+C L  G + + ++ + + KI+ 
Sbjct: 643 -GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYH 701

Query: 652 S 652
           S
Sbjct: 702 S 702

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 101/242 (41%), Gaps = 39/242 (16%)

Query: 52  KDGNNI-----KSDKEHYLYSYDYYNSKLHFCKPENVIEQAE-SLGSVLFGDRLYNSPFK 105
           K G+ +     K   E   + Y YY+ +   C P +  +    SL  ++ GDR + S + 
Sbjct: 46  KKGDKVDVIINKVVSETARFPYGYYDLQF-VCPPSDKKKPLHLSLNEIIRGDRKWESDYN 104

Query: 106 LNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLV-DGLPAGTLINNERESSAHIT 164
           L   E   C+ LC      E     + LI+ G++ +WL+ D LPA T     +      T
Sbjct: 105 LAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYT 164

Query: 165 NGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAG 224
            GFPLG V+ + G                              L NH  + ++Y   +  
Sbjct: 165 AGFPLGEVDAVTGK---------------------------TRLYNHLMLVVRYQTVDVN 197

Query: 225 KYRIVGVEVEPKSIKQT---SNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHT-WATR 280
           K+ I+G EV PKS+        + ++   +I+  E +   + +TYS+ +   S+  W+ R
Sbjct: 198 KHTIIGFEVYPKSVSDAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHR 257

Query: 281 WD 282
           W+
Sbjct: 258 WN 259

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 75/156 (48%), Gaps = 29/156 (18%)

Query: 423 PKVNM---ILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSL 479
           P+V++   +++   +PGL+L T++ LN  + +  SS AIPF  +   V  + +IS PLSL
Sbjct: 386 PRVSLGTSVISGSALPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSL 445

Query: 480 AGSLTAIK----------------------TCSWDQHPTKTNQIARQIPFQPWYLKTLPA 517
            G  +A K                      T S+D        + +  PF       +  
Sbjct: 446 LGGFSARKMKNAAKLAPANAISKSPFSFLLTLSYDTRSWPATALGK--PFPIALSNPILL 503

Query: 518 ALVAGIFPFASIAVELYFIYNSLWFH--QFFYMFGF 551
            ++AGI PF  I VEL+++Y S+W     F+Y++GF
Sbjct: 504 TILAGIAPFVVICVELFYVYKSMWLQTTNFYYLYGF 539

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 581 QWQWRSFIVGG-LGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGF 639
            W+W+SF+ GG +   + ++          LR  ++I+L+V Y+ L + +C    GA+G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 640 FSSMFLVRKIFSSVK 654
            S ++ +  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 103/252 (40%), Gaps = 39/252 (15%)

Query: 39  NHLTPSRHFQHKDKD--GNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE-SLGSVLF 95
           N LTP+ + +  D +   N I+SD       Y YY+     C P N  +    SL  +L 
Sbjct: 35  NRLTPNIYRKGDDVELIVNKIESDLTKL--PYGYYDLPF-ICPPTNQRKPLHMSLTEILR 91

Query: 96  GDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLIN 154
           GDR + S + L   +D  C  LC      E       L+K  ++  W +D  LPA T   
Sbjct: 92  GDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAINLVKKDYIVQWSIDNDLPASTTFI 151

Query: 155 NERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDI 214
           +  E+  +   GF LG V+            P  ET                +LNNH  +
Sbjct: 152 STSENRKYYIPGFSLGFVD------------PDTETA---------------YLNNHVML 184

Query: 215 TIQYHEPEAGKYRIVGVEVEPKSIKQT-SNSCEFTGEQISLSEDQDNEVLY---TYSVRY 270
            I+YH  +   + IVG+EV PKS+            EQ  L  + D EV Y   TYSV +
Sbjct: 185 VIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEVTYIPFTYSVYW 244

Query: 271 V-RFSHTWATRW 281
              F   W  R+
Sbjct: 245 REEFDVEWKDRY 256

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 113/240 (47%), Gaps = 26/240 (10%)

Query: 433 LIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAG----------- 481
           L+P +I++  I LN  +    SS A+P   +  ++ ++ I+ +PLSL G           
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 482 SLTAIKTCSWDQHPTKTNQIARQIP--FQPWYLKTLPAALVAGIFPFASIAVELYFIYNS 539
           +L A  + +  +     + +AR I   F   +   L  A + G+FPF  I VEL  +Y  
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLL--ASIGGLFPFFIIYVELQHVYKF 538

Query: 540 LWFHQ--FFYMFGFSMXXXXXXXXXXXXXXXXXXY---HS--LCLENWQWQWRSFIVGGL 592
           +W  +  F+Y+  F                    Y   HS    LEN  W+WRSF +   
Sbjct: 539 VWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS- 596

Query: 593 GSAVYIFIHSIFFTEFKLR--GFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIF 650
             A Y+ ++S+++  + L   GF++I+L V  S L + LC    G++G+ ++ + V +++
Sbjct: 597 SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 104/237 (43%), Gaps = 40/237 (16%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAE--SLGSVLFGDRLYNSPFKLNMLEDK 112
           N ++SD     Y+Y      L F  P  + ++    SL  ++ GDR + S +KL   ED 
Sbjct: 69  NKVESDLTQLPYAY----YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDN 124

Query: 113 SCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGS 171
           +C +LC      +    ++KL++ G++  WL+D  LPA T   +  +   +  +GFPLG 
Sbjct: 125 ACETLCARKTDKKGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGF 184

Query: 172 VEIMQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGV 231
           V+                            + +  +L+NH  + I++H     K  +VG 
Sbjct: 185 VD---------------------------PDTDKTYLHNHVILVIRFHGGGDDKNTVVGF 217

Query: 232 EVEPKSIKQ---TSNSCEFTGEQISLSEDQDNEVL--YTYSVRYV-RFSHTWATRWD 282
           EV PKS+        S  +   +I + ED+ +     +TYSV +   F   W  RW+
Sbjct: 218 EVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWN 274

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 109/239 (45%), Gaps = 26/239 (10%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA-------- 485
           +PG++++    LN  +    S++A+PF  +   + ++ ++ +PLSL G + A        
Sbjct: 467 LPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKY 526

Query: 486 ----IKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLW 541
               I     D + +K  +   +  F P          + GIFP   I VE+ ++Y SLW
Sbjct: 527 WLSGITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLW 583

Query: 542 FHQFFYMFGFSMXXXXXXXXXXXXXXXXXXYHSL----CLENWQ----WQWRSFIVGGLG 593
             +  + F +                       L    C ++ +    W+WR F +G  G
Sbjct: 584 LEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG 643

Query: 594 SAVYIFIHSIF--FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIF 650
             VY+ ++S++  F    + GF++I++ + YS+L +ILC L  GA+   ++ + + +I+
Sbjct: 644 -GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 34/233 (14%)

Query: 67  SYDYYNSKLHFCKPENVIEQAE-SLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGE 125
           SY YY+ +   C P         SL  V  GDR + S +KL    +  C +LC       
Sbjct: 66  SYGYYDLQFT-CTPTKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPS 124

Query: 126 DAAFINKLIKNGFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMA 184
                + LI+  +    L+D  +PA     + R++  +   GFPLG V+           
Sbjct: 125 GLIEADSLIRQNYTVQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------- 173

Query: 185 TPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQT--- 241
               ET ++             +L+NH+ + I+Y+  +  KY IVG EV PKS+      
Sbjct: 174 ---PETDVT-------------YLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCP 217

Query: 242 SNSCEFTGEQISLSEDQDNEVLYTYSVRYV-RFSHTWATRWDNYRFSYDTTVQ 293
            +S ++    ++ SE     +  TYSV +   F   W  RW+ Y  + D  V 
Sbjct: 218 GSSKDYENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN 270

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 107/269 (39%), Gaps = 57/269 (21%)

Query: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQ 493
           +P L +  ++  N    I      +PF  +  ++ L+ ++S+PLSL G  +A      DQ
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 494 H----------------PTK-------------TNQIA-RQIPFQPWYLKTLPAALVAGI 523
           H                P+K             T   A  QIP   W  K      + GI
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 524 FPFASIAVELYFIYNSLWFH-----QFFYMFGFSMXXXXXXXXXXXXXXXXXXYH----- 573
            PF +I +++ FI+  LW H     Q +      M                   H     
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 574 SLCLENW-----------QWQWRSFIVGGLGSAVYIFIHSIFFTEF--KLRGFTTIVLYV 620
             C ++             W+W++F +GG  +A Y   +S+++  F  +LR F +I+LY+
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGG-AAAWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 621 GYSMLISILCCLTTGAVGFFSSMFLVRKI 649
            Y  L+++    + G++G+ +  + + K+
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 100/237 (42%), Gaps = 42/237 (17%)

Query: 55  NNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSC 114
           +NI +D+E     + YY +      P        SLG V   +  + S + L++  +  C
Sbjct: 53  DNIWTDRE----VWGYYETLFTCPPPAEARAIYGSLGQVFRREMPWESNYVLHVRAETQC 108

Query: 115 VSLCKSVIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI 174
             LC   +  +    + ++I++G    W +DGLPA T    +R+SS     GF LG V+ 
Sbjct: 109 QPLCMRELRPDSHRRLIQMIRDGAQVRWTLDGLPAAT-TYPDRQSSYRYEAGFKLGEVD- 166

Query: 175 MQGVHNGAMATPREETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVE 234
                         ETG   H            L+NH  + ++Y   + G+Y IVG E  
Sbjct: 167 -------------AETG---H----------VRLHNHVMLVVRYRILDDGRYVIVGFEAY 200

Query: 235 PKSIKQ---TSNSCEFTGEQISLSEDQDNEVL--YTYSVRYVRFSHT--WATRWDNY 284
           P+S+     T    E+  E   L+ D    ++  +TY+V Y R+     W  RW  Y
Sbjct: 201 PRSVAGEGCTGGQTEY--EHFWLNPDAQAMIMVPFTYAV-YWRYQSAVKWNERWRLY 254

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 87/216 (40%), Gaps = 35/216 (16%)

Query: 78  CKPENVIEQA-ESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKN 136
           C P +       SL  +  GD L  S + L   +D+ C  LC      +       LIKN
Sbjct: 99  CPPSDTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKN 158

Query: 137 GFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAH 195
            ++  W VD  LP GT   + + +      GF LG  +               +TG +  
Sbjct: 159 DYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD--------------NQTGQA-- 202

Query: 196 GSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ---TSNSCEFTGEQI 252
                      +LN H    ++YH   +  + IVG+EV P+SI        S +F   ++
Sbjct: 203 -----------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLEV 251

Query: 253 SLSEDQDNEVL--YTYSVRYV-RFSHTWATRWDNYR 285
            + E+ D+     ++YSV +   F   W  RWD ++
Sbjct: 252 KVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFK 287

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 41/81 (50%)

Query: 418 FKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPL 477
           F   Y   N IL    +P  ILL++  +N  + ++  + A PF         + I+S+PL
Sbjct: 419 FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPL 478

Query: 478 SLAGSLTAIKTCSWDQHPTKT 498
           S+   + + +  S+ ++P+++
Sbjct: 479 SIISGVLSTRFISFPKYPSRS 499

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 101/267 (37%), Gaps = 47/267 (17%)

Query: 23  ISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPEN 82
           + P  Y     + + VN +      Q KD  G++ +        SY Y++   + C P N
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYHDLP-YICPPTN 93

Query: 83  VIEQA-ESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHN 141
             +    SL  +  GD    S + L    D  C +LC             ++I   ++ N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 142 WLVDG-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNVV 200
           W +D  LPA T   +          GF LG  +   G +                     
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGWKDPETGSY--------------------- 192

Query: 201 VNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTSNSCEFTGE-QISLSEDQD 259
                 ++NNH  + I+Y+  +  K+ IVG EV PKSI          G     L + ++
Sbjct: 193 ------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKDLEN 246

Query: 260 NE----VLYTYSVRYV-RFSHTWATRW 281
           N+    + ++YSV +   F + W TRW
Sbjct: 247 NDEFSLIPFSYSVYWREEFEYDWRTRW 273

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 404 GFVGSYASMGVYRFFKGPY--PKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFS 461
            FVG++  M +++    P   PK++++    L PGL L  +   N        + + PF 
Sbjct: 409 SFVGTWLRMYMFQKKMTPNYDPKMSIVCGSIL-PGLTLAGVTVFNTVTWFLEGNSSYPFR 467

Query: 462 ALFAVVLLWLIISVPLSLAGSLTAIK 487
            L  ++ ++ I S+P+SL G   A+K
Sbjct: 468 KLSWLIFVYFIFSIPMSLIGGSLAVK 493

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 81/213 (38%), Gaps = 35/213 (16%)

Query: 78  CKPENVIEQAE-SLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKN 136
           C P +V +       S+  GD L  S +KL   +D  C  LC         +    +IK 
Sbjct: 85  CPPTSVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQ 144

Query: 137 GFLHNWLVDG-LPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAH 195
            +   W +D  LP      +          GFPLG  +             +++  +   
Sbjct: 145 DYQILWSIDDELPISMPYISTITQRKKYIPGFPLGRFD-------------KDKNKV--- 188

Query: 196 GSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ---TSNSCEFTGEQI 252
                      +L NH  + I+Y+  +  K+ IVG EV  +S+        S  +   ++
Sbjct: 189 -----------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYEL 237

Query: 253 SLSEDQDNEVL--YTYSVRYV-RFSHTWATRWD 282
            + E+ D+     +TYSV +   F   W +RW+
Sbjct: 238 VIPENDDDLTFIPFTYSVYWREEFDIDWTSRWN 270

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 115/284 (40%), Gaps = 41/284 (14%)

Query: 404 GFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSAL 463
            F+G++  M +       Y     IL   L+P L+++ +  ++  + +  SS   PF  L
Sbjct: 402 SFLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTL 461

Query: 464 FAVVLLWLIISVPLSLAGSLTAIK----------TCSWDQHPTKTNQIAR-QIPFQPW-- 510
             ++  + II VP S+ G   A K            + D      ++  R +   +P   
Sbjct: 462 TMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSI 521

Query: 511 ---YLKTLPAALVAGIFPFASIAVELYFIYNSLWFH--QFFYMFGFSMXXXXXXXXXXXX 565
               L TL  +L+  I PF  I  ELY+I+ + W +   F   F F +            
Sbjct: 522 NKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSS 581

Query: 566 XXXXXXYHSLCLENW---QWQ-------WRSFI-------VGGLGSAVYIFIHSIFFTEF 608
                 + ++ +      QW+       W  F+       + GL S  YI          
Sbjct: 582 TSLVGLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSLYYII------EVI 635

Query: 609 KLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSS 652
           ++ GF+  VL + Y++ ++++  ++ GA+ + +  +L+ K++ +
Sbjct: 636 RIHGFSMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLYKN 679

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 313 HMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNK 354
             L   +K+++ ++  +  D  F   +GWKLS+ D    PN+
Sbjct: 37  QTLKDQIKTEYRQFRNMTYDSNFQNITGWKLSYQDALDDPNR 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,821,317
Number of extensions: 2715063
Number of successful extensions: 9309
Number of sequences better than 10.0: 52
Number of HSP's gapped: 9280
Number of HSP's successfully gapped: 83
Length of query: 656
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 540
Effective length of database: 40,180,143
Effective search space: 21697277220
Effective search space used: 21697277220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)