Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E050805.122ON56356329230.0
ZYRO0F01606g5.122ON56356225580.0
NCAS0D016605.122ON56456225390.0
KLLA0E16303g5.122ON56356325250.0
CAGL0M07920g5.122ON56456225230.0
SAKL0G14894g5.122ON56456225210.0
Smik_12.1065.122ON56356225060.0
YLR044C (PDC1)5.122ON56356225060.0
SAKL0G10164gna 1ON56456225030.0
NDAI0C031105.122ON56456225000.0
Skud_12.1105.122ON56356224930.0
Suva_10.1285.122ON56356224890.0
KAFR0E020205.122ON56456224770.0
KLTH0B01188g5.122ON59356324660.0
NDAI0A01400na 2ON56356224540.0
ACL134C5.122ON58656224420.0
Kwal_33.155405.122ON56456324390.0
NCAS0A14630na 2ON56356324290.0
Kpol_1010.485.122ON56356224280.0
Suva_10.227na 3ON56356224210.0
SAKL0F04334gsingletonON56456223960.0
TPHA0H009505.122ON56356223890.0
Ecym_24795.122ON56456223860.0
Skud_12.203na 3ON56356223850.0
YLR134W (PDC5)na 3ON56356223800.0
TPHA0Q00120singletonON56356223790.0
TBLA0B075205.122ON56356223790.0
Smik_12.197na 3ON56356223700.0
AAL073Wna 1ON56356223460.0
Suva_7.369na 4ON56356223430.0
YGR087C (PDC6)na 4ON56356223280.0
KAFR0E01520singletonON56356223250.0
TBLA0B10060singletonON56456223090.0
NDAI0A02510singletonON56356322950.0
KNAG0M012505.122ON56356222940.0
TBLA0D02840singletonON56356222860.0
NCAS0A14240singletonON56556522830.0
TBLA0E03070singletonON56356122770.0
KNAG0J01330singletonON56456222500.0
KNAG0J01340singletonON56556422420.0
KLTH0D08272gsingletonON56356321920.0
NDAI0D03270singletonON52152121640.0
CAGL0G02937gna 4ON56456420930.0
Ecym_3185na 1ON56356220350.0
SAKL0E04972g2.390ON61154818730.0
YDL080C (THI3)2.390ON60955416200.0
KLTH0E09702g2.390ON60754916200.0
Suva_4.1672.390ON62055416170.0
Kwal_47.178782.390ON61054916050.0
ZYRO0A08426g2.390ON58454615710.0
Skud_4.1752.390ON62055415700.0
Smik_4.1562.390ON62155415620.0
TDEL0G032102.390ON60655415530.0
KNAG0A059002.390ON62055715350.0
TPHA0G026202.390ON68859315410.0
NCAS0A040002.390ON62556815350.0
CAGL0L06842g2.390ON63858115240.0
NDAI0E017002.390ON62156415050.0
KAFR0F029902.390ON60855714780.0
TBLA0B088202.390ON63558014490.0
Ecym_60552.390ON59256113480.0
ADR254W2.390ON58155312981e-173
Kpol_1046.92.390ON59855911191e-146
KLLA0F16962g2.390ON5785558611e-108
SAKL0G03036g5.456ON6376048411e-104
CAGL0A03102g5.456ON6496028351e-103
KLTH0F15510g5.456ON6256028311e-103
Suva_2.5545.456ON6356078211e-101
Kpol_1062.125.456ON6305948191e-101
YDR380W (ARO10)5.456ON6356078161e-100
Skud_4.6515.456ON6356148111e-100
ZYRO0G04378g5.456ON6136118082e-99
NCAS0A118305.456ON6376118058e-99
Smik_4.6495.456ON6356138041e-98
TPHA0J026805.456ON6486267945e-97
ACR211W5.456ON6295997917e-97
KAFR0E037305.456ON6356077734e-94
KNAG0C047905.456ON6375977472e-90
TBLA0A026705.456ON6406207395e-89
Kpol_440.45.456ON6366057352e-88
TBLA0A064205.456ON6386107309e-88
TPHA0E016005.456ON6516027266e-87
KLLA0E02707g5.456ON6316027114e-85
TDEL0D024505.456ON6756097059e-84
SAKL0D00220gsingletonON5775766892e-82
KLTH0D00418gsingletonON5615656072e-70
TDEL0C07020singletonON5605666011e-69
TDEL0F00150singletonON5605665992e-69
NDAI0A044505.456ON5615545957e-69
Kwal_26.75822.441ON6795292001e-15
Skud_7.383na 4ON86921755e-15
TBLA0I014002.441ON7103091931e-14
YMR108W (ILV2)2.441ON6873111931e-14
NDAI0H023802.441ON6853001877e-14
KLTH0D04532g2.441ON6785221813e-13
NCAS0A043202.441ON6893091813e-13
Kpol_297.122.441ON6713101813e-13
Smik_13.2972.441ON6873101804e-13
KAFR0A005702.441ON6823091805e-13
KNAG0E023602.441ON6933071752e-12
CAGL0K03465g2.441ON6773101742e-12
ZYRO0E03454g1.450ON5494971732e-12
NCAS0F015002.441ON6843071733e-12
TPHA0G024402.441ON6913071715e-12
Suva_13.2872.441ON6873041698e-12
KNAG0A062502.441ON6803101699e-12
NCAS0G039601.450ON5775221689e-12
SAKL0E03740g2.441ON6793111691e-11
Ecym_61072.441ON6895121691e-11
Skud_13.2672.441ON6873031653e-11
TDEL0A021602.441ON6823051635e-11
ZYRO0G19954g2.441ON7003121636e-11
NDAI0E020502.441ON6903131636e-11
AEL305C2.441ON6685331626e-11
TPHA0G028852.441ON6883071573e-10
KLLA0B12584g2.441ON6913041564e-10
TDEL0B055201.450ON5552891449e-09
Ecym_13601.450ON5444881322e-07
Skud_5.761.450ON5605281313e-07
Smik_5.871.450ON5605141295e-07
YEL020C1.450ON5605451251e-06
TPHA0B039401.450ON5755241214e-06
Kwal_34.161161.450ON553286940.007
SAKL0D10934g1.450ON550335920.013
KNAG0H015801.450ON560509920.015
Suva_5.681.450ON561299880.048
KLTH0H14102g1.450ON551501840.12
NDAI0G005201.450ON575295770.93
TBLA0C015601.450ON58262742.4
TPHA0N003107.33ON67350715.2
NCAS0B07970na 5ON20589695.9
TPHA0J011403.419ON85572706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E05080
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...  1130   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   989   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   982   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   977   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   976   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   975   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   969   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   969   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   968   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    967   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   964   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   963   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   958   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   954   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              949   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   945   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   944   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   940   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   939   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   937   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   927   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   924   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   923   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   923   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   921   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      920   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   920   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   917   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   908   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   907   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   901   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   900   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   894   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   888   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   888   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   885   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            884   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              881   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   871   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   868   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   848   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              838   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   810   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   788   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   726   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   628   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   628   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   627   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   622   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   609   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   609   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   606   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   602   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   595   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   598   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   595   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   591   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    584   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   573   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   562   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   523   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   504   e-173
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   435   e-146
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   336   e-108
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   328   e-104
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   326   e-103
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   324   e-103
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   320   e-101
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   320   e-101
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   318   e-100
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   317   e-100
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   315   2e-99
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   314   8e-99
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   314   1e-98
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   310   5e-97
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   309   7e-97
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   302   4e-94
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   292   2e-90
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   289   5e-89
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   287   2e-88
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   285   9e-88
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   284   6e-87
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   278   4e-85
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   276   9e-84
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   270   2e-82
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   238   2e-70
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   236   1e-69
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                235   2e-69
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   233   7e-69
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    82   1e-15
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    72   5e-15
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    79   1e-14
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    79   1e-14
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     77   7e-14
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    74   3e-13
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    74   3e-13
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    74   3e-13
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    74   4e-13
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    74   5e-13
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    72   2e-12
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    72   2e-12
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    71   2e-12
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    71   3e-12
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    70   5e-12
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    70   8e-12
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    70   9e-12
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    69   9e-12
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    70   1e-11
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    70   1e-11
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    68   3e-11
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    67   5e-11
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    67   6e-11
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    67   6e-11
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    67   6e-11
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     65   3e-10
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    65   4e-10
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    60   9e-09
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    55   2e-07
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    55   3e-07
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    54   5e-07
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    53   1e-06
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    51   4e-06
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    41   0.007
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    40   0.013
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    40   0.015
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    39   0.048
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    37   0.12 
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    34   0.93 
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    33   2.4  
TPHA0N00310 Chr14 complement(54950..56971) [2022 bp, 673 aa] {ON...    32   5.2  
NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {...    31   5.9  
TPHA0J01140 Chr10 complement(263525..266092) [2568 bp, 855 aa] {...    32   6.3  

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/563 (97%), Positives = 549/563 (97%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
           PVMDAPSSLVAQAQLTASINAKN
Sbjct: 541 PVMDAPSSLVAQAQLTASINAKN 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/562 (85%), Positives = 510/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQVDTNTIFG+PGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKG+AAL+TTFGVGELSALNGIAGSYAEHVGVLHIVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIR  YV+QRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK ND EAE EVVD VL LIK AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF L+KLL  V +  K+YKP  VPA    NA  A
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DST LKQ+W+W QVG FL+EGDVVITETGTSAFGINQ+HFPN+TYGISQVLWGSI     
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE A+YN IQPWK+L+LL TFGAKDYE HRVST GEWNKLT D +FN+NS+IRMIEVML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
            VMDAPSSLVAQAQLTA+ NAK
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAK 562

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/562 (84%), Positives = 517/562 (91%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q+D  TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLKANDAEAE EV++ +L L+K+AKNP+ILADAC SRHDVK ETRKLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL  +   AK YKPV VPA+   N ATA
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVGKFLQEGDVVI+ETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGEKA YNDIQ W++L+LLPTFGAKDYE HRVSTTGEW+KLT++ EFN+N++IRMIE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LVAQA+LTASINAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/563 (84%), Positives = 512/563 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV+  TIFGLPGDFNLSLLD IYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAMITDIN+APAEIDRCIRTTYVSQRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLK ND EAE+EV+++VL LIK AKNPVILADACCSRHD K ET+KLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDY KIR+ATFPGVQMKFALQKLL KV D AK YKPV VP+    N A A
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DSTPLKQ+W+W QVG+FL+EGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN IQ W++L+LLPTFGAKDYE  RVSTTGEWNKLTTD +F  N++IR+IEVML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
           P MDAPS+LV QAQLTA+ NAKN
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAKN 563

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/562 (85%), Positives = 508/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTY++QRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK ND EAE EVVD VL LIKAAKNPVILADAC SRHDVK ET+KLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL  V +  K YKPV VPAR PEN +  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQV KFLQEGDVVITETGTSAFGINQ+ FPN  YGISQVLWGSI     
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGEKA YNDIQ W +L LLPTFGAKDYE HRV+TTGEW+KLT D EFNKNSKIRMIEVML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAP+SL+ QA+LTASINAK
Sbjct: 541 PVMDAPTSLIEQAKLTASINAK 562

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/562 (85%), Positives = 514/562 (91%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA +TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLK ND EAE EVV+ VL LIK AKNPVILADAC SRH+VK ET++LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQ+PRFGGVYVGTLS+ +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL++VG+V KDYKPV VPA+   N A  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVG+FLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN+IQPWKNLDLLPTFGAKDYET+RV+TTGEW+KL  D  FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QAQLTASINAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/562 (83%), Positives = 510/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPID+SLKANDAE+E+EV+D +L+L+K AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + D AK YKPV VPA TP NAA  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN NSKIRMIEVML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/562 (83%), Positives = 509/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L TPID+SLK NDAE+E+EV+D +LAL+K AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + D AK YKPV VPARTP NAA  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/562 (84%), Positives = 511/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG YLFERL QVD  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA +TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLK ND EAE EVV+ VL LIK AKNP+ILADAC SRHDVK ET++LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQ+PRFGGVYVGTLS+ +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL+++G V KDYKPV VP +   N A  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVG+FLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTM+RWGL+PYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN+IQPWKNLDLLPTFGAKDYET+RV+TTGEW+KL  D  FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QAQLTASINAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/562 (84%), Positives = 510/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLKAND EAE EVV+ +L LIK AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL  V + AK YKPV VPA+   NAA  
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQVGKFLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W +L LLPTFGAKDYE HRV+TTGEW KLT + EFN+NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LVAQAQLTA INAK
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAK 562

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/562 (83%), Positives = 508/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPID+SLK NDAE+E+EV+D ++AL+K AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  + D AK YKPV VPA TP NAA A
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/562 (83%), Positives = 509/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPID+SLK NDAE+E+EV+D +LAL+K AKNP+ILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PR+GGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  V D AK YKPV VPA TP NAA  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G+FLQEGDVVI ETGTSAFGINQ  FPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN+NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/562 (83%), Positives = 503/562 (89%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QVD  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDAEAE+EVVD +L+LIK AKNPVIL+DAC SRHDVK ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLLA V D AK YKPV VPAR PEN A  
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPL Q+W+WNQ  KF QEGDV+ITETGTSAFGINQS FPN + GISQVLWGSI     
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGEKA YNDIQ WK+L LL TFGAKDYE HRV+TTGEW+ L  D EFNKNS+IRMIEVML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QA++TA+ NAK
Sbjct: 541 PVMDAPSNLVQQAKITAATNAK 562

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/563 (80%), Positives = 495/563 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRY+FERLKQVD  T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLHIVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITD+ +AP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDL+LK ND +AE+EV+  +L +IK AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LL KVG V KDYKPV VP     NAA  
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQQW+WNQVG+FLQEGD+V+TETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  KRVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIE+LI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN+IQ W +LDLLPTFGAKDYE  RVSTTGEWNKL  D +FNKNSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
           PVMDAP SLV QAQLTA+ NAK+
Sbjct: 570 PVMDAPESLVKQAQLTAATNAKS 592

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/562 (84%), Positives = 507/562 (90%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+ NTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EV+++VL+LIK AKNPVILADACCSRHDVK ETRKLIDITQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQNPRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  V    K YKPV VPA  P N   A
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DSTPLKQ+W+WNQVGKFLQEGD+VITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPK+RVILFIGDGSLQLTVQEISTMVRW LKPYLF+LNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W++L LL TFGAKDYE HRV+TTGEWNKL  + EFN NS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAP SL+ Q +LTA INA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 504/562 (89%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+Q++  TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS TTAMI+DI SAPAEIDRCIRT Y++QRPVYLGLPAN+VDLKVPASL
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDL+LK ND EAE EVV+ VL +I AAKNPVIL+DAC SRHDVK ET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI EQ+PRFGGVYVGTLSSPEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSD+IKIRNATFPGVQMK+ L+KL+  V +V K Y PV VP++   N    
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQVGKFL+EGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYNDIQPW++L+LLPTFGAKDYE  RVSTTGEW+ LT D  FN+NSKIRMIEVML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QA+LTA+ NAK
Sbjct: 563 PVMDAPSNLVKQAELTAATNAK 584

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/563 (84%), Positives = 506/563 (89%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QV+ NTIFGLPGDFNL LLD+IYE  GMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMI+D+ +APAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDA AEQEVV  VL LIK AKNPVILADAC SRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL +VGDV KDYKPV +P     NAA  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DSTPLKQQW+WNQVGKFLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN+IQPW +LDLLPTFGAKDYET RV+TTGEWNKL  D EFNKNSKIRMIEVML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
           PVMDAP SLV QAQLTA+ NAK+
Sbjct: 541 PVMDAPESLVKQAQLTAATNAKS 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/563 (81%), Positives = 504/563 (89%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV+ NTIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TD+ +A +EIDRCIRTTYV+QR VYLGLPAN+ DLKV ASL
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLK NDA AE EVV+ +L+L+K AKNP+ILADACCSRHDVK ET+KLIDITQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQNPR+GGVYVGTLS+P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSD+IKI++ATFPGVQMKF LQKLL  +  VAK YKPV VP R   N  + 
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WN++ KF QEGDV+ITETGTSAFGINQ+ FP   YGISQVLWGSI     
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTMVRW LKPYLFVLNN GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGEKA YNDIQPW +L+LL TFGAKDYE HRVSTTGEW KLTT+ +FN+NS+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
            VMDAPS+LVAQAQLTASINAKN
Sbjct: 541 EVMDAPSNLVAQAQLTASINAKN 563

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/562 (81%), Positives = 499/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV   TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAMITDI +APAEIDRCIRTTY++QR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L TPIDLSLK ND EAE EV+D +LA++K AKNP+ILADAC SRHDVK ET++LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQ+PRFGGVYVGTLS PEVK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKN+VEFHSD+ KI+ A+FPGVQMKF LQKL+A++G   KDYKPV  PA    NA   
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVGKFLQEGD+V+TETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ WK+LD+LPTFGAKDYE  RV+TTGE+NKL  D  FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LVAQA+LTASINAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/562 (80%), Positives = 500/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QVD NT+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTT+ +QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPID++LK NDAEAE EVV  V+ +I+ AKNPVILADAC SRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKNIVEFHSD+IKIRNATFPGVQMKFALQ+LL+ + +V KDYKPV VPARTP N A  
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STP+KQ+W+WNQ+  FLQEGD+VI ETGTSAFGINQ+ FP   Y I QVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN++QPW +L LLPTFGAKDYETHRV TTGEW+KLT D EF  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QAQLTA+ NAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/562 (80%), Positives = 494/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV   TIFGLPGDFNLSLLDKIYEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGM+ +VTTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+ ISETTA+ITDI  AP EIDRCI+ TY  QRPVYLGLPANLVDLKV ASL
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLS+  NDA+AE EVV+ VLA++  AKNPVILADACC+RHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE +PRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDY K+RNATFPGVQMK  LQKLL+KV D A  YKPV VP  T  N    
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+WIWN +  +L+EGDVVITETGTSAFGINQS FPN TYGISQVLWGSI     
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  +RVILF+GDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYND+QPW +L+LLPTFGAKDY++ R+STTGE+ KLT D  F++NSKIR+IEVML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QAQLTA+ NAK
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAK 562

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/562 (79%), Positives = 498/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERLKQV   TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+MITDI SA AEIDRCI+ TY+SQR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK ND +AE EV+  +L LIK AKNP+ILADAC SRHDVK ET+ LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+A+VG V K YKPV +PA  P N AT 
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPLKQ+W+WNQVGKFL+EGD+V+TETGTSAFGINQ+HFP  TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ WK+LD+LPTFGAKDYET RV+TTGEW+KL +D  FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+L+AQA+LTA+ NAK
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAK 562

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/562 (80%), Positives = 500/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEIT+G YLF+RLKQV+  TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISE+TAMITD+ +A  EIDRCIRT Y+SQRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPID SLK NDAEAE EVV  VL +I  +KNPVIL+DAC SRHDVK+ET++LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+ K+RNATFPGVQMKF L+KL+  VGDVAK+Y PV VP +    +   
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TPL+Q+WIW +V +FL+EGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYNDIQPW +L LLPTFGAKDYE  RVST GEW +LT D  F++NSKIRMIEVML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QAQLTA+ NAK
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAK 562

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/562 (79%), Positives = 496/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+ NT+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI SAP+EIDRCIRTT+ +QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPID+SLK NDAEAE EVV  V+ +IK AKNPVILADAC SRHDVK ET+KLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQ+PR+GGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQKLL  + +V KDYKPV VPAR P N AT 
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +T +KQ+W+WNQ+G FLQEGD+VI ETGTSAFGINQ+ FP   Y I QVLWGSI     
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTM+RWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN++Q W +L LLPTFGA+DYETHR++TTGEW+KLT D +F  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QAQLTA+ NAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/562 (79%), Positives = 496/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+ NT+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTY +QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EVV  V+ LIK AKNPVILADAC SRHDVK ET+KL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQ+PR+GGVYVGTLS PEVK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFALQKLL  + +V KDYKPV VPAR P   +T 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WN +G FL+EGD+VI ETGTSAFGINQ+ FP   Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTM+RWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN+IQ W +L LLPTFGA++YETHRV+TTGEW KLT D +F  NSKIRMIEVML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QAQLTA+ NAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/562 (79%), Positives = 497/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERLKQV  NTIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+MITDI SA AEIDRCI+ TY+SQR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK ND +AE EV+  +L LIK AKNP+ILADAC SRHDVK ET+ LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+A+VG V K YKPV +PA  P N AT 
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPLKQ+W+WNQVGKFL+EGD+V+TETGTSAFGINQ+HFP  TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN+IQ WK+LD+L TFGAKDYE HRV+TTGEW+KL +D  FN+NSKIR+IE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+L+AQA+LT + NAK
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAK 562

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/562 (79%), Positives = 494/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV   TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAMITDI +APAEIDRCIRTTYV QR VYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EV++ VL L++ AKNP+I+ADACCSRHDVK ET +LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E++PRFGGVYVGTLS PEVK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IK++NATFPGVQMKF LQKL++K+G   K YKPV VPA  P N    
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQ+G FLQEGD+V+TETGTSAFGINQ+ FP  TYGISQVLWGSI     
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W +L +LPTFGAKDYE  RV+TTGEW KLTTD  F KNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LVAQA+LTA+ NAK
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAK 562

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/562 (79%), Positives = 493/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV  NT+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+A ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTT+ +QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EVV  V+ +IK AKNPVILADAC SRHDVK ET+KLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQ+PR+GGVYVGTLS PEVKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFALQKLL  +  V KDYKPV VPAR P N  + 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WNQ+  FLQEGD+VI ETGTSAFGINQ+ FP   Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A YN+IQ W +L LLPTFGAKDYE HR++TTGEW+KLT D +F  NS+IR+IEVML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP +LV QAQLTASINAK
Sbjct: 541 PVFDAPENLVQQAQLTASINAK 562

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/562 (79%), Positives = 491/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV+  TIFG+PGDFNLSLLDK+YEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVK ++ LVTTFGVGELSALNGIAGSYAEHVGVLH+VGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS+TTA+ITDI+SAPAEIDRCIR  YV QRPVYLGLPAN+VDL VPASL
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+T IDLSLK ND EAE+EVV  VL L+  AK+PVIL+DAC SRHDVK ET++LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PRFGGVYVGTLS+P+VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSD+ KIR+ATFPG++MK  LQ L+ ++G+ AK Y+P  VP     N    
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPLKQ+W+WNQV  FL+EGD+VITETGT+AFGINQ+ FP+ T GISQVLWGSI     
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN IQPWK+LDLLPTFGAKDYETHRV+TTGEW  LT   EFNKNS IRMIE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
            VMDAPSSL+ QA+LTA+ NA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/562 (78%), Positives = 496/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLKQV+ NTIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++AL+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS NISETT+MITDI +AP+EIDR IRTT+V+QRP YLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+ PIDLSLK ND EAE+EV+D VL LI+ +KNP+IL+DAC SRH VK ET+KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQ+PR+GGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSDYIK++NATFPGVQMKFALQKLL+ +  V K YK V VP +T  N   A
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WN++ KFLQEGDV+++ETGTSAFGINQ+ FP   YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN+IQ W +L LLPTFGAK YE H+V+TTGEW+KLT D EF KNS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP SL+ QA+LTA+ NAK
Sbjct: 541 PVFDAPESLIKQAELTAATNAK 562

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/562 (77%), Positives = 493/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NTIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ LVTTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETT+MITDI +AP+EIDR IRTT+++QRP YLGLPANLVDLKVP SL
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+ PIDLSLK ND EAE+EV+D VL LI+ +KNPVIL+DAC SRH+VK ET+KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQ+PR+GGVYVGTLS  +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSDY+K++NATF GVQMKFALQ LL  + DV K YK V VP +TP N    
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WN++ KFLQEGDV+I+ETGTSAFGINQ+ FP   YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A+YN+IQ W +L LLP FGAK YE H+++TTGEW+ LTTDSEF KNS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PV DAP SL+ QAQLTA+ NAK
Sbjct: 541 PVFDAPESLIKQAQLTAATNAK 562

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 491/562 (87%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA++TDI +A AEIDRCI+TTY++QRPVYLG+PAN+ D K+PA L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSLK ND EAE EV+D +L+L+KAAKNPVIL+DAC SRH+V+ ETR+LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PR+GGVYVGTLS PEVK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKN+VEFHSDY KI+NATFPGVQMKF LQKL   +    K YKP+ VPA+ P N   +
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPL Q+W+WNQ  KF QEGD++ITETGT+AFGINQS FP    GISQVLWGSI     
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  +RVILFIGDGSLQLTVQEISTM+RW L+PYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HGE AQYN+IQ WK+L LL TFGAKDYE HR++TTGEW+ L ++ +FNKNS+IR+IE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LV QA++TA+ NA+
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQ 562

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/562 (78%), Positives = 495/562 (88%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL QV   TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS++SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMSA ISETTAMITDI +APAEIDRCIRTTYV+QR VYLGLPANLVDL VPASL
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDL+LK N  E+E EV++ +L ++K AKNP+I+ADAC SRH+VK ET +LIDITQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E++PRFGGVYVGTLS PE+K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKNIVEFHSD++KI+NATF GVQMKF L+KL+AK+GD  KDYKPV VPA  P N    
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPLKQ+W+WNQ+G FLQEGD+V+TETGTSAFGINQ+ FP  TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W +L +LPTFGAKDYE  RV+TTGEW+KLTTD  FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+LVAQAQLTA+INAK
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAK 562

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/563 (73%), Positives = 478/563 (84%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV  +TIFGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VG PS +SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TDI +APAEIDRCIRTTY++QRPVYLG+PAN  DLKVPA+L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSL  N+ EAE+E +  VL L+K +KNP+I+ DAC SRHDVK ET KLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQ+PR+GGVYVGTLS PEVKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y TK++VEFHSDY++I+ ATFPGVQMKF L KL   + +  + YKP  VP R P+NA   
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            ST LKQ W+WNQ+ KFL+EGD+VI ETGTS FGIN++ FP     ISQVLWGSI     
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+DPK+RVILF GDGSLQLTVQEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A YN+IQ W++L LL TFGAKDYE +RVSTTG WN++T D +FN+NSKIRMIEVML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
           PVMDAP SL+ Q +LTA IN+K+
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/562 (77%), Positives = 481/562 (85%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMA ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDL+LK ND EAE EV++ VL LI+ A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE+NPRFGGVYVGTLS+  V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLLA VG   K Y PV +P R   N    
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             T L+Q+W+WN+V KF ++GD+++TETGT+AFGINQS FPN T GISQVLWGSI     
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDP KRVILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIERLI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  A YN IQPW++  LL  FGA DYE  +++TTGEW  LT D +FN+ SKIRMIEVML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAPS+L+AQA+LTA IN+K
Sbjct: 541 PVMDAPSNLIAQAKLTACINSK 562

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/562 (74%), Positives = 485/562 (86%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS++TLGRYLFERL Q+   TIFGLPGDFNL LLDKIYE+PGMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+ +QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF  F+RMS+ ISET  MI D+ +APAEIDRCI+T YV QRPVYLGLP NLV+  VP SL
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L TPIDLSL+ NDA++E EV+  +L ++K AKNP+I+ADAC SRHDVK ET KLIDITQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+EQ+PRFGGVYVGTL+ PEVK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKN++EFHSD+ KI+NA + G+QMKF L KL+ K+G+V K+YKPV VPA    N  T+
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPL+Q+W+WNQ+G FLQEGD+V+TETGTSAFGINQ++FP  TYGISQVLWGSI     
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRV+LFIGDGSLQLTVQEISTMV W LKPYLFVLNNDGYTIERLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQPW NL+LL TFGAKDY+  RV+TTGEWN LT + EFN+NSKIRMIEVML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           P MDAPS+L++QA+LTASINAK
Sbjct: 541 PTMDAPSNLISQAELTASINAK 562

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/565 (75%), Positives = 482/565 (85%), Gaps = 2/565 (0%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS I+LGRYLFERL QV  +TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS SSQAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETT+++TD+  APAEIDRCIR TY+ QRPVYLG+PAN  DL + A L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLSL  ND EAE E +D VL L+K A NP+IL DAC SRHDVK+ET+KLIDITQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQ+PR+GGVYVG L+ P +KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
            KTKN+VEFHSDY+KIRNA+FPGVQMKF LQKL  ++    K+YKPV VP +T  N   A
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STP+KQ+W+WNQ+ KFLQEGD+VI+ETGTS FGINQ+ FPN T GISQVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRVILF GDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKD--YETHRVSTTGEWNKLTTDSEFNKNSKIRMIEV 538
           HGE A YN+IQPW +L+L   FGAK+  +E HRVSTTGEWNKLT   +F  N+KIRMIEV
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSSLVAQAQLTASINAKN 563
           MLPVMDAP+SL+ QA+LTASINAKN
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAKN 565

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/561 (75%), Positives = 484/561 (86%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLKQV+ NTIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS +SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMS  ISETTAMITD++ A ++ID CIR TY +QRPVYLG+PAN+ D  +PA L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPI++ L  N+ E+E EVV+ +L ++K AKNPVI+ADACCSRH+VK ET KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E +PRFGGVYVGTL+ PEVK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKNIVEFHSD+IKI+NATF GVQMKF L +L+ ++GD  KDYKPV VPA  P+N    
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           D TPL+Q+W+WNQ+G FLQEGD+V+TETGTSAFGIN + FP  TYGI+QVLWGSI     
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDPKKRV LFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W +L +LPTFGA DYE  RV+T GEWNKLTTD +FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSSLVAQAQLTASINA 561
           PVMDAPS+L+AQ +LT +INA
Sbjct: 541 PVMDAPSNLIAQGKLTEAINA 561

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/562 (75%), Positives = 480/562 (85%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERLKQV  NTIFGLPGDFNL LLDKIY++PGMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS  SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETTA+ITD++ A +EIDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLKAN+ E+E EV+D +L L+  AKNP+ILADAC SRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE +PR+GG+YVGTLSSP VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKNIVEFHSD+IKIRNA FP +QMK  LQKL+ ++  V  +Y PV VPAR P NAA  
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
            STPLKQ+W+W ++G FLQEGD+VITETGTSAFGIN + FP  T GISQVLWGSI     
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EEIDP +RVILFIGDGSLQLTVQEIST ++W LKPYLF+LNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W++L LLPTFGAKDYE  R++T GEWNKLT D EFNKNS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           PVMDAP SL+ Q QLTA+INAK
Sbjct: 541 PVMDAPESLIKQGQLTAAINAK 562

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/564 (72%), Positives = 476/564 (84%), Gaps = 1/564 (0%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS I+LG YLFERLKQV  NTIFGLPGDFNL LLDKIY+VPG+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VG PS  SQA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETT MITD + A  +IDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSLKAN+  +E++V+D +L  +K AKNP+I++DAC SRHDVK+ET++LI+ITQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE +PR+GG+YVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y+TKN+VEFHSD++KI+NA FPGVQM+  L+KLL ++  V K Y PV VPA+ P N  + 
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 361 DST-PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXX 419
            +T PL+Q+W+WNQ+ +FLQEGD++ITETGTSAFGIN + FP    GISQVLWGSI    
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERL 479
                     EEIDPKKRVILFIGDGSLQLTVQEISTM++W LKPYLF+LNN+GYTIE+L
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVM 539
           IHG  A+YN+IQ W +L LLPT GAKDYE  RV+T GEWNKLT D EFNKNS+IR+IEVM
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSSLVAQAQLTASINAKN 563
           LPVMDAP SL+ Q +LT  INA +
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINANS 564

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/563 (72%), Positives = 472/563 (83%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS ITLGRYLFERL+QV+  TIFGLPGDFNL LLD+IYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+A L+TTFGVGELSALNG+ GSYAEHVGVLH+VGVPS++SQAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSANIS+TTAM+TD+ +AP EIDRCIRTTYV+QRPVYLGLPAN+V+  V   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDLSL+ ND + E+EV+  VLAL++ A+NP+ILADACCSRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E++PRFGGVYVGTLSSP+VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y T+N+VEFHSD+ K+RNA FP V MKF LQKL+ ++    + Y P  VP R   NA T 
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPL Q+W+W Q+G+FL+EGDVV+TETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    EE+D  KRVILFIGDGSLQLTVQEIS+MVRWGL+PYLFV NNDGYTIE+LI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG  AQYN+IQ W +L LLPTFGA DYE  RV+TTGEW+ LT D  FN+NS+IR++EVML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSSLVAQAQLTASINAKN 563
            VMDAPSSLV QAQLTA+ NA+N
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQN 563

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/521 (75%), Positives = 443/521 (85%)

Query: 43  MRWAGNANELNAAYAADGYARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP 102
           MRWAGNANELNAAYAADGYARVKGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRP 162
           S +SQAK LLLHHTLGNGDFTVFHRMS+N+SETTAMITD+ +APAEIDRCIRTTY++QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLKVPASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACC 222
           VYLG+PAN  DLKVPA+LL+TPIDL L  N+ EAE+E +D +L LIK +KNP IL DAC 
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLI 282
           SRHDVK ET KLI++TQFP FVTPMGKG+I+EQ+PR+GGVYVGTLS PEVK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKF L KL A + +V  
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPN 402
            YKP  VPAR P N A + +TPLKQ W+WNQ+ KFL+EGDVVI ETGT  FGIN++ FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 KTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGL 462
              GISQVLWGSI              EE+DP KRVILF GDGSLQLTVQEISTM+RW L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLT 522
           +PYLF+LNN+GYTIE+LIHG  AQYN+IQ W +L LL TFGAKDYE HRV+TTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 TDSEFNKNSKIRMIEVMLPVMDAPSSLVAQAQLTASINAKN 563
            + +FNKNS+IR+IEVMLPVMDAP SL+ Q +LTA INAKN
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/564 (70%), Positives = 461/564 (81%), Gaps = 1/564 (0%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGRYLFERL Q+  +TIFGLPGDFNL+LLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS  S+AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMS+ ISETT +++D  +APAEIDRCIR  Y++QRPVYLG+PAN+ D KV + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           LDTPIDL+L+ N  +AE+EV+D+++ +IKA+K P+ILADAC SRHDVK ET++LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS PEVK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
             T+N++EFHSD++KIRNATFPGVQMKF L+KLL ++  V K     +V  R  E + T 
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 361 DST-PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXX 419
           +    +KQ+W+W  VGKFLQEGDVV+TETGTS FGI +S FP  T GISQVLWGSI    
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERL 479
                     +EIDPKKRVILFIGDGSLQLTVQE+ST  RWGL PY+FVLNN+GYTIERL
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVM 539
           IHGE   YNDIQ W +  +LP FGAK+YE  RV+T GEWN +  D +FNKN K+RMIEVM
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPSSLVAQAQLTASINAKN 563
           LP MD P +L  QA+LTASINAKN
Sbjct: 541 LPTMDGPENLKKQAKLTASINAKN 564

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/562 (65%), Positives = 452/562 (80%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MSEI++GRYLFERL QV   TIFGLPGDFNLSLLDK+YEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120
           YARV GM  LVTTFGVGELSA+NGIAGSYAE + VLH+VGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180
           DFT FHRM   I++TTA+++D  +A +EIDRCI+T  ++  PVYLG+PAN+    + ASL
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           L+TPIDLS + ND +AE EV+D VL LI+ A+NP+IL+DAC SR+D+K+E + LIDITQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++EQ+PR+GGVY G++S PEVK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
           Y TK+IVEFHS +  I+NATF GVQMKF LQKL  KVGDV ++Y PV + ++   N    
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
             TPL QQW+W +V  FL+EGD+VI E+GT AFGIN+   P  T  ISQ+LWGSI     
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480
                    +EIDP +RVILFIGDGSLQL VQE+STM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540
           HG +AQYNDIQPW +L LLP FGAK+YE  R+ST G W++LT D EFN++SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSSLVAQAQLTASINAK 562
           P +D+  +LV QA++   IN+K
Sbjct: 541 PRLDSTDALVKQAKMITDINSK 562

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/548 (60%), Positives = 426/548 (77%), Gaps = 1/548 (0%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL+Q+   TIFGLPGDFN++LLDKIYEVPG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  LVTTFGVGELSA+NGIAGS+AEHV VLH+VG+P+  +Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM+AN++  T +++D  +A  EID+C++  +  QRPVYLG+P NL ++ V  S+L  
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           P+DLSLK ND E E++VV+ ++  +K AKNPVI+ADAC +RHDV  ETR+L+D+TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQ+PRFGGVYVG++SSPEV+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           KN+V  ++++ K++NA +P +++KF LQ LL  + ++   YKP  VP          D+ 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
           PL+Q+W+WNQ+  +  EGD+VITETGTSAFGINQ+ FPN T  ISQVLWGSI        
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIH-G 482
                 EE+  K RVILF+GDG+LQLTVQEISTM+RWGLKPYLFV+NN GYTI+RL+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 EKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLPV 542
             A Y+DIQPW NL LLP FGA +Y+  +V+T G++ KL  D +F  + K++MIEV+LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSSLV 550
           MDAP +L+
Sbjct: 554 MDAPPALL 561

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/554 (50%), Positives = 399/554 (72%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q++ +TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  L+TTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           P+DL L  ND + E+EV+  +L+ I  ++NP I+ DAC SR ++ +ET++L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E +P+FGGV+ G++S+PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           KN    +S  +K++NAT+P + +K  LQK+LA + +    Y+P + P+        A + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++  + Q GD++ITETG SAFG+NQ+ FP  T GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+V+WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
           R +H    A Y DIQPW  L LL  FG  +YET ++ T GE+  + +D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EVMLPVMDAPSSLV 550
           E+MLP  D P +L+
Sbjct: 555 EIMLPPRDVPQALL 568

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/549 (51%), Positives = 398/549 (72%), Gaps = 1/549 (0%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL+Q+   TIFG+PG FN+ LL +I  VP M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K +A LVTTFGVGELSA+NG+AGS+AEHVG+LH VG+P +++Q ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            VFHR+ +++++ T+++TD  +   E+D+CI   +  QRPVYLG+P N+ D  V ++LL+
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
            P+DLS    + E +++ V+ +L+ +   ++P I+ DAC SRH+V  E R+L+++TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E +PRFGG +VG++S P+V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADS 362
            KN     S Y +++NA +P +++K AL+ LL K+      Y+P +VP           +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX 422
            PL+Q+W+WNQ+  + +EGD+VITETGTSAFG+NQS FPN T  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHG 482
                   E     RVILF+GDG+LQLTVQE+STM+RWGLKP +FV+NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 E-KAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLP 541
           +  A Y+DIQ W NL LLP FGA DY+T  V T G++  L +D  F  N+KI+M+EV+LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPSSLV 550
            MDAP +L+
Sbjct: 554 PMDAPPALM 562

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 399/554 (72%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q++ +TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  L+TTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T +I D +    E+D+CI+  ++ QRPVY+G+P N V+L + +  L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           P+DL L  ND + E+EV+  +L+ I  +KNP I+ DAC SR ++ +E ++L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E +P+FGGV+ G++S+PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           KN    +S  +K++NAT+P + +K  LQKLLA + +    Y+P + P+        A + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++ ++ Q GD++ITETG SAFG+NQ+ FP  T GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+V+WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
           R +H    A Y DIQPW  L LL  FG  +YET ++ T GE+  +  D+ F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EVMLPVMDAPSSLV 550
           E+MLP  D P +L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/549 (51%), Positives = 393/549 (71%), Gaps = 1/549 (0%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL+Q+   TIF +PG F++  + +IY+ P M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K +  L TTFGVGELSA+NG+AG++AEHVG+LH+VG+P +++Q KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            VFHR+ +++++   ++ D  +   E+D+CI      QRPVYLG+P N+ ++ V + LL+
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
            P+DL   A + + E+  V+ VL  I    NP I+ADAC SRH+V+ E + L+D+TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQ+PRFGG +VG++SSP+V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADS 362
           TKN V   SDY K++NA +P + +K  L+ +LAK+      Y+P QVP           +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX 422
            PL+Q+W+W Q+ ++ +EGD+VITETGTSAFG+NQ+ FP+ T  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHG 482
                   E     RVILF+GDG+LQLTVQEISTM+RWGL P +F++NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 EK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLP 541
           +  A Y+DIQ W NL +LPTFGA +YE   V T G++  L  D++F  N KI+M+EV+LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPSSLV 550
            MDAP +L+
Sbjct: 554 PMDAPPALM 562

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/546 (50%), Positives = 379/546 (69%), Gaps = 1/546 (0%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RLKQ++  TIFGLPG+FN  L+DK+Y + G+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  +++TFGVGELSA+NGIAGSYAEHVG+LH+VG+P  S+Q +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM+  +S  +A+I D      E+D CIR  Y+ QRPVY+G+P NLV + V +  L+ 
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           PIDLS+  ND   E EV+D +L     A NPVI+ADAC +RH ++ ET +L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P+FGGVY G++SSP V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
             +V  +   +K ++AT+P + +K  L  LLA + +    Y+    P           + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
           PL+Q+W+WNQ+ ++  EGDV+ITETGTSAFGINQ++FP  T GISQ LWGS+        
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGE 483
                 +E     RV+LF+GDG+ QLT QE+ST++RWGL PY+F++NN GY+++R +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLH-S 490

Query: 484 KAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLPVM 543
            A Y DIQ W    L   FGAKDYE+ ++ T G++  +  D  F+   +IR++E+MLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPSSL 549
           D P +L
Sbjct: 551 DVPQAL 556

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 399/554 (72%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q++ +TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  L+TTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           P+DL L  ND + E+EV+  +L+++  ++NP I+ DAC SR ++ +ET++L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E +P+FGGV+ G++S+PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           KN    +S  +K++NAT+P + +K  LQKLLA + +    Y+P + P         A + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++ ++ Q GD++ITETG SAFG+NQ+ FP  T GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+V+WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
           R +H    A Y DIQPW  L LL  FG  +YET ++ T GE+  L  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EVMLPVMDAPSSLV 550
           E+MLP  D P +L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 396/554 (71%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL Q++ +TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  L+TTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T +I D      E+D+CIR  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
           P+DL L  ND + E+EV+  +L+ +  ++NP I+ DAC SR ++ +E+++L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           KN    +S  +K++NAT+P + +K  LQKLLA + +    Y+P + P+        A + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++  + Q GD++ITETG SAFG+NQ+ FP  T GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
                 +EI        K RVILF+GDG+ QLTVQE+ST+V+WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
           R +H    A Y DIQPW  L LL  FG  +YET ++ T GE+  +  D EF  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EVMLPVMDAPSSLV 550
           E+MLP  D P  L+
Sbjct: 555 EIMLPPRDVPQVLL 568

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/554 (49%), Positives = 384/554 (69%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RLKQ+   TIFGLPG FN +LLDK+ E+PG+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM++ ++  + +I D +    E+D CI   +  Q+PVY+G+P NLVD  V +  L+T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSF 243
            ++L+L +ND + E E+V  +L  +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++SSPEV+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADST 363
           K  V  +   +K ++A +P +++K  +  LL  + +    Y+    P      +      
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
            L+ +W+WNQ+  + QEGD++ITETGTSAFGINQ+HFP+ + GISQ LWGS+        
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 XXXXXXEEIDPKK------RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
                  E+   +      RVILF+GDG+ QLTVQE+STM+RWGL PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 RLIHGE-KAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
           R +H    A Y DIQ W+ L L+P FGA+ YET ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EVMLPVMDAPSSLV 550
           E+MLP MD P +L+
Sbjct: 553 EIMLPPMDVPQALM 566

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/557 (48%), Positives = 379/557 (68%), Gaps = 9/557 (1%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL+Q+   TIFGLPG+FN+ LLDKIY +P MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K +  LVTTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            VF+RM+ +++  T ++ D +    E+D+C+   +  Q+P YLG+P N VDL V +  LD
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
           TP++L  + N+ E E +VV  +L  +   +NP I+ DAC  RHD+ +ET++   +T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    FGGV+ G+LSSP V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADS 362
           TKN    HS  +K++NAT+P + +K  +Q LL+++            P         + +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX 422
             LKQ+W+WN++  + Q+GD++ITE GTSAFGINQ+ FP +T GISQ LW S        
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 XXXXXXXEEIDP--------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGY 474
                  +E+          + RV+LF+GDG+ Q+T+QEISTM+RW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIERLIHGE-KAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKI 533
           +++R +H   KA Y D+QPW  L     FGA DYET ++ T G+   +  D  F K+ KI
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEVMLPVMDAPSSLV 550
           RM+E+MLP  D P  LV
Sbjct: 556 RMLEIMLPSTDVPQVLV 572

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/593 (48%), Positives = 401/593 (67%), Gaps = 43/593 (7%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           E+T+  YLF RLKQ++ NTIFGLPG+FN+SLLDK+Y V GMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K +  L+TTFGVGELS +NGIAGS++E+VG++HIVG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            +FHR+S +I   +A++T  N    EID+C+   ++SQ+PVYLGLP NLV +KV ++LL+
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
           TP+DL L  ND + E   +D +L  I +AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE + +FGGV+VG++SS +V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVP------------ 350
           TK+IV   S  +K++N  +P + +K  L KL+  +      YKP+  P            
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 351 --------ARTPE-NAATADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFP 401
                   ++TP+ N +  + T LKQ+W+WN+   + +EGD++ITETGTSAFGINQ+ FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NKTYGISQVLWGSIXXXXXXXXXXXXXXEEI---DP---KKRVILFIGDGSLQLTVQEIS 455
           N+T GISQ LWGS               EEI   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMVRWGLKPYLFVLNNDGYTIERLIHGE----------------KAQYNDIQPWKNLDLL 499
           TMV+W L PY+F++NN GY+++R +  +                   Y DIQ W  L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLPVMDAPSSLVAQ 552
             F A +YET++V +  +  K+     F+   +IRM+E++LP MD P SL+ +
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/568 (48%), Positives = 385/568 (67%), Gaps = 15/568 (2%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RLKQ+   TIFGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+  L+TTFGVGELSALNG+AGS+AEHVG+LHIVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
           +VFHR++++I+    +I D +    E+D+CI   ++ QRPVY+G+P N V+L V +  LD
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
            P+DL +  N  E   E+ + +L  I   K+P I+ DAC  RH+  DE  +    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P FGGV++G+LSSP V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATADS 362
            K+ V   SD +KI+N+ +  + +K  ++ LL  + +    Y   + P+         D 
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX 422
             L+Q+W+WN++  + +EGD++ITE GTSAFGINQ+ FPN+  GISQ LWGS        
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 XXXXXXXEEID--------------PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFV 468
                  +E +               K RVILF+GDG+ QLT+QE+ST++RW L PY+FV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNDGYTIERLIHGE-KAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEF 527
           LNN+GY+++R +H E  A Y DIQPW  LDL+ TF AK+YET ++ T G++  +  D  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NKNSKIRMIEVMLPVMDAPSSLVAQAQL 555
             N KIRM+E++LP  D P +LV   +L
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/581 (48%), Positives = 386/581 (66%), Gaps = 21/581 (3%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           S+I++  YLF RL Q+   TIFGLPGDFN+ LLDK+Y +P MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K +  L+TTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLL 181
           ++VF+R++ +I+  TA+I D +    E+D CIR  +  Q+PVYLG+P N VD+ V +S L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 DTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
           + PIDLS+     E + +V+D +L  + +A  P+I+ DAC  RHD   ET  L ++T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE    FGGVY G+LSSPEV+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYK-PVQVPARTPENAATA 360
           K KN        +KI+ ATFP + +K  LQ L+  +      YK   +V    P+    +
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPK-MEPS 369

Query: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXX 420
           DS  L+Q+W+WN++  + +E D++ITETG+SAFGINQ+ FP  T GI+Q LWGS+     
Sbjct: 370 DSNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALC 429

Query: 421 XXXXXXXXXEE------------------IDPKKRVILFIGDGSLQLTVQEISTMVRWGL 462
                    EE                  I  + R ILF+GDG+ QLTVQE+ST++RW L
Sbjct: 430 SCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKL 489

Query: 463 KPYLFVLNNDGYTIERLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKL 521
           KPY+F++NN+GY+++R +H    A Y D+QPW  L LL  FG   +ET ++ T  ++ +L
Sbjct: 490 KPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKEL 549

Query: 522 TTDSEFNKNSKIRMIEVMLPVMDAPSSLVAQAQLTASINAK 562
             D  F K  KIRMIE+MLP  D P +L+A+ Q    ++ K
Sbjct: 550 LADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNK 590

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/564 (49%), Positives = 379/564 (67%), Gaps = 15/564 (2%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           S IT+  Y+F RLKQ+   TIFGLPG+FN+ L+DK+Y++P +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGD 121
           +R+KG+  LVTTFGVGELSA+NG+AGS+AEHVG+LHIVG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLL 181
           + VF R+++ ++  T +I D +    E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 DTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
           + P+ LS   N  +   +VV  +L  I  + +PVI+ D C  RH   DE  + I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE NP F GV+ G++SSP V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATAD 361
           K+KN    +SD IK  NAT+P V +K  LQ LL  + +   +Y P + P          D
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 STPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXX 421
              L+Q+W+WN++  + QEGD++ITETGTSAFGINQ+ FPN+  GISQ LWGS+      
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 XXXXXXXXEEID--------------PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLF 467
                   +E                 K RVILF+GDG+ QLT+QE+ST+VRW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNDGYTIERLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSE 526
           +LNN GY+++R++H    A Y DIQ W  L+L+ TF A D +T ++ T G+   +  D E
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNKNSKIRMIEVMLPVMDAPSSLV 550
           F  +++IRMIEVMLP MD P +LV
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALV 574

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/557 (47%), Positives = 379/557 (68%), Gaps = 10/557 (1%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RLKQ+   TIFGLPG+FN+ LLD++Y +PG++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+  ++TTFGVGELSA+NGIAG++AEHVGVLH+VG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            VFHRM+ ++S  + +I D +    E+D+CI   Y+ Q+PVYLG+P N V+LKV ++ L+
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
             +   +  N+ + E E ++ +L  I   ++P I+ DAC +R D   ET + I +T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P FGGV+ G++SSP V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKP---VQVPARTPENAAT 359
           +KN V    D ++ + + +P + +K  ++ +L+++      ++P      P   P++  +
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 360 ADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXX 419
            D   L+Q+W+W++   + QEGD++ITE GTS+FGINQ  FP+ T GISQ LWGS     
Sbjct: 372 DDQL-LRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSM 430

Query: 420 XXXXXXXXXXEE-----IDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGY 474
                      E        ++RVILFIGDG+ Q+T+QEISTM+RW L PY+F+LNN GY
Sbjct: 431 GSCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGY 490

Query: 475 TIERLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKI 533
           +I+R +H  K     D+Q W  L     FGA DYET ++ T G+  ++  + +F++  +I
Sbjct: 491 SIDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RMIEVMLPVMDAPSSLV 550
           RM E+MLP MD P ++V
Sbjct: 551 RMAEIMLPSMDVPKAIV 567

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/580 (47%), Positives = 386/580 (66%), Gaps = 28/580 (4%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           ++ITL  YLF RL Q   +T+FGLPG+FN+ L+DK+  +P ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGD 121
           AR+KG+  L+TTFGVGELS++NGIAGSYAEHVGVLHI+G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLL 181
           +TVFHR+++ ++  + ++ D +    EID  I   +  QRPVYLG+P N +   + ++LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 DTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
           +  +D +L++N+  ++ +V++ +L  I   K PVI+ DAC +RH+++ ET +L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++SSP+V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATAD 361
           K+K+ +   SDYIK RN TF  + +K  ++KLL  + DV+K  K  Q+      N    +
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLAL-DVSK-IKNFQLQENNNGNIYIPN 368

Query: 362 -----STPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIX 416
                +  L+Q+W+WNQ+  + Q+GD++ITETGT+AFGINQ+ FP+   GISQ LWGS  
Sbjct: 369 IKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTG 428

Query: 417 XXXXXXXXXXXXXEEID--------------------PKKRVILFIGDGSLQLTVQEIST 456
                         EI                     PK RVILFIGDG+ QLTVQE+ST
Sbjct: 429 YSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELST 488

Query: 457 MVRWGLKPYLFVLNNDGYTIERLIHGEK-AQYNDIQPWKNLDLLPTFGAKDYETHRVSTT 515
           ++RWGL PY+F++NN GY+ +R +H    A Y DI  W  L LL  FGAK YE+ ++ T 
Sbjct: 489 IIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITV 548

Query: 516 GEWNKLTTDSEFNKNSKIRMIEVMLPVMDAPSSLVAQAQL 555
           G++ K+  +  F  +S +RMIE++LP MD P +L+ + +L
Sbjct: 549 GDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRL 588

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/561 (47%), Positives = 375/561 (66%), Gaps = 14/561 (2%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +I LG+YLF RL Q++  TIFGLP +FN  LLD+IY++P MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K ++ LVTTFGVGE+S LNGIAGS++EHV VLH+VG+P  S+Q K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLD 182
            +FHR++++I   TA++ + ++    ID CI   Y  Q+PVY G+P NL    V +  LD
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKAND--AEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
           +P+ L    N   ++A +E+VD +L  I +A++PVI+AD C SRHD  +E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ+ R+ GVY+G++SSP+V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDYIKIRNA-TFPGVQMKFALQKLLAKVGDVAK-DYKPVQVPARTPENAA 358
           YK KNIV     Y K+    T+P V++K  LQ LLA+  D  K  Y   ++P  +     
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQ-LLARCLDPTKLQYIQEEIPESSCLRVK 371

Query: 359 TADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXX 418
              +TPL+Q+W+W ++  + + GDV++TE GTS  G+NQ  FP+ T  +SQ LWGS+   
Sbjct: 372 PDANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYS 431

Query: 419 XXXXXXXXXXXEEID-----PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
                      +E          R+ILF+GDG+LQLTVQEIST+++WGL PY+FV+NN G
Sbjct: 432 VGACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQG 491

Query: 474 YTIERLI----HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNK 529
           YTI+RL+    H   A Y +IQPW NL ++P FG  +Y+  +V   G+ ++L  D  F+ 
Sbjct: 492 YTIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSN 551

Query: 530 NSKIRMIEVMLPVMDAPSSLV 550
              ++M+E++LP MDAP +L+
Sbjct: 552 QDILKMVEIILPSMDAPQALL 572

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  504 bits (1298), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 247/553 (44%), Positives = 348/553 (62%), Gaps = 6/553 (1%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           S I L  YLF RL+Q+   T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGD 121
           AR++ ++ LV+TFGVGELS +NGIAGS+AEHV VL IVG+P  S+Q ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLL 181
           + VF R++++I   + ++   ++A   +D CI   Y  Q+PVY G+P NL +  +P++ L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 DTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
           D P  L L         E+V  +L  I AAK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVP--LPLLDEPCAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS+P+V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATAD 361
           K KNI   H+ + ++    FP   ++  L  L+ +    A       VP  +    A   
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 STPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXX 421
           +TPL+ +W+W ++ ++   GD++++ETGTSAFG+ Q+  P     +SQ LWGS+      
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI- 480
                       P +RV+LF+GDG+LQLTVQE+STMVR  L P +FVLNN GY+ +RL+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIE 537
              H   A+Y D+QPW NL L P FGA  Y+   V+T GE + L +D  F + S ++M+E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 VMLPVMDAPSSLV 550
           V LP MD P +L+
Sbjct: 550 VALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  435 bits (1119), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 230/559 (41%), Positives = 329/559 (58%), Gaps = 38/559 (6%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           S IT+  YLF RLKQ+D  TIFGLPG+FN+ L+DK+Y++P +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGD 121
           AR+K +  L+TTFGVGELSALNGIAGS++EH+G+LH+V +P +      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLL 181
           +                       P +    + T  +S R ++  +          A +L
Sbjct: 130 YKF---------------------PMKARDILVTPRISHRNLWDEMIKPNQAWISSAGIL 168

Query: 182 DTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
                   K    +       ++        +  +     C R +     RK     +FP
Sbjct: 169 AYRYWRGSKIPKGKGADXXXKNLQCRTSYLSSRSLRFKEQCRRCNSDYSVRK----QKFP 224

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E N +FGGV+ G++SSP V+E V+ ADL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATAD 361
           + K++V   S Y+KIRN  +P + +K  L  LL++V      Y  ++ P   P +   + 
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIK-PMVVPTSKLPSK 342

Query: 362 STPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXX 421
           S  L+Q+W+WN++  + QE DV+ITETGTSAFGINQ+ FP +++GISQ LWGS+      
Sbjct: 343 SV-LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYSLGA 401

Query: 422 XXXXXXXXEEIDPK-------KRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGY 474
                   +E+           RVILF+GDG+ QLT+QE+STM++W LKPY+F++NN GY
Sbjct: 402 CLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNNQGY 461

Query: 475 TIERLI-HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKI 533
           +I+R + H   A+Y DIQ W+ L+LL  FGA DYE  ++ T  ++  +  D+ F +N KI
Sbjct: 462 SIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARNDKI 521

Query: 534 RMIEVMLPVMDAPSSLVAQ 552
           RMIE+MLP MD P SL+ Q
Sbjct: 522 RMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  336 bits (861), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/555 (34%), Positives = 310/555 (55%), Gaps = 38/555 (6%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I L  YLF RL Q++  T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFT 123
             G++  VT+    EL  +NG  GS+ E+V +L +V V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDT 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      VP+S L+ 
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DLSLKANDAEAE--QEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQ 239
            I   + +K    + +  + V+D ++A + A+  P+I+ DA   R++     +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P F G ++GT+S P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAK--DYKPVQVPARTPENA 357
           +YK+KN +   +D +KI N   P + +   L +L+A + D  K  + +PV +P   P   
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASL-DTTKIVNSRPVTIPNMIPR-V 360

Query: 358 ATADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXX 417
                T L+Q+++W ++  +L++GDV+I+E+GTSA G+ Q  FP+ T  +SQ +W S   
Sbjct: 361 EPQPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGY 420

Query: 418 XXXXXXXXXXXXEEIDP--KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYT 475
                        ++    K R+IL +GDGSLQ T QE+ST++  G KPY+FV+NN GYT
Sbjct: 421 SIGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 476 IERLIHGEK----AQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNS 531
           ++R ++ EK    A Y DIQPW+ L L   F +++Y   R  + GE N L +D EFNK+ 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 532 KIRMIEVMLPVMDAP 546
           +++++E++LP MD P
Sbjct: 541 QLKIVELILPSMDVP 555

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 207/604 (34%), Positives = 316/604 (52%), Gaps = 58/604 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL    T ++FG+PGDFNLSLL+ +Y    +   ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHT-- 116
           GY+R    +  ++TT+GVGELSA+NG+AG++AE+V VLHIVGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYL 165
                + N +F       +H M    IS +T  + +++ A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLKVPASLLDTPIDLSLKANDAEA-EQEVVDD----VLALIKAAKNPVILADA 220
            +PA+  D  V A  L T   ++L+   ++   QEVVD     ++ L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESAD 280
            C R    +E R  + IT+  +F + MG+  +DE  P F GVY G  SSP + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKI------RNATFPGVQMKFALQKL 333
           LIL  G L ++ N G +S+S+      VE HSDY+              GV     L ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LAKVGDVAK---DYKPVQVPARTPENAATAD----STPLKQQWIWNQVGKFLQEGDVVIT 386
           +  + DV K    Y  + V    PE A  A      + + Q+++ N + ++L  GDV + 
Sbjct: 392 IQLI-DVTKINLKYPDLTV---NPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVV 447

Query: 387 ETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEE-------------ID 433
           ETG+  F +    FP     ISQ  + SI              ++             +D
Sbjct: 448 ETGSFQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLD 507

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPW 493
              ++IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+ER I G    YNDI  W
Sbjct: 508 YTPKLILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEW 567

Query: 494 KNLDLLPTFGAKD---YETHRVSTTGEWNKLTTDSEFNK-NSKIRMIEVMLPVMDAPSSL 549
           K   LL  FG  D    E  +V   GE+  +    + +K  SK+R+IEVML +MD P  L
Sbjct: 568 KWTKLLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQL 627

Query: 550 VAQA 553
           +A A
Sbjct: 628 LAMA 631

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 208/602 (34%), Positives = 303/602 (50%), Gaps = 56/602 (9%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE---VPGMRWAGNANELNAAYAAD 59
           EIT G Y+F RL    T ++FG+PGDFNL+LL+ +Y+      +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQL---LLHH 115
           GY+R    +  L+TT+GVGELSALNG+AGS+AE V VLHIVGV S  +  K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLG 166
               L + +F      T +  +   +      + DI+ A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLKV--------PASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILA 218
           +PA+  D+ V        P   L+  I   +   +++ E  +V  V  LI  + NP IL 
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEA-IVAKVAQLIYNSSNPCILG 268

Query: 219 DACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVES 278
           D    R+ V  +   LI   Q  +F T MGK  IDE NP + G+Y G   S  V E    
Sbjct: 269 DVLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSK 328

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDYIKIRNA------TFPGVQMKFA 329
            DLIL  G   ++ N G ++  Y      N+VEFHSDYI+  N+         GV     
Sbjct: 329 CDLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHV 388

Query: 330 LQKLLAKV--GDVAKDYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITE 387
           L +L   +    ++ +Y+     +       +  S  + Q+++ + + ++L  GDV++ E
Sbjct: 389 LNRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCE 448

Query: 388 TGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX-----------XXXXXXXEEIDPKK 436
           TG+  FG+    FP+    +SQ  + SI                         EEI+ + 
Sbjct: 449 TGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEP 508

Query: 437 RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNL 496
           ++ILF GDGS Q+T+QE+STM+   +K  +F+ NNDGYTIER I G    YNDI PW   
Sbjct: 509 KLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWT 568

Query: 497 DLLPTF----GAKDYETHRVSTTGE--WNKLTTDSEFNKN---SKIRMIEVMLPVMDAPS 547
            +   F    G+K    ++V +T E    +L    +   N    +I ++EV + V+D P 
Sbjct: 569 KMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPE 628

Query: 548 SL 549
            L
Sbjct: 629 QL 630

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 211/602 (35%), Positives = 320/602 (53%), Gaps = 53/602 (8%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAA 58
            I LG+Y+FER+    T TIFG+PGDFNLSLL+ IY     + G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSI----SSQAKQLL 112
           DGY+R    +  L+TT GVGELSALNGIAG++AE V +LHIVGV PS     S+Q+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVY 164
            H      D  +    HR+        +S ++  + DI+SA  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLKVPASLLDTPIDLSLK-------ANDAEAEQEVVDDVLALIKAAKNPVIL 217
           + +PA+  D  V A  L+    + L+        ND +  QE+ + +L  + ++  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKC-QELAEYILESMYSSSRPAII 259

Query: 218 ADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVE 277
           AD  C R+D+    R+L++ T   +F + MGK  +DE N  F GVY G+ S  +V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNA-----TFPGVQMKFALQ 331
           + D +L VG + ++ NTG +SY +    NIVE H  Y+   +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLAKVGDVAKDYKPVQ--VPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETG 389
            ++ ++ D  K +   Q  +P+RT E      S+ +   ++     KFL  GDV + +TG
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGPPHSS-VTHSYLQTHFPKFLSSGDVFVVDTG 438

Query: 390 TSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPKK 436
           +  FG+    FP+    ISQ  + SI              ++              + + 
Sbjct: 439 SFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQP 498

Query: 437 RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNL 496
           R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+ER I G    YNDI  W+  
Sbjct: 499 RLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEWT 558

Query: 497 DLLPTFGAKDYE---THRVSTTGEWNKL--TTDSEFNKNSKIRMIEVMLPVMDAPSSLVA 551
           +LL  FG    E   + +VS+  + ++L  T  S   ++  +R++EVML VMD P  L A
Sbjct: 559 ELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQLKA 618

Query: 552 QA 553
            A
Sbjct: 619 MA 620

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 217/607 (35%), Positives = 317/607 (52%), Gaps = 59/607 (9%)

Query: 6   LGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAADGY 61
            G Y+F RL  + T ++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAYAADGY
Sbjct: 27  FGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAADGY 86

Query: 62  ARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP----SISSQAKQLLLHH- 115
           +R    +  L+TT+GVGELSALNGIAGS+AE+V VLHIVGV     S S+  K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGL 167
              L + +F      V+H M   N++ + A + DI +A  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYVFV 206

Query: 168 PANLVDLKVPA-SLLDTPIDLSLKANDAEAEQE---VVDDVLALIKAAKNPVILADACCS 223
           PA+  D+ V   +L++ P         + +E +   ++D +   + +++ P IL D    
Sbjct: 207 PADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVLTD 266

Query: 224 RHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLIL 283
           R+ V D   KLI  ++  +F T MGK  IDE NP + G+Y G     +V E  ES DLIL
Sbjct: 267 RYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDLIL 326

Query: 284 SVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFALQKLLAK 336
             G  +++ N G +S++YK    I++FH +YI+           F GV     LQ+L   
Sbjct: 327 HFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELYQC 386

Query: 337 VGDVAKDYKPVQVPAR-TP--------ENAATADSTPLKQQWIWNQVGKFLQEGDVVITE 387
           + DV+K    +Q  +R TP        E+     ST + Q  +   + KFL  GDVV+ E
Sbjct: 387 I-DVSK--LSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCE 443

Query: 388 TGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------------- 434
           TG+  F +    FP +   ISQ  + SI              ++  P             
Sbjct: 444 TGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEGY 502

Query: 435 KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWK 494
           K R+ILF GDG+ Q+T+QE+ST++++ +   + + NN+GYTIER I G    YNDI  WK
Sbjct: 503 KPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWK 562

Query: 495 NLDLLPTFGAKD--YETHRVSTTGEWNKLTTDSEFNKNS--KIRMIEVMLPVMDAPSSLV 550
              L   FG  D  Y  + +  T     L      N ++  +I ++EV L V+D P  L 
Sbjct: 563 WTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLR 622

Query: 551 AQAQLTA 557
              +  A
Sbjct: 623 CMVEAAA 629

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 202/594 (34%), Positives = 306/594 (51%), Gaps = 49/594 (8%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY------EVPGMRWAGNANELNAAYA 57
           +  G Y+F+RL    T +IFG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHT 116
           ADGY+R    +  +VTT GVGELSA+NGI+GS+AEHV VLHIVG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGL 167
           L N         ++ VF  M   ++S +T  I ++++A  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLKV-PASLLDTPI-----DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADAC 221
           P N   L V P +L +TP       +++  +  E    + D + + +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 CSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADL 281
             R+       + I  T   +F T MGK  +DE    + GVY G     +V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKI------RNATFPGVQMKFALQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  YI++          F GV+  + L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLAKVG--DVAKDYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETGT 390
           +L  V   ++  +Y P    + T  +     +  + Q  I   +  +++ GDVV+ +TGT
Sbjct: 384 MLKMVNPSNLHLNY-PTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 391 SAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DPKKRV 438
             F +    F ++   +SQ  + SI               +             + K R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 439 ILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNLDL 498
           ILF GDG+ Q+TVQE+STM+R+ +   +F+ NNDGYTIER I G    YNDIQPW    L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 499 LPTFG-AKD--YETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVMLPVMDAPSSL 549
              FG AK+   + H+V TT E + + T+      + I  +EV L +MD P  L
Sbjct: 563 FKAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKIL 616

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  318 bits (816), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 213/607 (35%), Positives = 318/607 (52%), Gaps = 55/607 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           I  G Y+F+RL  +DT ++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SISSQAKQLL---LH 114
           GY+R    +  L+TT+GVGELSALNGIAGS+AE+V VLHIVGV  SI S++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI +A  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLKVPA-SLLDTPI----DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADA 220
            +PA+  D+ V   +L++ P     D  +  ++ +   ++++ + + I ++K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQL-SDIINKITSWIYSSKTPAILGDV 263

Query: 221 CCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESAD 280
              R+ V +   KLI  T   +F T MGK  IDE NP + G Y G     +V E  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFALQKL 333
           L+L  G  +++ N G ++++YK    I++FH +YI++          F G+     L++L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 334 LAKVGDVAK-----DYKPVQVPARTP--ENAATADSTPLKQQWIWNQVGKFLQEGDVVIT 386
             ++ DV+K     D    Q    T   E+     S+ + Q  +   + KFL  GDVV+ 
Sbjct: 384 YKRI-DVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVVC 442

Query: 387 ETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DP 434
           ETG+  F +    FP++   ISQ  + SI              ++             D 
Sbjct: 443 ETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKEDY 502

Query: 435 KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWK 494
           K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIER I G    YND+  WK
Sbjct: 503 KPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSWK 562

Query: 495 NLDLLPTFGAKDYETHRVSTTGEWNKLTTDSE----FNKNSKIRMIEVMLPVMDAPSSLV 550
              L   FG  D +    +     +KL    E     NK S I ++EV L  +D P  L 
Sbjct: 563 WTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQLK 622

Query: 551 AQAQLTA 557
              +  A
Sbjct: 623 CMVEAAA 629

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 216/614 (35%), Positives = 318/614 (51%), Gaps = 63/614 (10%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAY 56
           ++ I+ G Y+F RL    T ++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARV-KGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SISSQAKQLL-- 112
           AADGY+R    +  LVTTFGVGELSALNG+AGS+AE+V VLHIVGV  SI S++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI +A  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLDTPIDLSLKANDAEAEQ----EVVDDVLALIKAAKNPVIL 217
            Y+ +PA+  D+ V   +L++ P  +S +       Q    +++D + + + ++K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVP-HISQQDCITYPSQIQLFDILDRITSWMYSSKTPAIL 260

Query: 218 ADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVE 277
            D    R+ V +   KLI  T   +F T MGK  IDE NP++ G Y G     +V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFAL 330
           S DL+L  G  +++ N G ++++YK    I++FH +YI+           F G+     L
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 QKLLAKVGDVAK----------DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQE 380
            +L   + DV++           Y    +    P N  + + T +  Q +   + KFL  
Sbjct: 381 MELYKGI-DVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKV---MPKFLSP 436

Query: 381 GDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------ 434
           GDVV+ ETG+  F +    FP +   ISQ  + SI              ++         
Sbjct: 437 GDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDE 496

Query: 435 ------KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYN 488
                 K R+ILF GDG+ Q+T+QE+ST+++  +   +F+ NN+GYTIER I G    YN
Sbjct: 497 NIGEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYN 556

Query: 489 DIQPWKNLDLLPTFGAKDYETHRVSTTGEW-NKLTTDSEFNKNSKIR----MIEVMLPVM 543
           D+  WK   LL  FG  D   H  ST  E+ +KL    E  K+S  R    ++EV L V+
Sbjct: 557 DVMSWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVL 615

Query: 544 DAPSSLVAQAQLTA 557
           D P  L       A
Sbjct: 616 DFPEQLKCMVDAAA 629

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 208/611 (34%), Positives = 317/611 (51%), Gaps = 64/611 (10%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAA 58
            I  G YLF++L Q  + +IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHH-- 115
           DGY+R    +A L+TT+GVGELSA+NG+AGS AE+V VLHIVGV  + S A +   HH  
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 116 -TLGNGDFT------VFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLP 168
             L + +F        +  +   ++ +   + DI +AP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLKVPASLLDTPIDL--SLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHD 226
           A+  D  V  + L+  I+L  S++   +E    +VD VL  I  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVG 286
           +  +  + I+ TQ  +F T MGK  IDE NPR+ G+Y G   +  V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMKFALQKLLAKVGD 339
              ++ N  +  + Y  +  ++EFH  YI++ +        F  V     L  L  ++ D
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRI-D 371

Query: 340 VAK-----------DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITET 388
           ++K            Y+P Q+      N    D++ + Q ++  +  + L  GD+++++T
Sbjct: 372 ISKLNLQYDKAIFTTYEPSQL------NLPEEDTSDVTQIYLQKKFPEILAPGDILVSDT 425

Query: 389 GTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP-------------K 435
           G+  FG+     P ++  ++Q  W SI              ++                K
Sbjct: 426 GSFQFGVRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYK 485

Query: 436 KRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKN 495
            +++L +GDG+ Q+TVQE++TM+R+ +   +FV NN+GYTIER I GE + YNDI PW+ 
Sbjct: 486 PKLVLGVGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRW 545

Query: 496 LDLLPTFG---AKDYETHRVSTTGEWNKLTTDSEFNKNSK-IRMIEVMLPVMDAPSSLVA 551
             L   FG    K   +  V T  E ++   D   NK  K I ++EV L VMD P+ L  
Sbjct: 546 TKLFEAFGDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL-- 601

Query: 552 QAQLTASINAK 562
           Q  L+   NAK
Sbjct: 602 QMMLSNMKNAK 612

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  314 bits (805), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 214/611 (35%), Positives = 318/611 (52%), Gaps = 54/611 (8%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAAD 59
           I  G YL +R+    T +IFG+PGDFNLSLL+ +Y       G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SISSQAKQLL---LH 114
           GY+R    M+ L+TT+GVGELSA+NG+AG++AE V VLHIVGV  S+ S++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I +A  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLKV-PASLLDTPIDLSLKANDAEAE----QEVVDDVLALIKAAKNPVILADA 220
            +PA+  D+ V P++L+  P+ ++L+    E      +EV   +L  I  +K P I+ D 
Sbjct: 208 FVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDV 266

Query: 221 CCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESAD 280
              R     E  KLI +T   +F T MGK  IDE NP++ G+Y G      V E     D
Sbjct: 267 LTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCD 326

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI------RNATFPGVQMKFALQKL 333
           L+L  G  +++ N G ++Y Y +   IVE H +Y++           F GV     L++L
Sbjct: 327 LVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRL 386

Query: 334 LAKVGDVAKDYK-PVQVPARTPENAA--TADSTPLK--QQWIWNQVGKFLQEGDVVITET 388
           L K+     ++  P  V   + E        S+ LK  Q  + N++  +  +GDVV+ ET
Sbjct: 387 LEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCET 446

Query: 389 GTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKK------------ 436
           G+  F +    FP++   ISQ  + SI              ++  PK             
Sbjct: 447 GSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSYQ 505

Query: 437 -RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKN 495
            R+ILF GDG+ Q+TVQE++TM+R  +   + +LNN+GYTIER I G    YNDI PWK 
Sbjct: 506 PRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKW 565

Query: 496 LDLLPTFGAKDYE---THRVSTTGEWNKLTTDSEFNK-NSKIRMIEVMLPVMDAPSSLVA 551
             L   FG  D +      V T  E +++  D ++ K ++ I ++EV L VMD P  L +
Sbjct: 566 TKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQS 625

Query: 552 QAQLTASINAK 562
                A   +K
Sbjct: 626 MVDAAAFKRSK 636

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  314 bits (804), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 213/613 (34%), Positives = 317/613 (51%), Gaps = 61/613 (9%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAY 56
           ++ I  G Y+F RL  + T ++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP----SISSQAKQL 111
           AADGY+R    +  L+TT+GVGELSALNGIAGS+AE+V VLHIVGV     S S+  K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI +A  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLDTPIDLSLKANDA-----EAEQ-EVVDDVLALIKAAKNPV 215
            Y+ +PA+  D+ V A +L+  P    +   D      E +  +++D + + + ++K P 
Sbjct: 202 GYIFVPADFADMSVAADNLVKVP---HISQQDCITYPPEVQLLDIIDKITSWMYSSKTPA 258

Query: 216 ILADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEA 275
           IL D    R+ V +   +LI  T+  +F T MGK  IDE NP + G Y G     +V + 
Sbjct: 259 ILGDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKH 318

Query: 276 VESADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNATFPGVQMKFALQ--- 331
            ES DL+L  G  +++ N G ++++YK    I++FH +YI+  +  +   QM   +    
Sbjct: 319 FESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVP 378

Query: 332 --KLLAKVGDVAK---DYKPVQVPARTPENAATAD-----STPLKQQWIWNQVGKFLQEG 381
             K L K+ DVA+    Y    V + T E     D     S+ + Q  +   +  FL  G
Sbjct: 379 VLKELYKLIDVARLSLQYDS-NVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPG 437

Query: 382 DVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI--------- 432
           DVV+ ETG+  F +    FP +   ISQ  + SI              ++          
Sbjct: 438 DVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSN 497

Query: 433 ---DPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYND 489
              D K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIER I G    YND
Sbjct: 498 VKEDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYND 557

Query: 490 IQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFN-----KNSKIRMIEVMLPVMD 544
           I  WK   L   FG  D   H  ST  E+               + ++I ++EV L V+D
Sbjct: 558 IMSWKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLD 616

Query: 545 APSSLVAQAQLTA 557
            P  L    +  A
Sbjct: 617 FPEQLKCMVEAAA 629

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  310 bits (794), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 211/626 (33%), Positives = 322/626 (51%), Gaps = 73/626 (11%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY-------EVPGMRWAGNANELNA 54
           + ITL  Y+F RL+   T ++FG+PGDFNL LL+ +Y       EV  + W G  NELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISS-QAKQLL 112
           AYAADGY+R    +  LVTTFGVGE+SALNGI G+  E+V VL+IVG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMI--TDI-----NSAPAEIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  +DI     N    +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YVSQRPVYLGLPANLVDLKVPASLL----DTPIDLSLKANDAE----AEQEVVDDVLALI 208
           ++S +P YL +P+N+ ++ V ++ L       +D +LK+  +      E ++++++  L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KAAKNPVILADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLS 268
             +K P IL D    R D + +  +LI      +F T +GK  IDE N RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 SPEVKEAVESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKIR------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   DYIKI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFALQKLLAKVGDVA------------KDYKPVQVPARTPENAATADST-PLKQQ 368
             + ++  +QKLL  + D                YK   +  ++ EN   + +   + Q 
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXX------ 422
            +  ++     +GDVV+ ETG+  F I    FP +T  I+Q  + SI             
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 423 ------XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTI 476
                        E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +F+ NN+GYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 ERLIHGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSK---- 532
           ER+  GEK  YNDI PWK ++LL  FG  +    + +T     +L    +  KN+     
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFGDHEKTFSKSTTISTVQELRCKIDELKNANPQKI 613

Query: 533 IRMIEVMLPVMDAPSSL---VAQAQL 555
           I +IEV L  MD P +L   V Q +L
Sbjct: 614 IELIEVKLGEMDIPKNLKHIVEQMKL 639

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  309 bits (791), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 199/599 (33%), Positives = 305/599 (50%), Gaps = 50/599 (8%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYA 57
           +E+ LG Y+F RL    T T+FG+PGDFN+ LL+ +Y       G++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLL---L 113
           ADGY+R    +  +VTT GVGELSALNG+AG++AEHV VLHIVGV   ++Q    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ +A  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLKV--------PASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVI 216
           L +PA++ ++KV        P  +L++ +   L+  +  A   +  ++L  +  +  P I
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAV---LERTNLAACDRIGIEILQHLYQSSTPAI 264

Query: 217 LADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAV 276
           L D  C R  +  + R+L+++T   +F T MGK  +DE  P + GVY G   S E    +
Sbjct: 265 LCDGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGA-GSKERNALL 323

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKI-RNA---TFPGVQMKFALQ 331
           +  DLIL +G +  + NT  +++ +  ++ I+E H +Y+ + RN          +   L+
Sbjct: 324 QECDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLR 383

Query: 332 KLLAKVGDVAKDYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETGTS 391
            +LA +      +       R P     A   P+ Q  + + + + L  GDV++ +TGT 
Sbjct: 384 SILAHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTF 443

Query: 392 AFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEE-----IDPK-------KRVI 439
            F +    FP     ISQ  + SI               E     + PK        R++
Sbjct: 444 QFSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLV 503

Query: 440 LFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNLDLL 499
           L  GDG+ Q+T+QE+ST +R+ L   + + NNDGYT+ER+I G    YNDI  W    LL
Sbjct: 504 LCEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLL 563

Query: 500 PTFGAKDYETHRVSTTGEWN----KLTTDSEFNKNSKIRMIEVMLPVMDAPSSLVAQAQ 554
             FG  D          ++N     L++     K SKIR++EV+L  MD  ++L   A+
Sbjct: 564 RVFGDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  302 bits (773), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 200/607 (32%), Positives = 321/607 (52%), Gaps = 59/607 (9%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAA 58
           +I  G Y+F+R+    T ++FG+PGDFNL LL+ +Y+      G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARV-KGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SISSQA---KQLLL 113
           DGY+R  +G+  L+TT+GVGELSA+NGIAG++AE+V +LHIVGV  SI SQ    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I++A  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLKVPA-SLLDTPI----DLSLKANDAEAEQEVVDDVLALIKAAKNPVILAD 219
           + +P + V++ V   +LL  P     D  L+ +      ++ + +L  I ++K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESA 279
               R+       + I +T+  +F T  GK  I+EQNP + G+Y G   +  V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNA------TFPGVQMKFALQK 332
           DLI++VG  +++ N G +++SY+    ++E H  YI++ +        F G+     L++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLAKVGDVAK---DYKPV------QVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDV 383
           +L K+ D+ +   DY P        +  + P  +A  DS  + Q ++   V  +L +GDV
Sbjct: 384 MLIKI-DIKRFDFDYDPSVTKFDPTIELKFP--SADPDSNKITQNFLAQNVPDYLNDGDV 440

Query: 384 VITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK-------- 435
           ++ ETG   F       P++   I+Q  + SI              ++  P+        
Sbjct: 441 LVVETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIP 499

Query: 436 ----KRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQ 491
                R+IL  GDG+ Q+TVQE+S+ +R+ +   + +LNNDGYTIER I G    YNDI 
Sbjct: 500 ETYNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIM 559

Query: 492 PWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKN----SKIRMIEVMLPVMDAPS 547
            W    +    G  D +    +T    +KL    +  KN    +KI  IEV+L V+D P 
Sbjct: 560 AWNWTKIFEALGDFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPE 619

Query: 548 SLVAQAQ 554
            L +  +
Sbjct: 620 QLKSMVE 626

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 196/597 (32%), Positives = 301/597 (50%), Gaps = 50/597 (8%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEV----PGMRWAGNANELNAAYAA 58
           +I LG+YLF+R+    T +IFG+PGDFNL LL+ +YE      G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTL 117
           DG++R    +  L+TT+GVGELSALNG+AG++AE+V +LHIVGV   S++ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLP 168
            N   + F R         +   +  +   + +I+ A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLKVPASLLDTP-IDL--SLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSR 224
            + V +L    +LL TP IDL  SL   D     EV   +   I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILS 284
           +D        I +T+  +F T  GK  IDE NP + G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNAT------FPGVQMKFALQKLLAKV 337
            G  +++ N G +++ YK    IVE H  Y++  +        F G+   F L++L+ ++
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 G--DVAKDY-----KPVQVPARTPENAAT-ADSTPLKQQWIWNQVGKFLQEGDVVITETG 389
              +    Y     K      +TPE+    A+++ + Q  +   +  +L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPKK 436
           +  F +     P +   +SQ  + SI              ++              + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKNL 496
           R+IL  GDG+ Q+TVQE+++M+R+ +   + + NN+GYT+ER I G    YNDI PW   
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 DLLPTFG---AKDYETHRVSTTGEWNKLTTDSEFNKNSK-IRMIEVMLPVMDAPSSL 549
            L   FG    K   +  + TT +        +   N   I M+EV L VMD P  L
Sbjct: 567 KLFAAFGDFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPHQL 623

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  289 bits (739), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 204/620 (32%), Positives = 319/620 (51%), Gaps = 89/620 (14%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY---------EVPGMRWAGNANELNA 54
           IT G Y+F+RL  + T ++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSI----SSQAK 109
           AY+ADGY+R    ++ L+TTFGVGELSA+NG++GS+AE++ VLHIVGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLKVPA-SLLDTP---IDLSLKANDAEAE------QEVVDDVLALIKA 210
           RP YL +P+N  D+ V   +L+D P   +D +L  N  ++       +++   +L ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSP 270
           ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE N  + G+Y G  S+ 
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 EVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI--------RNATF 321
           +V E  E++DL+L  G   ++ NTG +S+SY     +++ +  Y+++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFALQKLLAKVGDVAK---DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFL 378
             V     L++LL  + D++K    Y+P+              +T +KQ+ I N  GK  
Sbjct: 383 RDVNFLHILKQLLKDI-DLSKLNFKYQPL--------------ATRVKQETIENSDGKIT 427

Query: 379 QE------------GDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXX 426
           Q             GD+++ +TG   F I    F ++   I+Q  + SI           
Sbjct: 428 QASLGQAFPSTFNPGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVG 487

Query: 427 XXXEEID----------PKK---RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
              ++            PK    R+IL  GDG+ Q+TVQE+STM+R  +   +++ NNDG
Sbjct: 488 VAMQDYPLEHVYDKSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDG 547

Query: 474 YTIERLIHGEKAQYNDIQPWKNLDLLPTFGAKDYE-THRVSTTGEWN---KLTTDSEFNK 529
           YTIER I G    YNDI  W    LL +FG  + + T+ V+   + +   KL    E + 
Sbjct: 548 YTIERAIMGPTRSYNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDN 607

Query: 530 NSKIRMIEVMLPVMDAPSSL 549
           N  I  +EVML  +D P  L
Sbjct: 608 NKCIEFMEVMLGKVDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  287 bits (735), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 197/605 (32%), Positives = 307/605 (50%), Gaps = 54/605 (8%)

Query: 3   EITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPG---MRWAGNANELNAAYAAD 59
           +I LG YL  RL  + + + FG+PGDFNL LL+ +Y   G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSISSQAKQLL---LH 114
           GY+R    +  L+TT+GVGELSA+NGI GSYAE++ +LHIVGV P+  S+ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI ++  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLKVPA-SLLDTP-IDLSLKANDAEAEQ--EVVDDVLALIKAAKNPVILADAC 221
            +P++  +  V + +L++ P I+LS   N    E+   + ++++ LI  +++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 CSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADL 281
             R          I +T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKIRNAT---------FPGVQMKFALQ 331
            L  G  +++ N+G++S+ + K   I+E + +Y+KI             +P V M   L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLAKVG--DVAKDYKPVQVPARTPENA---ATADSTPLKQQWIWNQVGKFLQEGDVVIT 386
            L+AKV   D   +Y        T E        D   + Q  +  ++  FL  GDV++ 
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVLPLQQEDEEKITQVHLQRELPNFLNPGDVLVC 435

Query: 387 ETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK----------- 435
           ETG+  F +    FP+    ISQ  + SI              ++  PK           
Sbjct: 436 ETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDHSLARN 494

Query: 436 --KRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPW 493
              R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NN+GYT+ER I G    YNDI PW
Sbjct: 495 YTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDIMPW 554

Query: 494 KNLDLLPTFGAKDYETHRVSTTGEWNKLTTD----SEFNKNSKIRMIEVMLPVMDAPSSL 549
               LL   G  + E +R  T  + ++L+       E   N+ I++IEV L   D P  L
Sbjct: 555 NWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIPRQL 614

Query: 550 VAQAQ 554
               Q
Sbjct: 615 DFMVQ 619

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  285 bits (730), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 187/610 (30%), Positives = 304/610 (49%), Gaps = 66/610 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           + LG YL+ +L Q+ T TIFG+PGDFNLSLL+ +Y    +  G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLG 118
           GY+R    +  +VTT+GVGELSALNGIAG++AE++ +LH+VGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPA 169
              ++        V+  M +  +    A ITD+N A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLKVPASLLDTPIDLSLKANDAEAEQEVV--------------DDVLALIKAAKNPV 215
           +  D  +P S     ++  L   D    +E+V              D +L+L+ ++K P 
Sbjct: 206 DFQDALIPIS-----VNEHLSREDIMPIEEIVEIPLLPSLEMVSVCDYILSLLYSSKTPC 260

Query: 216 ILADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEA 275
           I+ D    R  V  +   LI  T+  +F T M KG ++E NP + GVY G LS   + + 
Sbjct: 261 IIGDILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKK 320

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKIRNATFPGVQMKFALQKLL 334
           ++  DLI+  G + ++ NTG +S++YK  ++ ++ H DY++I       ++  +   +  
Sbjct: 321 IQMCDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQH-NIRTDYKGIEFR 379

Query: 335 AKVGDVAKDYKPVQVPAR-----TPENAA------TADSTPLKQQWIWNQVGKFLQEGDV 383
             V  V K  +P  +        +P + A        +  P+   ++   + +++  GDV
Sbjct: 380 TFVDMVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINPGDV 439

Query: 384 VITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEE------------ 431
           V+ ETG+  F +  +   +    I+Q  + SI               +            
Sbjct: 440 VVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSH 499

Query: 432 --IDP--KKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQY 487
             + P  K R+IL  GDG+ Q+TVQEI+ ++++ +   + +LNN GYTIER I G   ++
Sbjct: 500 SNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEF 559

Query: 488 NDIQPWKNLDLLPTFGAKDYETHR----VSTTGEWNKLTTDSEFNKNSKIRMIEVMLPVM 543
           NDI  W    LL   G    ET       STT  + KL    ++        +EV+L  +
Sbjct: 560 NDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKL 619

Query: 544 DAPSSLVAQA 553
           + P++L+  A
Sbjct: 620 NIPTTLIKMA 629

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  284 bits (726), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 195/602 (32%), Positives = 307/602 (50%), Gaps = 58/602 (9%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE-----VPG-MRWAGNANELNAA 55
           + I  G+Y+F RL+   T ++FG+PGD+NL+LL+++Y+      P  ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLH 114
           YAADGY+R    +  L+TT+GVGELSA+NGIAG++ E+V +LHIVGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPVYL 165
           H + N +        + +   M  N IS +T  + +I +A  + D  +R  + + +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLKVP---------ASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVI 216
            +P    +L V           +L D+ I   +  +  +   ++  D   LI  +K P I
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKD---LIYQSKRPAI 272

Query: 217 LADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAV 276
           + D    R        +LI  T   +F T MGK  I+E N  + G++ G     EV + +
Sbjct: 273 IGDILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKI 332

Query: 277 ESADLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-- 331
              DLIL  G   ++ N+G ++   Y  K   I+EFHS+YIKI++ +   V +   L   
Sbjct: 333 RQCDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFI 392

Query: 332 ---KLLAKVGDVAK---DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVI 385
              K L K+ D +K   DY  +    +T  +     +  + Q +I + + K L  GD+++
Sbjct: 393 HVLKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILL 452

Query: 386 TETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEE------------ID 433
            +TGT  F +     P +   ISQ  + SI              ++            I 
Sbjct: 453 CDTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIK 512

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPW 493
            + ++IL  GDG+ Q+T+QEIST++R+ +   +F+ NNDGYTIER I G    YNDIQPW
Sbjct: 513 TQPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPW 572

Query: 494 KNLDLLPTF--GAKDY-ETHRVSTTGEWNKLTT---DSEFNKNSKIRMIEVMLPVMDAPS 547
               L+ +F    K + +T++V+   E+  L T    + FN++S +  IEV L  +D P 
Sbjct: 573 NWTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPH 631

Query: 548 SL 549
            L
Sbjct: 632 IL 633

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  278 bits (711), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 193/602 (32%), Positives = 308/602 (51%), Gaps = 58/602 (9%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAY 56
           +  I  G Y+FERL      +IFG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYAR-VKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSISSQAKQLL-- 112
           AADGY+R    +  ++TT+GVGELSALNG+AG++AE V VLHI+GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVY 164
            +HH +   D          F  +   +  ++A + DIN+A   +D+ I     + +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLKVP-ASLLDTPI---DLSLKA-NDAEAEQEVVDDVLALIKAAKNPVILAD 219
           + +P +  D  V   +L+  PI   D  +++  D  A +   D +L  I  +  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESA 279
               R +++ E R+ I+     ++ T MGK ++DE+NP++ G+Y G  +  E++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEFHSDYIKIRNATFPGVQMKFALQ 331
           DLIL  G   ++ N G +S+ +         + NI++F    IK +NA+        ++ 
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSVL 386

Query: 332 KLLAKVGDVAK---DYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITET 388
           K +    D +K    Y PV    ++  +    ++  + Q+ +   +  +  +GDV+I ET
Sbjct: 387 KYVNDNLDKSKLSFSYPPV---PKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVET 443

Query: 389 GTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX----------XXXXXXEEIDPKK-- 436
           G+  FG+    F  +   I+Q  + SI                        + + PK   
Sbjct: 444 GSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYI 503

Query: 437 -RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPWKN 495
            R+IL  GDG+ Q+T+QE ++ +R+ +   + V NN+GYT+ER I+G    YNDI P+K 
Sbjct: 504 PRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKW 563

Query: 496 LDLLPTFGAKDYETH-RVSTTGEWNK-----LTTDSEFNKNSKIRMIEVMLPVMDAPSSL 549
             LL  FG  D+E     S T E N      L       + + I++ EVMLPVMD P  L
Sbjct: 564 TALLNVFG--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQEL 621

Query: 550 VA 551
            A
Sbjct: 622 NA 623

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  276 bits (705), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 193/609 (31%), Positives = 304/609 (49%), Gaps = 64/609 (10%)

Query: 2   SEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVP-------GMRWAGNANELNA 54
           ++I  G Y+F+RL  V   +IFG+PGD+N+ LL+ +Y+          + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVG-----VPSISSQA 108
           AYAADGY+R    +  ++TT+GVGEL A++G+AG++AE V VLHIVG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVS 159
           +   LHH L           D+ V+  M  + ++ +   + D+ +A  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVD-LKVPASLLDTP---IDLSLKANDAEAEQEVVDDVLALIKAAKNPV 215
            +P YL +P + VD L    +L++ P   +   ++ +  +  + V + +L L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEA 275
           ++ D    R+ ++ E    I+      F T  GK  IDE +P + G Y G  S+P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQM-- 326
           + + DL+L  G   ++ N G++++ +K+   IVE H  YI+  + T      + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 327 -------KFALQKLLAKVGDVAKDY--KPVQVPARTPENAATADSTPLKQQWIWNQVGKF 377
                     L +L  +     K Y  + + +  R   N  T+D T   Q  +   +  +
Sbjct: 420 ILDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDIT---QGTLQKSMPNY 476

Query: 378 LQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI----- 432
           L  GDV+I++TGT  F I     P++   I+Q  + SI               +      
Sbjct: 477 LNPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHV 536

Query: 433 -DPKK-------RVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEK 484
            D +K       +VILF GDG+ Q+TVQE+STM+R  +   +F+ NN+GYTIER+I G  
Sbjct: 537 WDVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPT 596

Query: 485 AQYNDIQPWKNLDLLPTFGAKDYETHRVST----TGEWNKLTTDSEFNKNSKIRMIEVML 540
             YNDIQPWK   LL  FG  D +  R +     +   NKL+     +    I  +EV L
Sbjct: 597 RPYNDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKL 656

Query: 541 PVMDAPSSL 549
             MD PS L
Sbjct: 657 ATMDVPSQL 665

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 186/576 (32%), Positives = 292/576 (50%), Gaps = 39/576 (6%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEV--PGMRWAGNANELNAAYAA 58
           MS + LG YLF RL QV T T+FG+PGDFNL+LL+ +Y      ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLL---HH 115
           DGY+R+      +TT+GVGELSALN ++G++AE+  VLHIVG  S+ ++     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMITDIN--SAPAEIDRCIRTTYVSQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D N      +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLKVPASL---LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSR 224
           P+NL D ++P  L   L+      L+  D  A  E+V   L  I +++NP  + D    R
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRV-DPHATSEMVSLTLKRIYSSRNPGFIVDQFM-R 237

Query: 225 HDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILS 284
            D+ ++    ++   F  + T   +G  DE  P F GV+   LS+    E ++  D IL 
Sbjct: 238 FDL-EKLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILH 296

Query: 285 VGALLSDFNTGSF----SYSYKTKNIVEFHSDYIKI--RNATFPGVQMKFALQKLLAKVG 338
           +G   ++ N  S+    S     K+++    DY ++        G+      ++LL ++ 
Sbjct: 297 LG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMN 353

Query: 339 DVAKDYKPVQVPARTP--ENAATA--DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFG 394
             +K    V+    T    N  T   DS  + Q  +   V   L+E DV+I E  +  F 
Sbjct: 354 --SKTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFE 411

Query: 395 INQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEI 454
           +    +      + Q  +GSI              ++     RVILF GDGS Q+T+QE+
Sbjct: 412 MPNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQEL 471

Query: 455 STMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYND-IQPWKNLDLLPTFGAKDYE---TH 510
           ++ +R+ + P +F+LNN GY++ER+I G    YND I  W   ++L  FG ++ +   ++
Sbjct: 472 ASYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSY 531

Query: 511 RVSTTGEWNKLTTDSEFNKNSKIRMIEVMLPVMDAP 546
           +V   GE   + T      + KI+M+E++L  MD P
Sbjct: 532 KVEKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  238 bits (607), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/565 (28%), Positives = 263/565 (46%), Gaps = 19/565 (3%)

Query: 5   TLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL Q      F +PGD+NL LLDK+ E P +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+AA+V TF VG  SA NGI  +Y E++ V+ I G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTP 184
            + M+  I+     I     AP+ ID  IR     ++P Y+ +P N+      +++   P
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMA-----SAICAPP 177

Query: 185 IDLSLKANDAEAEQEV----VDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240
             +S   N     ++V    V+  +  I +   P +LA       D +    +L +  + 
Sbjct: 178 GPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKC 237

Query: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
              V P  K    E +P+F GVY G +S+ +    +E +DL +  G + +D++T  ++  
Sbjct: 238 AVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTAL 297

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360
             + + +E  +D ++    +F  + +   L  L  +V +  K         ++P     A
Sbjct: 298 QPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAA 357

Query: 361 D-STPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXX 419
           D    + ++ +  Q+ + +     +  ETG S F   Q   P       ++ WG I    
Sbjct: 358 DPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSV 417

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERL 479
                         P +R+I  +GDGS Q+T QE+S MVR      +F++NN GYTIE  
Sbjct: 418 PASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVE 473

Query: 480 IHGEKAQYNDIQPWKNLDLLPTFGAKD--YETHRVSTTGEWNKLTTDSEFNKNSKIRMIE 537
           IH     YN+I+ W    L+  F A +   +  +  T GE       ++ N  S   +IE
Sbjct: 474 IH--DGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPTLIE 530

Query: 538 VMLPVMDAPSSLVAQAQLTASINAK 562
           + +   D  + L+      A  NA+
Sbjct: 531 IQINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  236 bits (601), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/566 (28%), Positives = 266/566 (46%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL +V     F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+AA+V TF VG  SA NGI  +Y E++ V+ I G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDAEAE--QEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
           I+  L  + +E +     VD    LI +   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E +P++ GVY G +S+ +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAK---DYKPVQ-VPARTPENAA 358
             + +E  SD +K  +  +  +++   L  L  KV    K   +Y+ ++ VP   P   A
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP---PAIKA 357

Query: 359 TADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXX 418
              S  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG I   
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 XXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIER 478
                          P + ++  +GDGS Q+TVQE++ M+R      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEKAQYNDIQPWKNLDLLPTFGAKD--YETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
            IH     YN+I+ W    L+  F A D   +  +V T  E ++    ++ N      +I
Sbjct: 474 EIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAKSNTRGPT-LI 530

Query: 537 EVMLPVMDAPSSLVAQAQLTASINAK 562
           E+ +   D  + L++     A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  235 bits (599), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 164/566 (28%), Positives = 265/566 (46%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL +V     F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+AA+V TF VG  SA NGI  +Y E++ V+ I G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDAEAE--QEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
           I+  L  + +E +     VD    LI +   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E +P++ GVY G +S+ +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAK---DYKPVQ-VPARTPENAA 358
             + +E  SD +K  +  +  +++   L  L  KV    K   +Y+ ++ VP   P   A
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP---PAIKA 357

Query: 359 TADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXX 418
              S  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG I   
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 XXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIER 478
                          P + ++  +GDGS Q+TVQE++ M+R      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEKAQYNDIQPWKNLDLLPTFGAKD--YETHRVSTTGEWNKLTTDSEFNKNSKIRMI 536
            IH     YN+I+ W    L+  F A D   +  +V T  E  +    ++ N      +I
Sbjct: 474 EIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAKSNTRGPT-LI 530

Query: 537 EVMLPVMDAPSSLVAQAQLTASINAK 562
           E+ +   D  + L++     A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  233 bits (595), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 175/554 (31%), Positives = 275/554 (49%), Gaps = 57/554 (10%)

Query: 58  ADGYARVKG-MAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SISSQAKQLL--- 112
           ADG++R    +  L+TT+GVGELSALNGIAG+++E+V VLHIVGV  S+ S+++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDINSAPAEIDRCIRTTYVSQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DIN+A  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLKV-PASLLDTPIDLSLKANDAEAEQEVVDD----VLALIKAAKNPVILA 218
           Y+ +P +  D+ V P++L   P +++L+   + A   VVD+    VL  I  +K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVES 278
           D  C R         LI +T   +F T MGK  IDE N  + G+Y G  S   V E    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMKFALQ 331
           +DL+L  G  + + N G ++ +YK    ++EFHS+YI+  +A+      F GV     L+
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLAKVGDVAKDYK---PVQVPARTPENAAT--ADSTPLKQQWIWNQVGKFLQEGDVVIT 386
           +L+  +     +++    ++  A    N  T   + T + Q ++   V  +L  GDV++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------- 432
           ETG+  F I     P++   I+Q  + SI              ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYND 489
              D + R+IL  GDG+ Q+T+QE+++MVR+ +   + +LNN+GYTIER I G    YND
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQPWKNLDLLPTFGAKDYETHR-VSTTGEWN-----KLTTDSEFNKNSKIRMIEVMLPVM 543
           +  W    LL  FG  D++  R VS   E       KL       K + I ++E+ L  M
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAPSSLVAQAQLTA 557
           D P  L +     A
Sbjct: 540 DFPKQLQSMVDAAA 553

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 123/529 (23%), Positives = 195/529 (36%), Gaps = 108/529 (20%)

Query: 7   GRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G+   E +++   +T+FG PG   L++ D IY      +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  MAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVF 125
              +V  T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 196

Query: 126 H--RMSANISETTAMITDINSAPAEIDRCIRTTYVSQR--PVYLGLPANLVD--LKVPAS 179
               +S + ++   M+  +   P  I+       VS R  PV + LP ++    LK P  
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILKTPIP 255

Query: 180 LLDT-PIDLSLKANDAEAEQEV---VDDVLALIKAAKNPVI-LADACCSRHDVKDETRKL 234
           +  T P D   K   A A++     +  V  LI  AK P++ +      R D     R+L
Sbjct: 256 VNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKLLRQL 315

Query: 235 IDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSD--- 291
            D  Q P   T  G G+ D+++P+   + +G   S     +V++ADLI+++GA   D   
Sbjct: 316 ADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDDRVT 374

Query: 292 FNTGSFS----------------YSYKTKNI-------VEFHSDYIKIRNATFPGVQMKF 328
            N   F+                +    KNI       V    D         P V    
Sbjct: 375 LNVSKFAPEARQAALENRGGIVHFEISPKNINKVVEAQVAVEGDVTDNLELLLPMVNKVE 434

Query: 329 ALQKLLAKVGDVAKDY-------------KPVQVPARTPENAATADSTPL---------- 365
             ++ L ++    K+Y             KP  V AR  E A+      +          
Sbjct: 435 ERKEWLGQIDAWKKEYPYDYQRETKGSLIKPQTVIARLSEIASGTGREVIVTTGVGQHQM 494

Query: 366 --KQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXX 423
              Q W W     F       IT  G    G          YG+   +   +        
Sbjct: 495 WAAQHWTWRHPRSF-------ITSGGLGTMG----------YGLPAAIGAQVA------- 530

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNND 472
                     P   VI   GD S  +T+ E+S+ V+ G    + VLNN+
Sbjct: 531 ---------KPDALVIDIDGDASFNMTLMELSSAVQAGAPVKILVLNNE 570

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 72.0 bits (175), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDG 445
           TETG S    NQ+      + ISQVLW  I              E+IDP  R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATLSA----EDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMVRWGLKPYLFVLNNDGYTIE 477
            L LTVQE+ T +RW LKPYLFV NND   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 139/309 (44%), Gaps = 21/309 (6%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +T G    E +++ + +T+FG PG   L + D IY     ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARVKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLG 118
           YAR  G   +V  T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVD--LK 175
                    +S + ++   M+  ++  P  I+         +  PV + LP ++    LK
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVLK 281

Query: 176 VPASLLDTPIDLSLKANDAEAEQ-----EVVDDVLALIKAAKNPVILADA-CCSRHDVKD 229
            P  +L+  +  +  +N  +  Q     E + +   LI  AK PVI A A   S  +   
Sbjct: 282 NPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGPT 341

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALL 289
             ++L + +Q P   T    G+ D+Q+P+   + +G   S     A+++ADLI+++G   
Sbjct: 342 LLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLIIALGGRF 400

Query: 290 SDFNTGSFS 298
            D  TG+ S
Sbjct: 401 DDRVTGNIS 409

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 136/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRH-DV 227
           L  PI             L+ +A D E   + ++    LI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQD-EFVMQSINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGA 287
               ++L D  Q P   T  G GS D+++P+   + +G         AV++ADLI++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGA 375

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 376 RFDDRVTGNIS 386

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 136/300 (45%), Gaps = 18/300 (6%)

Query: 7   GRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G+   E +K+ + +T+FG PG   L + D IY     ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGDFTV 124
              +V  T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVD--LKVPASLL 181
              +S + ++   M+  +   P  I+         +  PV + LP ++    L+ P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 DT-PIDLSLKANDAEA-EQEVVDDVLALIKAAKNPVI-LADACCSRHDVKDETRKLIDIT 238
            T PI   LK+   EA   E ++    LI  AK PV+ + +   +  D     ++L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFS 298
           Q P   T  G G+ D+++P+   + +G         A+++ADL++++GA   D  TG+ +
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTGNIA 384

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 118/522 (22%), Positives = 195/522 (37%), Gaps = 94/522 (18%)

Query: 7   GRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G+   E +++   NT+FG PG   L++ D IY      +    +E  A + A+GYARV G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  MAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVF 125
              +V  T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 195

Query: 126 H--RMSANISETTAMITDINSAPAEIDRCIRTTYVSQR--PVYLGLPANLVD--LKVPAS 179
               +S + ++   M+ ++   P  I+       VS R  PV + LP ++    L+ P  
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILRTPIP 254

Query: 180 LLDTPIDLSLKANDAEAEQEV----VDDVLALIKAAKNPVI-LADACCSRHDVKDETRKL 234
           +  T    +L      A +E     +     LI  AK P+I +      +       R+L
Sbjct: 255 VKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPKLLREL 314

Query: 235 IDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNT 294
            +  Q P   T  G G+ D+++P+   + +G   S     +V++ADLI+++GA   D  T
Sbjct: 315 AERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDDRVT 373

Query: 295 -------------------GSFSYSYKTKNI-------VEFHSDYIKIRNATFPGVQMKF 328
                              G   +    KNI       V    D         P V    
Sbjct: 374 CNVAKFAPEARKAALENRGGIIHFEISPKNINKVVEAQVAVEGDVTDNLERLIPLVNNVK 433

Query: 329 ALQKLLAKVGDVAKDY-------------KPVQVPARTPENAATAD-----STPLKQQWI 370
             ++  A++    K+Y             KP  + AR  E A++       +T + Q  +
Sbjct: 434 ERKEWFAQIDAWKKEYPYDYQRETKDSKIKPQTLVARLSEVASSTGRDVIVTTGVGQHQM 493

Query: 371 WNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXE 430
           W       +     IT  G    G          YG+   +   I               
Sbjct: 494 WAAQHWTWRHPRTFITSGGLGTMG----------YGLPSAIGAQIAR------------- 530

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNND 472
              P   VI   GD S  +T+ E+S+ V+ G    + VLNN+
Sbjct: 531 ---PDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNNE 569

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 138/309 (44%), Gaps = 28/309 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +TIFG PG   L + D I++    ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTY---VSQR--PVYLGLPANLV---- 172
                 +S + ++   M+  ++  P    RCI   +   +S R  PV + LP ++     
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKDVTAAIL 260

Query: 173 --DLKVPASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADA-CCSRHDVKD 229
              + V ++L  + +    K    E   E ++   ALI  AK PV+   A   +  D   
Sbjct: 261 RNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNNVDGPR 320

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALL 289
             ++L D  Q P   T  G G+ D+++P+   + +G         AV++ADL++++G   
Sbjct: 321 IIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIALGTRF 379

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 380 DDRVTGNIT 388

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 135/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + + +T+FG PG   L + D IY     ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V A++
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LDTPIDLS-----------LKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKD 229
           L  PI ++           +K    E  +E +    +LI  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGAL 288
              R+L +  Q P   + +G G+ D+++P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 134/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI--DLSLKAN---------DAEAEQEVVDDVLALIKAAKNPVILADACCSRH-DVK 228
           L  PI    +L +N           E   + ++    LI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 DETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGAL 288
              ++L    Q P   T  G GS D+++P+   + +G         A+++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 139/309 (44%), Gaps = 28/309 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D IY+    ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MI ++   P  I+      T     PV + LP ++      A L
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKDV----TAAIL 253

Query: 181 LDT-PIDLSLKAN-----DAEAEQEVVDDVLA----LIKAAKNPVI-LADACCSRHDVKD 229
            D  P+  SL +N       +A+ E V D +     LI  AKNPV+ +        D   
Sbjct: 254 RDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGPK 313

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALL 289
             ++L +  Q P   + +G G+ D+++P+   + +G         A+++ADLI+++G   
Sbjct: 314 LLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTRF 372

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 373 DDRVTGNIA 381

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 133/307 (43%), Gaps = 23/307 (7%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVDLKVPASL 180
                 +S + ++   M+ ++   P  I+         +  PV + LP + V   V    
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKD-VTAAVLREA 266

Query: 181 LDTPIDLSLKANDAEAEQEVVDDVLA--------LIKAAKNPVI-LADACCSRHDVKDET 231
           + T   L      A     V D+ LA        LI  AK PV+ + +   +  D     
Sbjct: 267 IPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDGPRLL 326

Query: 232 RKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSD 291
           ++L D  Q P   T  G G+ D+++P+   + +G         A+++ADLI++VGA   D
Sbjct: 327 KELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARFDD 385

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 386 RVTGNIT 392

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 136/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+     ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+ ++   P  I+   +  T     PV + LP +     V A++
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LDTPIDLSLKANDAEAEQ-----------EVVDDVLALIKAAKNPVI-LADACCSRHDVK 228
           L TPI +         +Q           E +     LI  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 DETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGAL 288
              ++L +  Q P   T  G G+ D+++P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 367 FDDRVTGNIT 376

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 109/497 (21%), Positives = 199/497 (40%), Gaps = 58/497 (11%)

Query: 9   YLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           Y    L+    +T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL GI  S +    +L + G    SS+A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSANISETTAMITDINSAPAEI---DRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTP 184
           +S  +         +NS+  ++   D      Y +    YL +P NL+   V    L   
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSLPPV 171

Query: 185 IDLSLKAN--DAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
            ++ +  +  D  A QEV D    LI+     V++     + H    E R+ +D  Q P 
Sbjct: 172 KNIYVPKSSPDPSAVQEVTD----LIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLPF 226

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS---------DFN 293
             TPMGKG + + +P         +SS   + A++ A ++L +GA L+          +N
Sbjct: 227 LPTPMGKGVVPDSHPL-------NVSSARSR-ALQEAKVVLVLGARLNWILHFASAPKWN 278

Query: 294 TGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPART 353
             +      +      H+++ K ++ +  G  +   ++ + A +GD         + +  
Sbjct: 279 PDALFIQVDSDTTTLGHNNF-KSQHLSLWG-DIGLTVRLITASLGDYHSQGLSPSLQSNI 336

Query: 354 PENAATADSTPLKQ-------QWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYG 406
             NAA   S   +Q         ++  +   + +   +I   G +     +  FP   Y 
Sbjct: 337 ARNAAKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTD-YP 395

Query: 407 ISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYL 466
           + ++  G+               +  +P K V++  GD +   +  +I T  R GL   +
Sbjct: 396 LQRLDAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALIV 454

Query: 467 FVLNNDGYTIERLIHGE 483
            V+NN G     + HG+
Sbjct: 455 IVMNNGG-----IYHGQ 466

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 137/307 (44%), Gaps = 30/307 (9%)

Query: 7   GRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G+   E +K+ + +T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  MAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGDFTV 124
              +V  T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVDLKVPASLLDT 183
              +S + ++   M+  +   P  I+         +  PV + LP +     V A++L  
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILRE 257

Query: 184 PIDL-------SLKANDAEAEQEVVDDVLA----LIKAAKNPVI-LADACCSRHDVKDET 231
           PI +       +L    + A+++ + D +     LI  AK PV+ + +   +  D     
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLYVGNGIFNNEDGPRLL 317

Query: 232 RKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSD 291
           ++L +  Q P   T  G G+ D+++P+   + +G         A+++ADLI++VGA   D
Sbjct: 318 KELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARFDD 376

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 377 RVTGNIA 383

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 131/307 (42%), Gaps = 38/307 (12%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E +K+ + +T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTY---VSQR--PVYLGLPANLVDLKV 176
                 +S + ++   M+  I   P    +CI   +    S R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLP----KCINEAFEIATSGRPGPVLVDLPKD-----V 255

Query: 177 PASLLDTPIDLS----------LKANDAEAEQEV-VDDVLALIKAAKNPVI-LADACCSR 224
            AS+L TPI +           L  N      EV +     LI  AK P++ +     + 
Sbjct: 256 QASILKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNN 315

Query: 225 HDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILS 284
            +     ++L D  Q P   T    G+ D+++P+   + +G         A+++ADLI++
Sbjct: 316 PEGPRLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIA 374

Query: 285 VGALLSD 291
           VGA   D
Sbjct: 375 VGARFDD 381

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 130/304 (42%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRH-DV 227
           L  PI             L+ +  D    Q  ++    LI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQN-INKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGA 287
               ++L D  Q P   T  G G+ D+++P+   + +G         AV++ADL+++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGA 375

Query: 288 LLSD 291
              D
Sbjct: 376 RFDD 379

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 136/310 (43%), Gaps = 32/310 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVDLKVPASL 180
                 +S + ++   M+ ++   P  I+         +  PV + LP +     V A++
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LDTPI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVI-LADACCSRHDV 227
           L  PI            +L    +DA   +E ++    LI  AK PV+ +     +  + 
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDA-FTKERIEKAAKLINIAKKPVLYVGGGILNNPEG 308

Query: 228 KDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGA 287
               + L D  Q P   T  G G+ D+++P+   + +G   S     ++++ADLI+++G 
Sbjct: 309 PKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLSIQNADLIIAIGT 367

Query: 288 LLSDFNTGSF 297
              D  TG+ 
Sbjct: 368 RFDDRVTGNL 377

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 122/522 (23%), Positives = 203/522 (38%), Gaps = 95/522 (18%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T   Y    LKQ + +T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  VKGM-AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           + G  A L+   G G + AL GI  S +    ++ I G  S +S+  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPV---YLGLPANLVD--LKVP 177
               ++S  +++       +NS            +  Q P+   Y+  P NL++   KV 
Sbjct: 119 QDLDQVSL-LNKYVKYTVKLNSINIPTALFNAYNFAIQSPMGVTYIDFPGNLIEGNYKVQ 177

Query: 178 ASLLDTPIDLSLKANDAEAEQEVVDDVLALI--KAAKNP-VILADACCSRHDVKDETRKL 234
           A     P+ +  +      +   V++V  LI   ++ N  VIL       H    +  K 
Sbjct: 178 AQPATNPVSIPRRVR-CSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFH---KDINKF 233

Query: 235 IDITQFPSFVTPMGKGSI-DEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFN 293
           I+    P   TPM KG + D  N          +SS   K A++ A+++L +GA L+   
Sbjct: 234 INTFNLPFLPTPMAKGILPDSHNL--------NVSSARSK-ALKDANIVLVLGARLNWIL 284

Query: 294 TGSFSYSYKTKNI-VEFHSD--YIKIRNATFPGVQMKFALQKLLAKVGD----------- 339
               S  +  K I ++  +D   + + N T   + +   L   +  + D           
Sbjct: 285 HFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNWKY 344

Query: 340 ---VAKDYKPV----QVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETGTSA 392
              ++ + + +    Q   +  E     D   L    ++  + K + E   V+   G ++
Sbjct: 345 EKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGANS 404

Query: 393 FGINQSHFPNKT------------------YGISQVLWGSIXXXXXXXXXXXXXXEEIDP 434
             I +  FP+                    YGI+  L                   E+  
Sbjct: 405 MDIARISFPSSVPKQRLDAGTNATMGIGLGYGIAACL------------------NELRN 446

Query: 435 KKR---VILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
            KR   VIL  GD +   +  EI T VR+ L   + V+NN G
Sbjct: 447 GKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 136/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++   +T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
             G   +V  T G G  + +  +A + A+  GV  +V    +S+ A        +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPMVVFTGQVSTTA--------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   M+  I   P  I+      T     PV + LP +     V A+
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 180 LLDTPIDL-SLKANDA--EAEQEVVDDVLA--------LIKAAKNPVILADACCSRHDVK 228
           +L  PI   S   +DA  +  +  VD+           LI  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 DE-TRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGA 287
            +  ++L +  Q P   T  G G+ D+++P+   + +G   S     AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 116/512 (22%), Positives = 204/512 (39%), Gaps = 70/512 (13%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E +++   +TIFG PG   L + D IY     ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LDTPIDL--SLKAND-AEAEQEVVD--------DVLALIKAAKNPVILADACCSRHDVKD 229
           L +PI +  +L +N   E  + VVD        +   LI  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-RKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGAL 288
           +  ++L +  Q P   T  G G+ D+ +P+   + +G   S     A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFS-YSYKTKN--------IVEFHSDYIKIRNATFPGVQMKFALQKLLAKV-- 337
             D  TG+ + ++ + +         IV        I       V ++  +   LAK+  
Sbjct: 379 FDDRVTGNVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDAQVAVEGDVTANLAKILP 438

Query: 338 ------------GDVA--KDYKPVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDV 383
                       G +   K+  P      TP++     +   +   I N  GK     DV
Sbjct: 439 LIDPVETRPEWLGQIYKWKEQYPYAYQKETPDSGIKPQTVIARLSEISNSTGK-----DV 493

Query: 384 VITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXX----XXXXXEEIDPKKRVI 439
           ++T       G+ Q       +   +  W  I                  +   P   VI
Sbjct: 494 IVTT------GVGQHQMWAAQHWQWKKPWSFITSGGLGTMGFGLPAAIGAQVARPNALVI 547

Query: 440 LFIGDGSLQLTVQEISTMVRWGLKPYLFVLNN 471
              GD SL +T+ E+ST V+ G    + +LNN
Sbjct: 548 DIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 134/303 (44%), Gaps = 30/303 (9%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   M+  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI--DLSLKAN-----DAEAEQEVVDDVLA----LIKAAKNPVILADA-CCSRHDVK 228
           L  PI    +L +N      + A+ E V   ++    LI  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 DETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGAL 288
              ++L +  Q P   T  G GS D+++P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 133/305 (43%), Gaps = 34/305 (11%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I++     +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR--PVYLGLPANLVDLKVPAS 179
                 +S + ++   M+  I   P  I+       VS R  PV + LP +     V A+
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTAA 251

Query: 180 LLDTPI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDV 227
           +L  PI             L+ +A D E+  E +     L+  AK PV+   A    +  
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMD-ESTNENIVRTADLLNKAKTPVLYVGAGILNNPA 310

Query: 228 KDE-TRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVG 286
             +  ++L +  Q P   T    G+ D+Q+P+   + +G         A+++ADLIL+VG
Sbjct: 311 GPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVG 369

Query: 287 ALLSD 291
           +   D
Sbjct: 370 SRFDD 374

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 133/312 (42%), Gaps = 34/312 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ D +T+FG PG   L + D I+E     +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
             G   +V  T G G  + +  +  + A+ V ++   G  + S+          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMITDINSAPAEIDRCIRTTYVSQR-PVYLGLPANLVDLKVPAS 179
                  +S + ++   M+ ++   P  I+         +  PV + LP +     V A+
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 268

Query: 180 LLDTPI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACC-SRHD 226
           +L  PI             L+ +A D E     V     L+  AK P++   A   +  D
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQD-EFTSNNVKRAADLVNVAKKPILYVGAGIFNNPD 327

Query: 227 VKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVG 286
                ++L +  Q P   T  G G+ D+++ +   + +G         A+++ADLIL+VG
Sbjct: 328 GPRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVG 386

Query: 287 ALLSDFNTGSFS 298
           A   D  T + S
Sbjct: 387 ARFDDRVTCNIS 398

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 131/313 (41%), Gaps = 36/313 (11%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + + +T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQR--PVYLGLPANLVDLKVPAS 179
                 +S + ++   M+  +   P  I+       +S+R  PV + LP +     V A+
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 LLDTPIDLSLKANDAEAEQ-----------EVVDDVLALIKAAKNPVILADACCSRHDVK 228
           +L  PI +          Q           E +     LI  AK PV+   A    +   
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNN--M 317

Query: 229 DETRKLIDITQ---FPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSV 285
           +  R L D++Q    P   T  G G+ D+++P      +G         AV+++DLI++V
Sbjct: 318 EGPRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAV 376

Query: 286 GALLSDFNTGSFS 298
           G    D  TG+ S
Sbjct: 377 GTRFDDRVTGNIS 389

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 116/533 (21%), Positives = 197/533 (36%), Gaps = 116/533 (21%)

Query: 7   GRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G    E +++ + +T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  MAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGDFTV 124
              +V  T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASLLDT 183
              +S + ++   M+  +   P  I+      T     PV + LP +     V A++L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PI------------DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDE- 230
           PI             L+ +A D +  + +  D   LI  A+ PV+   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLA-DASRLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS 290
            R+L +  Q P   T    G+ D+++ +   + +G   S      V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ 331
           D  TG+ +                   +    KNI +     + +       ++    L 
Sbjct: 360 DRVTGNIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVDAQVAVEGDVTANLEKLLPLI 419

Query: 332 KLLAK----VGDVAK-------DY---------KPVQVPARTPENA-ATADSTPL----- 365
           K +A+    +G +A        DY         KP  V  R  E A AT     +     
Sbjct: 420 KPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVITRLSEIANATGKEVIVTTGVG 479

Query: 366 ------KQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXX 419
                  Q W W +   F+  G +     GT  FG+  +                     
Sbjct: 480 QHQMWAAQHWTWKKPRTFITSGGL-----GTMGFGLPAA--------------------- 513

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNND 472
                     +   P   VI   GD SL +T+ E+S+ V+ G    + +LNN+
Sbjct: 514 -------IGAQVAKPDAIVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNE 559

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 130/307 (42%), Gaps = 38/307 (12%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E +K+ + +T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSISSQAKQLLLHHTLGNGD 121
             G   +V  T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMITDINSAPAEIDRCIRTTY---VSQR--PVYLGLPANLVDLKV 176
                 +S + ++   M+  +   P    +CI   +    S R  PV + LP +     V
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLP----KCINEAFEIATSGRPGPVLVDLPKD-----V 252

Query: 177 PASLLDTPIDL-------SLKANDAEAEQEV----VDDVLALIKAAKNPVI-LADACCSR 224
            AS+L  PI +       +LK     A  +     +     LI  AK P++ +     + 
Sbjct: 253 QASILRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNN 312

Query: 225 HDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILS 284
            +     ++L D  Q P   T    G+ D+ +P+   + +G         A+++ADLI++
Sbjct: 313 PEGPRLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIA 371

Query: 285 VGALLSD 291
           VGA   D
Sbjct: 372 VGARFDD 378

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 134/304 (44%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E +++ + +T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  VKGMAALV-TTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
             G   +V  T G G  + +  +A + A+ V ++   G  + S+          +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA----------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   M+  I   P  I+      T     PV + LP +     V A+
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 260

Query: 180 LLDTPIDL-SLKANDA--EAEQEVVDD--------VLALIKAAKNPVILADACCSRHDVK 228
           +L  PI + S+  +D   +  Q VVD+           LI  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 DE-TRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGA 287
            +  ++L D  Q P   T  G G+ ++++ +   + VG   +     A+++ADLI+++GA
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLDM-VGMHGNAAANLAIQNADLIIALGA 379

Query: 288 LLSD 291
              D
Sbjct: 380 RFDD 383

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 125/289 (43%), Gaps = 33/289 (11%)

Query: 9   YLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           Y  + L+Q   +T+FG+ G   + L D +    G+++    NE +A+YAA  Y  + G  
Sbjct: 8   YFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGKP 66

Query: 68  AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL GI  S +    ++ I G    SS+         L  G F    +
Sbjct: 67  GVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG----SSE--------DLHKGGFQELDQ 114

Query: 128 MSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTPIDL 187
           +S  +S+       + + P  I+     TY + R    G P  +  +  P SL+   I+ 
Sbjct: 115 VSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPG-VTYIDFPGSLISESIER 169

Query: 188 S------LKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFP 241
           S      +       + E +  V+ L+ + +N  IL        +  +E RKLI+    P
Sbjct: 170 SPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNLP 229

Query: 242 SFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS 290
              TPM KG + + +P          +S    +A++ A+++L +GA L+
Sbjct: 230 FLSTPMAKGVVPDSHP--------LNASSARSKALKEAEIVLVLGARLN 270

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
           P K ++L  GD +   +  EI T VR  L   + V+NN G
Sbjct: 428 PDKSIVLLQGDSAFGFSAMEIETAVRNRLGLVIIVMNNSG 467

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 96/488 (19%), Positives = 192/488 (39%), Gaps = 65/488 (13%)

Query: 14  LKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM-AALVT 72
           LKQ     +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    L+ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANI 132
             G G + AL G+  S+     +L + G    SS+ +            F    ++S  +
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYY--------EGFQELDQLSV-M 116

Query: 133 SETTAMITDINSAPAE--IDRCIRTTYVSQRPVYLGLPANLVDLKVPASLLDTPIDLSLK 190
           S        IN+      +   ++T+ +     Y+ +P  L++ K  +S  + P  + + 
Sbjct: 117 SRWCKFYGRINTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSS-DELPKKMEIA 175

Query: 191 ANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSFVTPMGKG 250
                 + + V +V  ++++ K  +++     + +    E R  ++  Q P   TPM KG
Sbjct: 176 HIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANYPA--EVRAFLEKYQLPFLPTPMAKG 233

Query: 251 SI-DEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS------------------- 290
            + D       G             A++SA+++L +GA L+                   
Sbjct: 234 IVPDTHELNVNGAR---------SLALKSAEVVLILGARLNWILHFGLEPKWSDDACFIQ 284

Query: 291 -DFNTGSFSYSYKTKNIVEFHSD---YIKIRNATFPGVQMKFAL-QKLLAKVGDVAKDYK 345
            D +  +   +         HSD   +I+  +   P       + +K+L+K+    K  K
Sbjct: 285 VDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILSKIHSNGKAMK 344

Query: 346 PVQVPARTPENAATADSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTY 405
             ++    PE +A      L+   ++ ++ +F+ +   ++   G +   I +  FP  +Y
Sbjct: 345 EKEI---IPEGSA------LRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFPT-SY 394

Query: 406 GISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPY 465
              ++  G+               +  +P K V+   GD +   +  E+ T+ R  L   
Sbjct: 395 QKHRLDAGT-SATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIV 453

Query: 466 LFVLNNDG 473
           + V+NN G
Sbjct: 454 VVVMNNGG 461

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 117/528 (22%), Positives = 213/528 (40%), Gaps = 88/528 (16%)

Query: 8   RYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM 67
           ++  + L++   +T+FG+ G   + L D +    G+++    NE  A+YAA GY  V   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAK---QLLLHHTLGNGDFT 123
              L+   G G + +L GI  S      +L I G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVPASLL 181
            F + +  ++ +   M+T        ++ CI+ T  VS    Y+ +PA+ ++ + P    
Sbjct: 122 PFLKFTGKLTPDNVDMVTQ-----KALNHCIQGTAGVS----YIDVPADFIESEKPLEGN 172

Query: 182 D-----TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKD--ETRKL 234
           D      P+ L+ K    +  Q  + +++ LI   ++  IL      +  VK+  E R+L
Sbjct: 173 DYIANELPMILTPKKCGPDPSQ--IKEIVQLILHHRDNNILI--VIGKGAVKNSHEIRRL 228

Query: 235 IDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + + +P         +SS    +A+++AD++L +GA L+    
Sbjct: 229 INKFNLPFLPTPMAKGIVPDSSPL-------NVSSAR-SQALKTADVVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLAKVGDVAKDYKP 346
              S  +  ++I ++F S+   +  N   PG  +        ++  L+ ++   +  +K 
Sbjct: 281 FGTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKY 340

Query: 347 VQVPARTPENAATADSTPLKQQ----------WIWNQVGKFLQEGDVVITETGTSAFGIN 396
             V     E      +  L+++           ++  +   + +   ++   G +   I 
Sbjct: 341 SGVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIA 400

Query: 397 QSHFP------------NKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGD 444
           +  FP            N T GI                       E+D    V+L  GD
Sbjct: 401 RVSFPTDVPRRRLDAGTNATMGIG----------LGYALASKASHLELD----VVLIQGD 446

Query: 445 GSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQP 492
            +   +  EI T VR  L   + V+NN G     + HGE    +D+ P
Sbjct: 447 SAFGFSAMEIETAVRCQLALIIVVMNNSG-----IYHGENNTGSDLPP 489

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 113/514 (21%), Positives = 207/514 (40%), Gaps = 60/514 (11%)

Query: 8   RYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYARVK 65
           +Y  E L++   +T+FG+ G   + L D +    G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAK---QLLLHHTLGNGDF 122
               L+   G G + +L GI  S +    +L I G  S     K   Q L   +L     
Sbjct: 66  -PGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPA--- 178
           + F + +  ++ +   MIT        ++ CI+ T       Y+ +PA+ ++ + P    
Sbjct: 121 SPFLKFTGKLAPDNIRMITQ-----KALNHCIQGT---AGVAYIDVPADFIEYEKPLEGN 172

Query: 179 SLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKD--ETRKLID 236
             +   + + L  N    +   + +V+ LI   K   IL      +  VK+  E R+LI+
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILV--VIGKGAVKNSHEVRRLIN 230

Query: 237 ITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGS 296
               P   TPM KG + + +P         +SS    +A+++AD++L +GA L+      
Sbjct: 231 KFNIPFLPTPMAKGIVPDSSPL-------NVSSAR-SQALKTADIVLVLGARLNWILHFG 282

Query: 297 FSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLAKVGDVAKDYKPVQ 348
            S  + +++I ++F S+   +  N   PG  +        ++  L+ +V      +K   
Sbjct: 283 ASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKYSG 342

Query: 349 VPARTPENAATADSTPLKQQ----------WIWNQVGKFLQEGDVVITETGTSAFGINQS 398
           +     E      +  LK++           ++  +   + +    +   G +   I + 
Sbjct: 343 ISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIARV 402

Query: 399 HFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMV 458
            FP  T    + L                  +   P+  V+L  GD +   +  EI T V
Sbjct: 403 SFP--TNAPKRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAV 460

Query: 459 RWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQP 492
           R  L   + V+NN G     + HGEK   +D+ P
Sbjct: 461 RCQLALVIVVMNNSG-----IYHGEKDTGSDLPP 489

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 128/545 (23%), Positives = 224/545 (41%), Gaps = 68/545 (12%)

Query: 5   TLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L++   +T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAK---QLLLHHTLGN 119
             K    L+   G G + AL GI  S +    +L I G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMITDINSAPAEIDRCIR-TTYVSQRPVYLGLPANLVDLKVP 177
              + F + +  ++ +   MIT        ++ CI+ T  VS    Y+ +PA+ ++ + P
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQ-----KALNYCIQGTAGVS----YIDVPADFIEYEKP 168

Query: 178 ASLLD---TPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKD--ETR 232
               D     + + L  N    +   +  V+ LI   KN  IL      +  VK+  E R
Sbjct: 169 LEGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILI--VIGKGAVKNSHEIR 226

Query: 233 KLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDF 292
           +L++    P   TPM KG + + +P    + V +  S    +A++ AD++L +GA L+  
Sbjct: 227 RLVNTFNLPFLPTPMAKGIVPDSSP----LNVSSARS----QALKIADIVLVLGARLNWI 278

Query: 293 NTGSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLAKVGDVAKDY 344
                S  + +++I ++F S+   +  N   PG  +        ++  L+ ++      +
Sbjct: 279 LHFGTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCW 338

Query: 345 KPVQVPARTPENAATADSTPLKQ------QWIWNQV----GKFLQEGDVVITETGTSAFG 394
           K   V     E      +  L++      Q  +NQV       + +   ++   G +   
Sbjct: 339 KYSGVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMD 398

Query: 395 INQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEI 454
           I +  FP  T    + L                  +   P+  V+L  GD +   +  EI
Sbjct: 399 IARISFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEI 456

Query: 455 STMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPW---KNL--DLL-PTFGAKDYE 508
            T VR  L   + V+NN G     + HGEK    D+ P    KN   DL+    GA D+ 
Sbjct: 457 ETAVRCQLALVIVVMNNSG-----IYHGEKDIEGDLPPTALSKNCRYDLVGKGLGANDFF 511

Query: 509 THRVS 513
            + +S
Sbjct: 512 VNTIS 516

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 116/524 (22%), Positives = 208/524 (39%), Gaps = 89/524 (16%)

Query: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MS I++  Y+   LK+ D +T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARVKGM-AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAK-----QLLLH 114
           Y  +      L+T  G G + AL GI  S   +  ++ I G   I SQ K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + +S + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LKVPASLLDT-----PI---DLSLKAND---AEAEQEVVDDVLALIKAAKNPVILADACC 222
             V  ++ D+     PI    L+   ND    E  + + D   A+ K  +N +++     
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYD---AMRKRDQNMLVIVGKGA 222

Query: 223 SRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLI 282
                    R  I+    P   TPM KG I++ N          +SS     A++ AD+I
Sbjct: 223 I--GASSALRHFINCFNLPFLPTPMAKGIIEDSNEL-------NVSSGR-SMALKDADVI 272

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFP-GVQMKFALQKLLAKVGDVA 341
           L  GA L+      +  + K K+ V+F    I++ N T   G+  +  LQ  L  +GD+ 
Sbjct: 273 LVFGAKLNWIL--HYGDTPKFKDNVKF----IQVDNNTKTIGLNNQRGLQNSL--IGDIE 324

Query: 342 KDYKPVQ-----------------------------VPARTPENA---ATADSTPLKQQW 369
              K +                              +     ENA      ++  L    
Sbjct: 325 STVKKLTMMINHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNV 384

Query: 370 IWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXX 429
           ++ ++    ++ + ++   G +   + +  FP   +   ++  G++              
Sbjct: 385 VFGRLKTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLATMGIGLGYAISTK 443

Query: 430 EEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
               P K V+L  GD +   +  E+ T VR+ L   + ++NN G
Sbjct: 444 LS-KPNKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG 486

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 122/286 (42%), Gaps = 27/286 (9%)

Query: 9   YLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           ++ + L     +T+FG+ G   + + D I     +R+ G  NE  A+YAA  Y  + G  
Sbjct: 9   HISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASAYGYLTGKP 68

Query: 68  AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL G+  S +    +L + G    SS+         L  G F    +
Sbjct: 69  GVLLVVGGPGLIHALAGVYNSISNKWPLLVLAG----SSE--------DLNRGGFQALDQ 116

Query: 128 MSANISETTAMITDINSAPAE--IDRCIRTTYVSQRPV-YLGLPANLVDLKVPASLLDTP 184
           + A +S      + +N++     +   +R + V    V YL +P +L++  V     +  
Sbjct: 117 I-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSVEKEKYNCV 175

Query: 185 IDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPSFV 244
            +++    + +  ++ +  V  LI       +L        D   E RK I+  Q P   
Sbjct: 176 RNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIERFQLPFLP 233

Query: 245 TPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS 290
           TPM KG + + +P         +SS     A+ SAD++L +GA L+
Sbjct: 234 TPMAKGVVPDSHPL-------NVSSAR-SLALRSADIVLVLGARLN 271

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 73/335 (21%), Positives = 134/335 (40%), Gaps = 47/335 (14%)

Query: 164 YLGLPANLV------DLKVPASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVIL 217
           Y+ +P NL+      + ++   ++ +P+  S        +  VV +V  LI   ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCS-------PDPLVVSEVARLIANNEHKEIL 205

Query: 218 ADACCSRHDVKDETRKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVE 277
                   +  +E R+ +D  Q P   TPM KG + + +P         +SS     A+ 
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHPL-------NVSSAR-SLALR 257

Query: 278 SADLILSVGALLSDFNTGSFSYSYKTKNIVEF-HSDY---------IKIRNATFPGVQMK 327
            AD++L +GA L+      F    K K+ V+F   DY         +   N +  G  + 
Sbjct: 258 KADVVLLLGARLNWIL--HFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCG-DIG 314

Query: 328 FALQKLLAKVGDVAKDYKPVQVPAR----TPENAATADSTPLKQQWI-WNQV----GKFL 378
            +L++L +K+   A  Y+ +    R    T E          +   + +NQV     +++
Sbjct: 315 LSLEELGSKLH--AFKYRGLNNAIREKIDTNELKLRGKERETRTALLHYNQVYALMRQYI 372

Query: 379 QEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRV 438
            + + ++   G +   + +  FP   Y   ++  G+               +  D  K V
Sbjct: 373 TDDETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTTKTV 430

Query: 439 ILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
           I   GD +   +  E+ T VR  L   + V+NN G
Sbjct: 431 ICIQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG 465

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 97/509 (19%), Positives = 196/509 (38%), Gaps = 70/509 (13%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T+   +   L+  + + +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  VKGM-AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           + G    L+   G G + +L G+  S      ++ + G              H    G F
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHG---------HDQYRGAF 112

Query: 123 TVFHRMS--ANISETTAMITDINSAPAEIDRCIRTTY-----VSQRPVYLGLPANLVDLK 175
               ++S      + +  +T+ N     +D  + + Y      ++   Y+ +P NL++ +
Sbjct: 113 QELDQISLLKPYVKFSGKLTEGN-----VDHVLFSAYNIALQGTKGVTYVDIPGNLIETQ 167

Query: 176 VPAS---LLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETR 232
              +    L  P+   +K +    +   V  V +LI   ++  +L              R
Sbjct: 168 AVCAGTPGLLPPVPQPIKCS---PDPHTVKRVASLILENRDKKVLVVVGKGSQGAFAAVR 224

Query: 233 KLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDF 292
           + ID   FP   TPMGKG + +++          +SS     A+  A ++L +GA L+  
Sbjct: 225 RFIDEFNFPFLPTPMGKGVVPDEHEL-------NVSSAR-SYALAHAGIVLIMGARLNWI 276

Query: 293 NTGSFSYSYKTK---NIVEFHSD----YIKIRNATFPGVQM----KFALQKLLAKVGDV- 340
                 Y+   K   N V    D     +   N    G+ +    ++ ++ L  ++    
Sbjct: 277 ----LHYAGPPKWNPNAVFIQCDSNGETLGQNNQYHAGLSLFGDIEYTVEALSNELRSAG 332

Query: 341 AKDYKPVQVPA-------------RTPENAATADSTP---LKQQWIWNQVGKFLQEGDVV 384
             DY+   + +             R  E+A   +S+P   L    ++  +   L++   V
Sbjct: 333 GGDYRYGGLSSSIQEKIHKNEQRLRDSEHAVPEESSPPHVLNYNRVYGIIRPLLEQDRTV 392

Query: 385 ITETGTSAFGINQSHFPNKTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGD 444
           +   G +     +  FP  T   S++  G+                     + V+L  GD
Sbjct: 393 LVTEGANTMDKARVSFPAST-PFSRLDAGTNATMGVGLGYAMAAKLSSGAARDVVLIQGD 451

Query: 445 GSLQLTVQEISTMVRWGLKPYLFVLNNDG 473
            +   +  E+ T+VR+ +   + ++NN G
Sbjct: 452 SAFGFSGMELETLVRFQVGVVVMIMNNSG 480

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 137/299 (45%), Gaps = 38/299 (12%)

Query: 5   TLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L++   +T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAK---QLLLHHTLGN 119
             K    L+   G G + +L GI  S +    +L I G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMITDINSAPAEIDRCIRTTY-VSQRPVYLGLPANLVDLKVP 177
              + F + +  + S+   M+T        ++ CI+ T  VS    Y+  PA+L++ +  
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTR-----KALNHCIQGTMGVS----YIDFPADLIENEKK 168

Query: 178 A----SLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKD--ET 231
           +      L   + + L  N    +   +++++ LI   ++  IL      +  VK+  E 
Sbjct: 169 SLAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILI--VIGKGAVKNSHEI 226

Query: 232 RKLIDITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS 290
           R+L+     P   TPM KG + + +P    + V +  S    +A+++AD++L +GA L+
Sbjct: 227 RRLVSSFNLPFLPTPMAKGIVPDSSP----LNVSSARS----QALKTADIVLVLGARLN 277

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQP 492
           P+  V+L  GD +   +  EI T VR  L   + V+NN G     + HG K    D+ P
Sbjct: 437 PELDVVLIQGDSAFGFSAMEIETAVRCQLALVIVVMNNSG-----IYHGVKDAGADLPP 490

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 105/501 (20%), Positives = 192/501 (38%), Gaps = 65/501 (12%)

Query: 9   YLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           YL E L       +FG+ G   + L D +     +++ G  NE  A+YAA  Y  + G  
Sbjct: 7   YLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGRP 66

Query: 68  AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL G+  S +    ++ + G    S++            G F    +
Sbjct: 67  GVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNR------------GGFQELDQ 114

Query: 128 MS--ANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPA--SLLDT 183
           ++  +   + ++ +++ N   +  D   +    +    YL +PAN++D +V    S    
Sbjct: 115 IALLSKYVKYSSRLSNSNVDQSFYDALRQAVLGTPGVSYLDIPANVIDQEVEKNESFSRR 174

Query: 184 PI-DLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQFPS 242
            I  +S +  DA  ++     V  L+ A ++  IL        +   + R  +D  Q P 
Sbjct: 175 HIAKISYQPTDAALQR-----VAKLLNANRDKNILCVIGKGATENAQQIRPFVDEFQLPF 229

Query: 243 FVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
             TPM KG +    P    + V +  S     A++SAD++L +GA L+      F  + K
Sbjct: 230 LSTPMAKGVV----PDSHALNVSSARS----LALKSADIVLVLGARLNWIL--HFGEAPK 279

Query: 303 TKN---IVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPV-----------Q 348
            KN    ++  +   ++ +    G      L  L   +G       P+            
Sbjct: 280 WKNDAIFIQIDTTAEELGHNNGAGT-----LFSLCGDIGTTVAKLTPLLAGFSGRGLFGS 334

Query: 349 VPARTPEN-----AATADSTP-LKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPN 402
           +  R  +N     A   + +P L    ++  + K + + D +I   G +   + +  FP 
Sbjct: 335 LETRIQQNEKRLRARENEPSPALTYNKVYATIRKQIVDKDTIIVSEGANTMDVARISFPT 394

Query: 403 KTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGL 462
               +   +                  +   P+K VI   GD +   +  E+ T  R+ L
Sbjct: 395 DYPKLR--MDAGTNATMGVGLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMELETASRYKL 452

Query: 463 KPYLFVLNNDGYTIERLIHGE 483
              + V+NN G     + HGE
Sbjct: 453 GITVVVMNNSG-----IYHGE 468

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 126/295 (42%), Gaps = 32/295 (10%)

Query: 4   ITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  Y    LK  + +T+FG+ G   + L + +    G+++    NE  A+YAA  Y  
Sbjct: 10  IEITEYFIGLLKYYEIDTVFGIVGIPIVELANSMI-THGIKFISCRNEQAASYAASAYGF 68

Query: 64  VKGM-AALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNGDF 122
           + G  A L+   G G + AL G+  S +    ++ I G  S   + ++ L       G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGVYNSTSNKWPLIVIAG--SNHDEIQENL-------GGF 119

Query: 123 TVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVS--QRPV---YLGLPANLV--DLK 175
               ++S  + +       +N +   I+      Y S  Q P    Y+  P +L+  +++
Sbjct: 120 QDLDQVSL-LKDKVKYCGRLNGS--NINSVWYNAYNSAIQPPTGVSYIDFPEHLISNNVR 176

Query: 176 VPASLLDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLI 235
           VP    +  I  ++K++   A+  V  +V  L++   +  +L        +        I
Sbjct: 177 VPNMKQNISIPRAIKSS---ADPLVTKEVAQLLRRNSDQNVLVIIGKGAVNYSKGLSAFI 233

Query: 236 DITQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLS 290
              QFP   TPMGKG I + +P         +SS     A+  +D++L  GA L+
Sbjct: 234 HKYQFPFLPTPMGKGIISDMDPL-------NVSSAR-SSALSKSDIVLVFGARLN 280

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGEKAQYNDIQPW 493
           P K  +L  GD +   +  E+ T+ R+ L   + ++NN G     + HG + ++N ++P+
Sbjct: 449 PDKLTVLIQGDSAFGFSGMELETISRFKLGIVVIIMNNSG-----IYHGNE-KFNPMEPY 502

Query: 494 KN 495
            N
Sbjct: 503 SN 504

>TPHA0N00310 Chr14 complement(54950..56971) [2022 bp, 673 aa] {ON}
           Anc_7.33 YOR356W
          Length = 673

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 313 YIKIRNATFPG-VQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATAD 361
           Y  I +  F G V   F   K  AK+  +AKDYKP+Q P   P+   T D
Sbjct: 523 YSGIDSYVFKGRVPWTFGFHKSDAKITKLAKDYKPIQYP--QPDGKITFD 570

>NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {ON}
           
          Length = 205

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 39/89 (43%)

Query: 98  IVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTY 157
           +V   +++ +  ++     L  G       + A+ +     +TDI  +  EI   +   Y
Sbjct: 1   MVAFKAVTPKKARVAADEPLEKGVLRFLVSIGASYTTRPEFLTDIVDSTTEIIDTVGNKY 60

Query: 158 VSQRPVYLGLPANLVDLKVPASLLDTPID 186
            S +  YL +  N+ DLK+   ++ +P D
Sbjct: 61  ESTQFGYLNIKTNVKDLKIKTYVIKSPED 89

>TPHA0J01140 Chr10 complement(263525..266092) [2568 bp, 855 aa] {ON}
           Anc_3.419 YPR105C
          Length = 855

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 472 DGYTIERLIHGEKAQYNDI----QPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEF 527
           D   +E L+  E ++YN +         L+ L     +D    +  TTG+ NK    S+F
Sbjct: 16  DNAVLEGLLSKELSKYNQLFSKLSTQSQLNKLHDIIQRD----KAETTGQLNKFIATSQF 71

Query: 528 NKNSKIRMIEVM 539
           + N KIR +E++
Sbjct: 72  SHNKKIRKLELL 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,585,162
Number of extensions: 2429189
Number of successful extensions: 6627
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6532
Number of HSP's successfully gapped: 150
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)