Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E037505.251ON47147122590.0
Kpol_1032.875.251ON46447320890.0
ACR050C5.251ON47547220680.0
SAKL0G11484g5.251ON45647120600.0
TBLA0C030405.251ON46847120580.0
CAGL0E06490g5.251ON47247220530.0
KLTH0G07524g5.251ON44547120480.0
Ecym_82505.251ON45647220490.0
TPHA0B025505.251ON46347120460.0
Skud_11.825.251ON46847120410.0
ZYRO0A10560g5.251ON46847220340.0
YKL145W (RPT1)5.251ON46747120270.0
NCAS0F023005.251ON47447420270.0
Smik_11.915.251ON46847220220.0
KAFR0H036305.251ON44847220170.0
Suva_11.805.251ON47147120140.0
KLLA0E13773g5.251ON47547619700.0
KNAG0H023005.251ON47747819410.0
Kwal_23.28495.251ON40943119020.0
NDAI0C037805.251ON38538717180.0
Suva_7.2274.57ON4053117991e-102
Skud_7.2364.57ON4053117961e-101
Smik_7.2354.57ON4053117951e-101
YGL048C (RPT6)4.57ON4053117951e-101
KLLA0A04752g4.57ON4043117931e-101
Kwal_26.74744.57ON4053017831e-99
KLTH0D03806g4.57ON4053007831e-99
ZYRO0G22330g4.57ON4053117822e-99
CAGL0D06292g4.57ON4003137812e-99
Kpol_1041.424.57ON4033127804e-99
NCAS0A058804.57ON4073127795e-99
AGL043C4.57ON4053007795e-99
SAKL0H23672g4.57ON4083017771e-98
KNAG0D032004.57ON4003157752e-98
TBLA0B098804.57ON4013127742e-98
KAFR0F031004.57ON4053127743e-98
NDAI0D028504.57ON4053127743e-98
TDEL0E056604.57ON4063007726e-98
TPHA0F004404.57ON4033127718e-98
KLLA0C09592g8.708ON4343077216e-90
AAL113W8.708ON4323097164e-89
Skud_15.4258.708ON4373227164e-89
KNAG0G027208.708ON4443227141e-88
KLTH0D11990g8.708ON4333077131e-88
SAKL0H05764g8.708ON4213077111e-88
YOR259C (RPT4)8.708ON4373227112e-88
Ecym_23658.708ON4273077084e-88
Smik_15.4428.708ON4373227094e-88
NCAS0B011508.708ON4263227085e-88
TDEL0A065308.708ON4353077085e-88
NCAS0A101803.216ON4373177061e-87
Kwal_26.89128.708ON4343077061e-87
Suva_8.3088.708ON4373227061e-87
KAFR0A040108.708ON4243227042e-87
NDAI0E010208.708ON4433227052e-87
TPHA0D014708.708ON4553257035e-87
Kpol_1064.228.708ON4323207015e-87
TBLA0D012408.708ON4433207026e-87
CAGL0K08910g8.708ON4363227016e-87
YDL007W (RPT2)3.216ON4373177017e-87
Suva_4.2463.216ON4373176991e-86
KAFR0F024403.216ON4363176991e-86
Smik_4.2293.216ON4373176991e-86
NDAI0A072903.216ON3763176932e-86
Kpol_1010.743.216ON4373176972e-86
KNAG0K015303.216ON4353176963e-86
Kwal_27.110323.216ON3763306913e-86
SAKL0C11440g3.216ON4363306955e-86
TDEL0D040603.216ON4372976946e-86
CAGL0I04884g3.216ON4333176947e-86
Skud_4.2473.216ON4373176948e-86
ZYRO0A04224g3.216ON4372606939e-86
KLLA0E21209g5.428ON4323086921e-85
Ecym_52863.216ON4373176922e-85
TPHA0A042703.216ON4373176912e-85
TBLA0F006903.216ON4343176902e-85
Ecym_55275.428ON4323086902e-85
TPHA0H017705.251ON4343086903e-85
AEL011W3.216ON4373176893e-85
NCAS0F033305.428ON4343086894e-85
SAKL0G02376g5.428ON4343086885e-85
ZYRO0F11946g8.708ON4443226896e-85
KLTH0G16698g3.216ON4553176871e-84
CAGL0A02750g5.428ON4293086832e-84
KLTH0F16214g5.428ON4343086842e-84
KNAG0C049605.428ON4233086822e-84
Kwal_55.214535.428ON4343086824e-84
Smik_15.2955.428ON4343086824e-84
YOR117W (RPT5)5.428ON4343086825e-84
Suva_8.1705.428ON4343086815e-84
KLLA0F14707g3.216ON4343176815e-84
KAFR0E038905.428ON4343086807e-84
Kpol_1062.335.428ON4343086809e-84
Skud_15.2805.428ON4343086791e-83
AER254W5.428ON4603086802e-83
TDEL0E019705.428ON4343086782e-83
NDAI0B056205.428ON4823086794e-83
TBLA0A037405.428ON4343086755e-83
ZYRO0F09900g5.428ON4343086712e-82
Kpol_543.175.486ON4282786451e-78
ZYRO0D11528g5.486ON4532936426e-78
KLLA0C06534g5.486ON4282626397e-78
NDAI0A042905.486ON4262796397e-78
NCAS0A119805.486ON4262796399e-78
CAGL0K09526g5.486ON4312636381e-77
Ecym_45485.486ON4252626372e-77
TPHA0J028605.486ON4312796372e-77
Smik_4.6685.486ON4282796362e-77
YDR394W (RPT3)5.486ON4282796362e-77
Skud_4.6685.486ON4282796353e-77
AFR394W5.486ON4722596393e-77
TBLA0D018605.486ON4292796354e-77
KAFR0E035805.486ON4252796344e-77
SAKL0G03828g5.486ON4252626329e-77
Suva_2.5715.486ON4282796329e-77
KNAG0C045905.486ON4322956329e-77
TDEL0A035005.486ON4262796127e-74
KLTH0G02662g5.486ON4252626083e-73
TBLA0J006407.288ON8522315319e-59
TDEL0H015607.288ON8382315291e-58
NCAS0E035807.288ON6012315183e-58
TBLA0C048407.288ON8472315273e-58
SAKL0F09834g7.288ON8422315264e-58
KLLA0F05676g7.288ON8302315246e-58
KLTH0A05324g7.288ON8322315246e-58
NCAS0A137607.288ON8252315237e-58
KNAG0B029407.288ON8382315238e-58
NDAI0A030407.288ON8422315231e-57
Smik_4.1117.288ON8352315221e-57
NDAI0A022807.288ON8252315221e-57
Kpol_1020.97.288ON8122315212e-57
Kwal_23.59967.288ON8312315212e-57
KAFR0L011907.288ON8242315202e-57
CAGL0J09350g7.288ON8302315203e-57
Ecym_80377.288ON8362315203e-57
Skud_4.1297.288ON8352315203e-57
YDL126C (CDC48)7.288ON8352315193e-57
Suva_4.1197.288ON8362315193e-57
AFR158W7.288ON8322315194e-57
ZYRO0C09262g7.288ON8302315185e-57
Kpol_2000.157.288ON8232315169e-57
TPHA0A032607.288ON8262315151e-56
NCAS0E040505.34ON13292794934e-53
ZYRO0D07414g5.34ON14202694901e-52
KAFR0D019005.34ON12612694863e-52
Kwal_47.18848singletonOFF3021564544e-52
TDEL0G005905.34ON12942344847e-52
KLTH0B09130g5.34ON13332794821e-51
TPHA0L022105.34ON14002704821e-51
TBLA0C068505.34ON14262694812e-51
NDAI0B007805.34ON13482794812e-51
KNAG0K002805.34ON14082714802e-51
CAGL0G00528g5.34ON13172714802e-51
Kpol_513.195.34ON13772704793e-51
TBLA0I011902.472ON8352654763e-51
KLLA0A09823g5.34ON13192714784e-51
ABR139W5.34ON12702684776e-51
ZYRO0D15290g7.168ON7272644708e-51
Ecym_47695.34ON13392694741e-50
Ecym_12587.168ON7472644691e-50
Skud_13.2452.472ON8242574701e-50
SAKL0H01276g5.34ON13372694732e-50
Kwal_23.42535.34ON13292794732e-50
KNAG0L010607.168ON7132614662e-50
KNAG0B061604.259ON7722674682e-50
Smik_16.385.34ON13892344713e-50
KLTH0F13904g7.168ON7392634654e-50
Kwal_26.77492.472ON8142574674e-50
Skud_7.6035.34ON13862344695e-50
AAR025C7.168ON7262644636e-50
TDEL0A024802.472ON8162574656e-50
Kpol_483.204.259ON7832614657e-50
NCAS0J015504.259ON7722424647e-50
Ecym_74002.472ON8042564657e-50
KAFR0A058904.259ON7722824648e-50
Kpol_401.37.168ON7862644631e-49
Suva_13.2662.472ON8232574631e-49
KLTH0D05412g2.472ON8132574622e-49
KAFR0A007402.472ON7842574612e-49
YGR270W (YTA7)5.34ON13792344633e-49
Suva_7.5665.34ON13982364633e-49
YMR089C (YTA12)2.472ON8252574595e-49
Smik_13.2732.472ON8272574595e-49
CAGL0J01353g2.472ON8272554586e-49
SAKL0H02750g4.259ON7762944577e-49
TPHA0B007304.259ON7763114577e-49
CAGL0C02585g4.259ON7712724561e-48
NDAI0H022102.472ON8032574561e-48
NCAS0A078202.472ON7912574551e-48
Klac_YGOB_Anc_7.168b7.168ON7792614551e-48
NDAI0E035807.168ON7822624551e-48
Kpol_467.232.472ON8592574562e-48
YLR397C (AFG2)4.259ON7802674542e-48
SAKL0F03894g7.168ON7422634532e-48
NDAI0J023204.259ON7784504524e-48
TBLA0D044907.168ON7822944514e-48
KLLA0B03234g4.259ON8042454524e-48
SAKL0E03014g2.472ON8302574525e-48
KLLA0F13706g2.472ON8422574517e-48
NCAS0E020207.168ON7732644499e-48
ABL041W2.472ON8182564491e-47
TPHA0C015207.168ON7842644481e-47
Suva_5.1097.168ON7612594481e-47
Smik_12.4844.259ON7802664481e-47
TDEL0H027707.168ON7442644471e-47
TPHA0G031302.472ON7922664462e-47
CAGL0D02838g4.23ON8343344454e-47
CAGL0H09416g7.168ON7502644434e-47
KNAG0E025502.472ON8452574446e-47
KAFR0G028007.168ON7832624436e-47
Skud_12.4824.259ON7773064427e-47
Smik_5.1387.168ON7602594427e-47
YLL034C (RIX7)4.23ON8373154439e-47
Suva_10.5144.259ON7802674419e-47
Skud_5.1217.168ON7622594411e-46
KNAG0C033207.430ON7662544411e-46
ZYRO0G03212g2.472ON8302554411e-46
SAKL0H25630g4.23ON8302574402e-46
YER017C (AFG3)7.168ON7612594382e-46
ZYRO0F13024g7.430ON7402544382e-46
Suva_10.384.23ON8372574402e-46
Skud_12.334.23ON8372574402e-46
Smik_12.224.23ON8372574392e-46
ZYRO0G08008g4.23ON8263124383e-46
NCAS0A146407.430ON7502544373e-46
KAFR0K020607.430ON7262544363e-46
NCAS0A029404.23ON8572884393e-46
KLTH0D14586g4.259ON7742694373e-46
KLLA0E06711g7.430ON7692544364e-46
Ecym_62184.23ON8382574375e-46
TDEL0E011104.259ON7782684356e-46
Kwal_23.41944.259ON7742774348e-46
Ecym_71237.430ON7272554331e-45
KLLA0E00837g4.23ON8142574341e-45
TDEL0C029307.430ON7402544321e-45
TBLA0A063804.259ON8082844331e-45
SAKL0F13376g7.430ON7412544312e-45
Suva_16.3517.430ON7472544302e-45
NDAI0A013907.430ON7122554293e-45
CAGL0K05093g7.430ON7452544303e-45
TBLA0F014707.430ON8022544313e-45
Kpol_1044.154.23ON8392574313e-45
Smik_16.2657.430ON7472514294e-45
KLTH0C05742g7.430ON7442544294e-45
YPR024W (YME1)7.430ON7472544284e-45
ZYRO0B12606g4.259ON7772834295e-45
TBLA0E014504.23ON8612574305e-45
Skud_16.3097.430ON7472544276e-45
KAFR0L002604.23ON7943104286e-45
NDAI0D048904.23ON8703384296e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E03750
         (471 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   874   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   809   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   801   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   798   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   797   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   795   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   793   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   793   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   792   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   790   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   788   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   785   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   785   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   783   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   781   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   780   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   763   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   752   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   737   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   666   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   312   e-102
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   311   e-101
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   310   e-101
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   310   e-101
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   310   e-101
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   306   1e-99
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   306   1e-99
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   305   2e-99
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   305   2e-99
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   305   4e-99
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   304   5e-99
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   304   5e-99
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   303   1e-98
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   303   2e-98
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   302   2e-98
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   302   3e-98
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     302   3e-98
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   301   6e-98
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   301   8e-98
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   282   6e-90
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   280   4e-89
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   280   4e-89
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   279   1e-88
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   279   1e-88
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   278   1e-88
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   278   2e-88
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   277   4e-88
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   277   4e-88
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    277   5e-88
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   277   5e-88
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   276   1e-87
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   276   1e-87
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   276   1e-87
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   275   2e-87
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    276   2e-87
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   275   5e-87
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   274   5e-87
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   275   6e-87
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   274   6e-87
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   274   7e-87
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   273   1e-86
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   273   1e-86
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   273   1e-86
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   271   2e-86
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   273   2e-86
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   272   3e-86
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   270   3e-86
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   272   5e-86
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   271   6e-86
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   271   7e-86
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   271   8e-86
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   271   9e-86
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   271   1e-85
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   271   2e-85
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   270   2e-85
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   270   2e-85
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   270   2e-85
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   270   3e-85
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   270   3e-85
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    270   4e-85
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   269   5e-85
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   270   6e-85
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   269   1e-84
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   267   2e-84
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   268   2e-84
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   267   2e-84
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   267   4e-84
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   267   4e-84
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   267   5e-84
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   266   5e-84
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   266   5e-84
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   266   7e-84
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   266   9e-84
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   266   1e-83
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   266   2e-83
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   265   2e-83
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   266   4e-83
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   264   5e-83
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   263   2e-82
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   253   1e-78
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   251   6e-78
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   250   7e-78
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   250   7e-78
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   250   9e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   250   1e-77
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   249   2e-77
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   249   2e-77
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   249   2e-77
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   249   2e-77
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   249   3e-77
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   250   3e-77
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   249   4e-77
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   248   4e-77
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   248   9e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   248   9e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   248   9e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   240   7e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   238   3e-73
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   209   9e-59
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   208   1e-58
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    204   3e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   207   3e-58
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   207   4e-58
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   206   6e-58
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   206   6e-58
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            206   7e-58
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   206   8e-58
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   206   1e-57
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   205   1e-57
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   205   1e-57
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   205   2e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   205   2e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   204   2e-57
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   204   3e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   204   3e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   204   3e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   204   3e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   204   3e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   204   4e-57
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   204   5e-57
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   203   9e-57
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   202   1e-56
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    194   4e-53
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   193   1e-52
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   191   3e-52
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   179   4e-52
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   191   7e-52
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   190   1e-51
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   190   1e-51
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   189   2e-51
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   189   2e-51
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   189   2e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   189   2e-51
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   189   3e-51
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   187   3e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   188   4e-51
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   188   6e-51
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   185   8e-51
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   187   1e-50
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   185   1e-50
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   185   1e-50
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   186   2e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   2e-50
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   184   2e-50
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   184   2e-50
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   186   3e-50
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   183   4e-50
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   184   4e-50
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   185   5e-50
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   182   6e-50
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   183   6e-50
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   183   7e-50
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   183   7e-50
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   183   7e-50
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   183   8e-50
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   182   1e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   182   1e-49
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   182   2e-49
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   182   2e-49
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   182   3e-49
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   182   3e-49
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   181   5e-49
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   181   5e-49
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   181   6e-49
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   180   7e-49
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   180   7e-49
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   180   1e-48
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   180   1e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   179   1e-48
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   179   1e-48
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    179   1e-48
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   180   2e-48
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   179   2e-48
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   179   2e-48
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   178   4e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   178   4e-48
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   178   4e-48
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   178   5e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   178   7e-48
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    177   9e-48
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   177   1e-47
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   177   1e-47
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   177   1e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   177   1e-47
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   176   1e-47
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   176   2e-47
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   176   4e-47
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   175   4e-47
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   175   6e-47
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   175   6e-47
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   174   7e-47
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   174   7e-47
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   175   9e-47
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   174   9e-47
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   174   1e-46
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   174   1e-46
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   174   1e-46
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   174   2e-46
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   173   2e-46
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   173   2e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   174   2e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   174   2e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   173   2e-46
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   173   3e-46
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   172   3e-46
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   172   3e-46
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     173   3e-46
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   172   3e-46
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   172   4e-46
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   172   5e-46
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   172   6e-46
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   171   8e-46
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   171   1e-45
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   171   1e-45
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   171   1e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   171   1e-45
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   170   2e-45
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   170   2e-45
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   169   3e-45
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   170   3e-45
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   170   3e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   170   3e-45
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   169   4e-45
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   169   4e-45
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   169   4e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   169   5e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   170   5e-45
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   169   6e-45
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   169   6e-45
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   169   6e-45
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   169   6e-45
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   169   7e-45
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   168   8e-45
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   169   1e-44
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   168   1e-44
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   168   2e-44
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   164   2e-43
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   165   2e-43
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   165   2e-43
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   164   3e-43
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   160   9e-42
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   160   1e-41
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   156   1e-41
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   159   2e-41
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   158   5e-41
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     157   1e-40
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   156   3e-40
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   155   4e-40
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   154   1e-39
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   154   1e-39
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   153   2e-39
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   154   2e-39
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   153   3e-39
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   153   4e-39
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   152   6e-39
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   151   1e-38
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   151   1e-38
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   151   1e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   149   4e-38
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   150   4e-38
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   149   6e-38
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   147   3e-37
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   147   4e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   140   1e-36
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   142   2e-35
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   140   5e-35
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   137   5e-35
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   132   5e-34
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   137   6e-34
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   133   8e-34
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   133   9e-34
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   133   1e-33
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   137   1e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   133   1e-33
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              131   1e-33
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   133   1e-33
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   130   3e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   132   3e-33
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   131   4e-33
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   131   4e-33
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              130   5e-33
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   131   6e-33
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   130   8e-33
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   134   1e-32
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   134   1e-32
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   128   1e-32
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   130   1e-32
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   130   1e-32
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   130   2e-32
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   133   2e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   129   2e-32
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   128   2e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   129   3e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   127   4e-32
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   132   4e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   132   4e-32
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   128   4e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   131   5e-32
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   127   5e-32
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   128   6e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   131   7e-32
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   130   1e-31
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   125   2e-31
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   129   3e-31
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   125   3e-31
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   129   4e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   126   4e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   129   4e-31
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   129   4e-31
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   129   4e-31
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   129   5e-31
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   128   6e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   128   6e-31
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   125   8e-31
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   123   9e-31
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   124   1e-30
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   127   1e-30
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   127   1e-30
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   127   1e-30
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   127   1e-30
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   127   1e-30
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   127   2e-30
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   126   3e-30
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   122   4e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   122   4e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   125   5e-30
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   121   5e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   125   6e-30
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   125   7e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   125   7e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   124   9e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   124   1e-29
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   124   1e-29
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   124   1e-29
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   124   2e-29
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   124   2e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   123   2e-29
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   122   4e-29
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   119   5e-29
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   122   7e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   121   1e-28
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   120   1e-28
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    121   1e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   116   3e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   120   3e-28
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   120   3e-28
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   120   4e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   119   5e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   119   5e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    119   6e-28
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    119   8e-28
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   117   2e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   117   2e-27
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   117   3e-27
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   117   4e-27
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   113   4e-27
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   114   2e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   112   1e-25
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   112   1e-25
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   112   1e-25
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   112   1e-25
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   110   5e-25
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   110   8e-25
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   108   1e-24
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   108   3e-24
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   108   3e-24
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   105   4e-24
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   107   6e-24
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   106   1e-23
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   105   1e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   105   2e-23
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   105   3e-23
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   105   3e-23
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   104   4e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   104   5e-23
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   103   6e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   101   6e-23
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   103   1e-22
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   103   1e-22
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   102   2e-22
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              102   3e-22
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...   102   3e-22
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   101   5e-22
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...   100   7e-22
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...   100   7e-22
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...   100   2e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    99   3e-21
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    63   1e-11
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    60   4e-09
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    60   5e-09
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    56   1e-07
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    56   1e-07
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    55   2e-07
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    55   3e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    54   4e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    54   5e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    53   7e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    53   7e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    53   1e-06
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    52   2e-06
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    52   2e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    51   3e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    51   3e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    51   4e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    50   5e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    50   5e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    50   6e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    50   6e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    50   7e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    50   7e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    49   2e-05
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    48   4e-05
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    47   8e-05
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    46   2e-04
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    46   2e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    46   2e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   8e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   0.001
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    43   0.001
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    42   0.002
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    42   0.002
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    42   0.003
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    42   0.003
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    41   0.005
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    41   0.005
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    40   0.008
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.009
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    40   0.012
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    40   0.012
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.014
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.015
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.016
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    37   0.085
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    37   0.14 
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    36   0.17 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    36   0.18 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    36   0.18 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    36   0.21 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.21 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    36   0.23 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    36   0.25 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    36   0.25 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    36   0.26 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    35   0.36 
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    35   0.36 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.38 
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    35   0.38 
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    35   0.39 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    35   0.40 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    35   0.44 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    35   0.44 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.46 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    35   0.54 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    35   0.57 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    35   0.59 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    35   0.65 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.66 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    34   0.74 
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    34   0.95 
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    34   0.99 
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    33   1.4  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.5  
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    33   1.5  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.6  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   1.6  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   1.7  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.7  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   1.8  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   1.8  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   1.9  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   2.0  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    33   2.1  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    33   2.1  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    33   2.4  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    33   2.4  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    33   2.5  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    32   2.9  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    32   3.2  
KLTH0G12870g Chr7 complement(1093554..1094732) [1179 bp, 392 aa]...    32   3.2  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    32   3.3  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.4  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    32   3.6  
Kpol_223.4 s223 (4546..6036) [1491 bp, 496 aa] {ON} (4546..6036)...    32   3.6  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   3.9  
Smik_14.114 Chr14 (217529..219280) [1752 bp, 583 aa] {ON} YNL218...    32   4.1  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   4.6  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   4.7  
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...    32   5.0  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   5.4  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   5.5  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    32   5.5  
CAGL0M08822g Chr13 (880145..882508) [2364 bp, 787 aa] {ON} highl...    32   5.7  
Ecym_6343 Chr6 complement(660862..664419) [3558 bp, 1185 aa] {ON...    32   5.8  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   6.2  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   6.3  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   6.4  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.1  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   7.2  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    31   7.2  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   7.3  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    31   7.6  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    31   7.7  
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    31   8.2  
SAKL0A03982g Chr1 complement(369575..373072) [3498 bp, 1165 aa] ...    31   9.1  
Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C...    31   9.5  

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/471 (94%), Positives = 444/471 (94%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEKYKAPA            TPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE
Sbjct: 1   MPPKEDWEKYKAPAEEDKEKSNDEKNTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
           NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL
Sbjct: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA
Sbjct: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
           ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACIVFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/473 (85%), Positives = 417/473 (88%), Gaps = 11/473 (2%)

Query: 1   MPPKEDWEKYKAP--AXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKD 58
           MPPKEDWEKYKAP               TPLTE DIQVLKTYGAAPYA KLKETEKDLKD
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 59  IENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNED 118
           IE RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+ +   E  N++
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 119 GLDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 178
           G        NG ++ E     + DDDE+AKYVINLKQIAKFVVGLGERVSPTDIEEGMRV
Sbjct: 121 G--------NG-ENGESASANDADDDEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 171

Query: 179 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPER 238
           GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKEQIEKLREVVELPLLSPER
Sbjct: 172 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPER 231

Query: 239 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 298
           FA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL
Sbjct: 232 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 291

Query: 299 FEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFA 358
           FEMARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFA
Sbjct: 292 FEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFA 351

Query: 359 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS 418
           TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK+MSVERGIRWELISRLCPNS
Sbjct: 352 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPNS 411

Query: 419 TGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           TGAELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 412 TGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/472 (84%), Positives = 413/472 (87%), Gaps = 20/472 (4%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXT-PLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59
           MPPKEDWEKYKAP               PL+EGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82

Query: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKIIRSN          
Sbjct: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSN---------- 132

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
             +A  +R+G ++        G+DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 133 -PSADASRSGANT--------GEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 183

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 184 VDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 243

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 244 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 303

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 304 EMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 363

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST
Sbjct: 364 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 423

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIR+RRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 424 GAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/471 (85%), Positives = 413/471 (87%), Gaps = 15/471 (3%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKE+WEKY AP              PL+EGDIQVLKTYGAAPYA KLKE EKDLKDIE
Sbjct: 1   MPPKENWEKYTAPIEEEETEEEKKV-VPLSEGDIQVLKTYGAAPYANKLKEIEKDLKDIE 59

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+    G+S +    
Sbjct: 60  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK----GDSSSSSPE 115

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           DT         SN    +EE  DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 116 DT--------QSNSSPNSEE--DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 165

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA
Sbjct: 166 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFA 225

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 226 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 285

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 286 MARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 345

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG
Sbjct: 346 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 405

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 406 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/471 (83%), Positives = 414/471 (87%), Gaps = 3/471 (0%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           M PKEDW+KYKAP             TPL+EGDIQVLKTYGAAP AGKLK+TEKDLK+I 
Sbjct: 1   MAPKEDWDKYKAPIEDDKTTVDEKI-TPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKEIR 59

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEK GVKESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKII++N + E  N + +
Sbjct: 60  KRIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLE--NSNSM 117

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           D  +     LD        + D+DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 118 DNNSTNNTPLDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 177

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 178 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFA 237

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 238 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 297

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 298 MARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 357

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTG
Sbjct: 358 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 417

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 418 AELRSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/472 (85%), Positives = 416/472 (88%), Gaps = 1/472 (0%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXT-PLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59
           M PKEDWEKYKAP             + PLTEGDIQVLKTYGAAPYA KLKETEKDLK+I
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAPYAAKLKETEKDLKEI 60

Query: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+S+   E  +E  
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSASNEVSDESA 120

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
           ++ A    +    +      EGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 121 VNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 180

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 181 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 240

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 241 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 300

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 301 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 360

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNST
Sbjct: 361 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCPNST 420

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/471 (84%), Positives = 410/471 (87%), Gaps = 26/471 (5%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEK+KAPA             PLTEGDIQVLKTYGAAPYA KLKETEKDLKDIE
Sbjct: 1   MPPKEDWEKFKAPAEEEKQEEKPN--VPLTEGDIQVLKTYGAAPYADKLKETEKDLKDIE 58

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+     ES  ++  
Sbjct: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASDESPADE-- 116

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
                                 D+ED+KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 117 ----------------------DEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGV 154

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA
Sbjct: 155 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFA 214

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
           ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 215 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 274

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MART+KACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 275 MARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 334

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTG
Sbjct: 335 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 394

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 395 AELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/472 (84%), Positives = 410/472 (86%), Gaps = 17/472 (3%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXT-PLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59
           M PKEDWEKYK P               PLTEGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDKIKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 60

Query: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119
           E RIKEKAGVKESDTGLAPSHLWDI+GDRQ+LSE HPLQVARCTKII+S     SR+  G
Sbjct: 61  EQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSE---PSRDSAG 117

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
             ++              T  GDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 118 GSSSA-------------TTVGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 164

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 165 VDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 224

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 225 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 284

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 285 EMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 344

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST
Sbjct: 345 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 404

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIR+RRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 405 GAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/471 (83%), Positives = 412/471 (87%), Gaps = 8/471 (1%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           M PKEDWEKYKAP              PL+EGDIQVLK+YGAAPY  K+KETEKDLK IE
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+ + E    N D  
Sbjct: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSE----NGDES 116

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           ++ +   NG  +         DD+E+AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 117 NSESTEGNGTANT----NTAADDNEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 172

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 173 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFA 232

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 233 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 292

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 293 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 352

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG
Sbjct: 353 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 412

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 413 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/471 (84%), Positives = 415/471 (88%), Gaps = 3/471 (0%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEKYKAP              PLTEGDIQVLK+YGAAPYA KLK+TE DLKDIE
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKII+ +GE +    D  
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTDNN 120

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           + +    NG  ++     +  +DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 NDSV---NGNSNSNQESADVDEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 177

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 178 DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFA 237

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 238 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 297

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 298 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 357

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTG
Sbjct: 358 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 417

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 418 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/472 (85%), Positives = 422/472 (89%), Gaps = 5/472 (1%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXX-TPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59
           MPP+EDWEKYKAP              +PL+EGDIQVLKTYGAAPYA KLKETEKDLKDI
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60

Query: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+S  +  + N +G
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSD-SNENGEG 119

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
           LD A  A  G  S E R+ ++ ++DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 120 LDGA--AGPGATS-ENRDADDAEEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 176

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERF
Sbjct: 177 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERF 236

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 237 AKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 296

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMAR+KKACIVFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 297 EMARSKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 356

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNST
Sbjct: 357 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST 416

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/471 (84%), Positives = 415/471 (88%), Gaps = 4/471 (0%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEKYKAP              PLTEGDIQVLK+YGAAPYA KLK+TE DLKDIE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKII+ NGE +    D  
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNN 120

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           ++         ++  + T+  +DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 NSGNSNS----NSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 176

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 177 DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFA 236

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 237 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 296

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 297 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 356

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTG
Sbjct: 357 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 416

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 417 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/474 (84%), Positives = 418/474 (88%), Gaps = 3/474 (0%)

Query: 1   MPPKEDWEKYKAP--AXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKD 58
           MPPKEDWEKYKAP  A             PL+EGDIQVLKTYGAAPYA KLKE EKDLK 
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 59  IENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNED 118
           IEN+IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+SNG  E +  +
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 119 GLDTATLARNGLDSNEPRETEEGDD-DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 177
           G   A+      +++     E G+D DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180

Query: 178 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 237
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240

Query: 238 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 297
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300

Query: 298 LFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 357
           LFEMARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 301 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 360

Query: 358 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 417
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420

Query: 418 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/472 (84%), Positives = 417/472 (88%), Gaps = 5/472 (1%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEKYKAP              PLTEGDIQVLK+YGAAPYA KLK+TE DLKDIE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPNDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTESDLKDIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNED-G 119
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKII+ NGE    N+D  
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGE----NDDPT 116

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
            D  + + N   ++  +  +  +DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 117 TDNNSNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 176

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERF
Sbjct: 177 VDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERF 236

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 237 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 296

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 297 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 356

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNST
Sbjct: 357 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST 416

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/472 (83%), Positives = 407/472 (86%), Gaps = 25/472 (5%)

Query: 1   MPPKEDWEKYKAPA-XXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59
           MPPK+DWEKYK P               PLTEGDIQVLKTYGAAPYA KLK TE+DLK I
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQIAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKKI 60

Query: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119
           E RIKEKAGVKESDTGLAPSH+WD+MGDRQRLSEEHPLQVARCTKII+S+ E        
Sbjct: 61  EARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKSSSE-------- 112

Query: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179
                    G + NE        D++DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 113 --------EGAEGNE--------DEDDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 156

Query: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239
           VDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 157 VDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 216

Query: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 217 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 276

Query: 300 EMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 359
           EMARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 277 EMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 336

Query: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+K+MSVER IRWELISRLCPNST
Sbjct: 337 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPNST 396

Query: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           GAELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 397 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/471 (84%), Positives = 414/471 (87%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKE+WEKYKAP              PLTEGDIQVLK+YGAAPYA KLK+TE DLKDIE
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDEDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKII+ NGE +    +  
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTNNN 120

Query: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180
           +    + N   ++     +  +DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 NDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240
           DRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 181 DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFA 240

Query: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300
           ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 301 MARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 360
           MARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNSTG 420

Query: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           AELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/476 (82%), Positives = 409/476 (85%), Gaps = 6/476 (1%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXXXTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60
           MPPKEDWEKYKAP              PL+EGDI+VLKTYGAAPYA KLK  E DLK+IE
Sbjct: 1   MPPKEDWEKYKAPIEDEESKEEKKV-VPLSEGDIEVLKTYGAAPYAKKLKSIENDLKEIE 59

Query: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRS-----NGEGESR 115
            +IKEKAGVKESDTGLAPSHLWDI+GDRQRLSEE PLQVARCTKII++     +G     
Sbjct: 60  KKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEKPQRSGNALGG 119

Query: 116 NEDGLDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEG 175
           + DG   A  A     +       E +DD+DAKYVINLKQIAKFVVGLGERVSPTDIEEG
Sbjct: 120 DADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIEEG 179

Query: 176 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 235
           MRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS
Sbjct: 180 MRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239

Query: 236 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 295
           PERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV
Sbjct: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299

Query: 296 RELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 355
           RELFEMARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKV
Sbjct: 300 RELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKV 359

Query: 356 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC 415
           MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC
Sbjct: 360 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC 419

Query: 416 PNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           PNSTGAELRSVCTEAGMFAIRARRKV TEKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 420 PNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/478 (80%), Positives = 406/478 (84%), Gaps = 8/478 (1%)

Query: 1   MPPKEDWEKYKAPAXXXXXXXXXXX---XTPLTEGDIQVLKTYGAAPYAGKLKETEKDLK 57
           MPPKEDWEK K PA                PLTE DIQVLKTYG APYA KLKETE DLK
Sbjct: 1   MPPKEDWEKQK-PAVENAEDDAAKKGEDVAPLTEDDIQVLKTYGVAPYAVKLKETENDLK 59

Query: 58  DIENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNE 117
           +IE RIKEKAGV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKII+S     + + 
Sbjct: 60  EIEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSG 119

Query: 118 DGLDTATLARNGLDSNEPRETEEGDDDED----AKYVINLKQIAKFVVGLGERVSPTDIE 173
           +  + A     G  +       +    +D    +KYVINLKQIAKFVVGLGERVSPTDIE
Sbjct: 120 NNSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIE 179

Query: 174 EGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPL 233
           EGMRVGVDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPL
Sbjct: 180 EGMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPL 239

Query: 234 LSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 293
           LSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR
Sbjct: 240 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 299

Query: 294 MVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNI 353
           MVRELFEMARTK+ACI+FFDEI               NEVQRTMLELITQLDGFDPRGNI
Sbjct: 300 MVRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNI 359

Query: 354 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISR
Sbjct: 360 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISR 419

Query: 414 LCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471
           LCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 420 LCPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/431 (84%), Positives = 381/431 (88%), Gaps = 24/431 (5%)

Query: 41  GAAPYAGKLKETEKDLKDIENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 100
           GAAPYA KLK  +KDLKDIE +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 101 RCTKIIRSNGEGESRNEDGLDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFV 160
           RCTKII+     ++  E+                        D+ED+KY+INLKQIAKFV
Sbjct: 63  RCTKIIKPEASEDNTGEE------------------------DEEDSKYIINLKQIAKFV 98

Query: 161 VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 220
           VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE
Sbjct: 99  VGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 158

Query: 221 QIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 280
           QI+KLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG
Sbjct: 159 QIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 218

Query: 281 SELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLEL 340
           SELVQKYVGEGARMVRELFEMART+KACI+FFDEI               NEVQRTMLEL
Sbjct: 219 SELVQKYVGEGARMVRELFEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLEL 278

Query: 341 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSM 400
           ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSM
Sbjct: 279 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM 338

Query: 401 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKK 460
           SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKK
Sbjct: 339 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 398

Query: 461 FSSTSRYMQYN 471
           FSSTS+YMQYN
Sbjct: 399 FSSTSQYMQYN 409

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/387 (86%), Positives = 345/387 (89%), Gaps = 2/387 (0%)

Query: 85  MGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGLDTATLARNGLDSNEPRETEEGDDD 144
           MGDRQRLSEEHPLQVARCTKII+ N    +  EDG D      +   SN        +D+
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTS--TSNNSNAENAEEDE 58

Query: 145 EDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTV 204
           ED KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTV
Sbjct: 59  EDNKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTV 118

Query: 205 EEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCA 264
           EEKPD+TYSDVGGCK+QIEKLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCA
Sbjct: 119 EEKPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCA 178

Query: 265 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX 324
           RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACI+FFDEI         
Sbjct: 179 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFD 238

Query: 325 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                 NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP
Sbjct: 239 DGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 298

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
           DLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA+E
Sbjct: 299 DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVASE 358

Query: 445 KDFLKAVEKVINGYKKFSSTSRYMQYN 471
           KDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 359 KDFLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  312 bits (799), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 210/311 (67%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQE 380

Query: 446 DFLKAVEKVIN 456
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  311 bits (796), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 446 DFLKAVEKVIN 456
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  310 bits (795), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 446 DFLKAVEKVIN 456
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  310 bits (795), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 446 DFLKAVEKVIN 456
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  310 bits (793), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 210/311 (67%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           + K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE
Sbjct: 80  EKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVE 139

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 259

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 260 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 319

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  R  I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 320 VAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 379

Query: 446 DFLKAVEKVIN 456
           DF  AV KV+N
Sbjct: 380 DFELAVAKVMN 390

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 205/301 (68%), Gaps = 1/301 (0%)

Query: 157 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 216
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 217 GCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 276
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 277 RVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQR 335
           RV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 336 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 395
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 396 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVI 455
           H++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 456 N 456
           N
Sbjct: 391 N 391

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 205/300 (68%), Gaps = 1/300 (0%)

Query: 158 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 217
           K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 92  KYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVGG 151

Query: 218 CKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 277
             +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 152 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 211

Query: 278 VIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 336
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 212 VSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 271

Query: 337 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 396
           MLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RIH
Sbjct: 272 MLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIH 331

Query: 397 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVIN 456
           ++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+N
Sbjct: 332 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMN 391

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 208/311 (66%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVE 140

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  +GG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLAR 200

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEG 260

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPT 320

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 446 DFLKAVEKVIN 456
           D   AV KV+N
Sbjct: 381 DLELAVGKVMN 391

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  305 bits (781), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 210/313 (67%), Gaps = 2/313 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 74  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVE 133

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 134 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 193

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX--XXXXX 323
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 194 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 253

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPP 313

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 443
           P +  RA I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTVAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 444 EKDFLKAVEKVIN 456
           ++DF  AV KV+N
Sbjct: 374 QEDFELAVGKVMN 386

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  305 bits (780), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D + ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVE 137

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 326 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  R  I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 378 EDFELAVSKVMN 389

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  304 bits (779), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 82  DKKVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVE 141

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 142 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 201

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX-XXXXXX 324
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 202 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 261

Query: 325 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                 +EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 262 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 321

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 322 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 381

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 382 EDFELAVGKVMN 393

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  304 bits (779), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 204/300 (68%), Gaps = 1/300 (0%)

Query: 158 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 217
           K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 92  KYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVGG 151

Query: 218 CKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 277
             +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 152 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 211

Query: 278 VIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX-XXXXXXXXXXXXNEVQRT 336
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI                +EVQRT
Sbjct: 212 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 271

Query: 337 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 396
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 272 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIH 331

Query: 397 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVIN 456
           ++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+N
Sbjct: 332 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMN 391

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  303 bits (777), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 157 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 216
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 217 GCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 276
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 277 RVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX-XXXXXXXXXXXXNEVQR 335
           RV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI                +EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 336 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 395
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 396 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVI 455
           H++ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 456 N 456
           N
Sbjct: 394 N 394

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  303 bits (775), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 208/315 (66%), Gaps = 4/315 (1%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 72  DTKVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVE 131

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 132 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 191

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX----XXX 321
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 192 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 251

Query: 322 XXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF 381
                    +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF
Sbjct: 252 SSGGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEF 311

Query: 382 SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
             P L  R  I RIH++ M++ RGI    I       +GA+++ VCTEAGM+A+R RR  
Sbjct: 312 PAPTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIH 371

Query: 442 ATEKDFLKAVEKVIN 456
            T++DF  AV KV+N
Sbjct: 372 VTQEDFELAVGKVMN 386

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  302 bits (774), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 76  DKRVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVE 135

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 136 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 195

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX-XXXXXX 324
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 196 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 255

Query: 325 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                 +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 256 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 315

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 316 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 375

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 376 EDFELAVAKVMN 387

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  302 bits (774), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVE 139

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 259

Query: 326 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  302 bits (774), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVE 139

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEG 259

Query: 326 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  301 bits (772), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 202/300 (67%)

Query: 157 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 216
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 217 GCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 276
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 277 RVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRT 336
           RV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 337 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 396
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 397 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVIN 456
           ++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  301 bits (771), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D + ++ ++   K++V +   ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVE 137

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX-XXXXXX 324
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 325 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 384
                 +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 385 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +  RA I +IH++ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARAEILKIHSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 445 KDFLKAVEKVIN 456
           +DF  AV KV+N
Sbjct: 378 EDFELAVAKVMN 389

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  282 bits (721), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 196/307 (63%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 413 MKAVRKV 419

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  280 bits (716), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 194/309 (62%)

Query: 146 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVE 205
           D KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 109 DEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 168

Query: 206 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCAR 265
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+
Sbjct: 169 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAK 228

Query: 266 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX 325
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+          
Sbjct: 229 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 288

Query: 326 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 385
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 289 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 348

Query: 386 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
             G   IF+IHT  +       +E   ++C    GA++R+  TEAG FAIR  R    ++
Sbjct: 349 EAGMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQE 408

Query: 446 DFLKAVEKV 454
           D +KAV KV
Sbjct: 409 DLMKAVRKV 417

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  280 bits (716), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R   T  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  279 bits (714), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV +  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  279 bits (713), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 194/307 (63%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 412 MKAVRKV 418

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  278 bits (711), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 193/307 (62%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 400 MKAVRKV 406

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  278 bits (711), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  277 bits (708), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 194/307 (63%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 106 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 165

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+AV
Sbjct: 166 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAKAV 225

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 226 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 285

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 286 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 345

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 346 GRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 405

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 406 MKAVRKV 412

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  277 bits (709), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +  +    +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   +  Y +
Sbjct: 405 MKAVRKVAE-VKKLEGSLEYQK 425

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 193/307 (62%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            D+++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 414 MKAVRKV 420

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  276 bits (706), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 205/317 (64%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  F V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A  +   I+F DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++ + + +E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTGEDFKQAKERVM 424

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  276 bits (706), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 193/307 (62%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 448 LKAVEKV 454
           +KAV KV
Sbjct: 413 MKAVRKV 419

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  276 bits (706), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  275 bits (704), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            +++++ +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           +    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV +  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  276 bits (705), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            +VT+  +GG  EQI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   +  Y +
Sbjct: 422 MKAVRKVAE-VKKLEGSLEYQK 442

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  275 bits (703), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 200/325 (61%), Gaps = 1/325 (0%)

Query: 143 DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMM 202
           D  D KY++      +++VG+   +  + +++G+RV +D +   I   LP   DP V  M
Sbjct: 129 DLSDEKYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNM 188

Query: 203 TVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTL 262
           T  E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL
Sbjct: 189 TSFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTL 248

Query: 263 CARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXX 322
            A+AVA    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+       
Sbjct: 249 LAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGRR 308

Query: 323 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 382
                    E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E  
Sbjct: 309 FSEGTSADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIP 368

Query: 383 LPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA 442
           LP+  GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R   
Sbjct: 369 LPNEAGRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHI 428

Query: 443 TEKDFLKAVEKVINGYKKFSSTSRY 467
             +D +KAV KV    KK   +  Y
Sbjct: 429 IPEDLMKAVRKVAE-VKKLEGSLEY 452

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  274 bits (701), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 448 LKAVEKVINGYKKFSSTSRY 467
           +KAV KV    KK   +  Y
Sbjct: 411 MKAVRKVAE-VKKLEGSLEY 429

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  275 bits (702), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR +IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 448 LKAVEKVINGYKKFSSTSRY 467
           +KAV KV +  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  274 bits (701), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  IF+IHT  +       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 415 MKAVRKVAE-VKKLEGTLEYQK 435

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  274 bits (701), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 109 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 166

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 167 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 226

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 227 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 286

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 287 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 346

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 347 ILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLALRER 406

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 407 RMQVTSEDFEQAKERVL 423

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTAEDFKQAKERVM 424

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  271 bits (693), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 200/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  F V +   V    +  G  V +      I   L   +DP 
Sbjct: 49  EEIIDDDHA--IVTSPTMPDFYVSILSFVDKELLGPGCAVSLHHKTMSIVGVLQDDVDPM 106

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +Y D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 107 VSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 166

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      I+F DEI   
Sbjct: 167 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVASENSPSIIFIDEIDAI 226

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD    +KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 227 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVKVIMATNKIETLDPALIRPGRIDRK 286

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   + +E +     + +GA+++++CTEAG+ A+R R
Sbjct: 287 ILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTTKDDLSGADIQAMCTEAGLLALRER 346

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 347 RMQVTAEDFKQAKERVM 363

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  273 bits (697), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL+ +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +  E+V+
Sbjct: 408 RMQVTAEDFKQGKERVL 424

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  272 bits (696), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      +   L    DP 
Sbjct: 108 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHNKTMSVVGVLQDDADPM 165

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 166 VSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 225

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 226 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEIDAI 285

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 286 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 345

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA++++VCTEAG+ A+R R
Sbjct: 346 ILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLALRER 405

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 406 RMQVTAEDFKQAKERVM 422

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  270 bits (691), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 204/330 (61%), Gaps = 2/330 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  +I       F V +   V    +E G  V +      I   L    DP 
Sbjct: 49  EEIIDDDHA--IITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPM 106

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           + +M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 107 INVMKIDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 166

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      IVF DEI   
Sbjct: 167 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAI 226

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 227 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 286

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 287 ILFENPDISTKRKILTIHTSKMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRER 346

Query: 439 RKVATEKDFLKAVEKVINGYKKFSSTSRYM 468
           R   T +DF +A E+++    + +  S Y+
Sbjct: 347 RMQVTAEDFKQAKERILKNKVEENLESLYL 376

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  272 bits (695), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 141/330 (42%), Positives = 206/330 (62%), Gaps = 2/330 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++       F V +   V    +E G  V +      I   L    DP 
Sbjct: 109 EEIIDDDHA--IVTSPTTPDFYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPM 166

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 167 VSVMKIDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 226

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 227 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 286

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 287 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 346

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   I  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 347 ILFENPDISTKRKILGIHTSKMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRER 406

Query: 439 RKVATEKDFLKAVEKVINGYKKFSSTSRYM 468
           R   T +DF +A E+V+    + +  S Y+
Sbjct: 407 RMQVTAEDFKQAKERVMKNKVEENLESLYL 436

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  271 bits (694), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 193/297 (64%)

Query: 172 IEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVEL 231
           +E G  V +      I   L    DP +++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDTDPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVEL 200

Query: 232 PLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 291
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 292 ARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 351
            R+ R++F++A      IVF DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 352 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELI 411
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL  +  I  IHT  MS+   +  E +
Sbjct: 321 DVKVIMATNKIESLDPALIRPGRIDRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEEL 380

Query: 412 SRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYM 468
                + +GA+++++CTEAG+ A+R RR   T +DF +A E+V+    + +    YM
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  271 bits (694), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 106 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 163

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 164 VSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 223

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 224 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 283

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 284 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 343

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 344 ILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLALRER 403

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 404 RMQVTAEDFKQAKERVM 420

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  271 bits (694), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKRKILGIHTSKMNLCEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTGEDFKQAKERVM 424

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  271 bits (693), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 180/260 (69%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           DP +  M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGA 224

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEI 284

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                           EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRI 344

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           DRK+ F  PD+  +  I  IHT  M++   +R + +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 436 RARRKVATEKDFLKAVEKVI 455
           R RR   T +DF +A E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  271 bits (692), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 200/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++       F V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPAESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   +  E +       +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDITTKRKILGIHTSKMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTVEDFKQAKERVM 424

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 201/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTGPTMPDYYVSILSFVDKELLEPGCSVLLHNKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +  E+V+
Sbjct: 408 RMQVTAEDFKQGKERVL 424

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++    +  + V +   V    +E G  V +      I   L    DP 
Sbjct: 107 EEIIDDDHA--IVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 164

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  TYSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 165 VSVMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 224

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      IVF DEI   
Sbjct: 225 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEIDAI 284

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 285 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRIDRK 344

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PDL  +  I  IHT  MS+   +  + +     + +GA+++++CTEAG+ A+R R
Sbjct: 345 ILFENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLALRER 404

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T KDF +  E+V+
Sbjct: 405 RMQVTAKDFEQGKERVL 421

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 194/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QAR 423

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 201/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++       F V +   V    +E G  V +      I   L    DP 
Sbjct: 110 EEIIDDDHA--IVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPM 167

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 168 VSVMKIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 227

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 228 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 287

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 288 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 347

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R R
Sbjct: 348 ILFENPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRER 407

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 408 RMQVTVEDFKQAKERVM 424

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  269 bits (688), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  270 bits (689), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 148 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 207
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 447
           GR  +F+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 448 LKAVEKVINGYKKFSSTSRYMQ 469
           +KAV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  269 bits (687), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 198/317 (62%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  +I       F V +   V    +E G  V +      I   L    DP 
Sbjct: 128 EEIIDDDHA--IITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPM 185

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           + +M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 186 INVMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 245

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      IVF DEI   
Sbjct: 246 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAI 305

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 306 GTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 365

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   +  + +     + +GA+++++CTEAG+ A+R R
Sbjct: 366 ILFENPDITTKRKILAIHTSKMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRER 425

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+++
Sbjct: 426 RMQVTAEDFKQAKERIL 442

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  268 bits (684), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEG+++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  267 bits (682), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV--QAR 414

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  267 bits (682), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEG+++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  267 bits (682), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  267 bits (682), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 135/317 (42%), Positives = 200/317 (63%), Gaps = 2/317 (0%)

Query: 139 EEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 198
           EE  DD+ A  ++       + V +   V    +E G  V +      +   L    DP 
Sbjct: 107 EEIVDDDHA--IVTSPTTPDYYVSILSFVDKELLEPGCSVLLHHKTMSVVGVLQDDADPM 164

Query: 199 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 258
           V++M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGT
Sbjct: 165 VSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGT 224

Query: 259 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXX 318
           GKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI   
Sbjct: 225 GKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAI 284

Query: 319 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 378
                        E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK
Sbjct: 285 GTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRK 344

Query: 379 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           + F  PD+  +  I  IHT  M++   +  + +     + +GA+++++CTEAG+ A+R R
Sbjct: 345 ILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRER 404

Query: 439 RKVATEKDFLKAVEKVI 455
           R   T +DF +A E+V+
Sbjct: 405 RMQVTAQDFKEAKERVL 421

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  266 bits (680), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  266 bits (680), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (679), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+    I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  266 bits (680), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QAR 451

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  265 bits (678), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  266 bits (679), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  264 bits (675), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  263 bits (671), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 160 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 219
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 220 EQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 279
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 280 GSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 339
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 340 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 399
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 400 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYK 459
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 460 KFSSTSRY 467
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  253 bits (645), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 177/278 (63%), Gaps = 5/278 (1%)

Query: 176 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 235
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 236 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 295
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 296 RELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 355
           R++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 356 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 414
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 415 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  251 bits (642), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 180/293 (61%), Gaps = 8/293 (2%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q +++RE VELPL 
Sbjct: 159 SMSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLT 218

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 219 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRM 278

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 279 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVK 338

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 339 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 396

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKAVE---KVINGYKKF 461
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A +   K  N   KF
Sbjct: 397 IIRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  250 bits (639), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 428
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 429 EAGMFAIRARRKVATEKDFLKA 450
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  250 bits (639), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSL 369

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  250 bits (639), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/263 (49%), Positives = 171/263 (65%), Gaps = 5/263 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     IV
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS--TGAELRSVC 427
           RPGR+DRK+EF SL D   R  IF      MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 428 TEAGMFAIRARRKVATEKDFLKA 450
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  249 bits (637), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 428
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 429 EAGMFAIRARRKVATEKDFLKA 450
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  249 bits (637), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+
Sbjct: 137 SMSVALYRYSNALVDILPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLV 196

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 197 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 256

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 257 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 316

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 317 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 374

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 375 IVRNDSLSGAIIAAIMQEAGLRAVRKNRYVILQSDLEEA 413

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (636), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  249 bits (636), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (635), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  250 bits (639), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 170/259 (65%), Gaps = 3/259 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 428
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 429 EAGMFAIRARRKVATEKDF 447
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  249 bits (635), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 372

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  248 bits (634), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSL 368

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 369 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  248 bits (632), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 428
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 429 EAGMFAIRARRKVATEKDFLKA 450
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  248 bits (632), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  248 bits (632), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 181/295 (61%), Gaps = 5/295 (1%)

Query: 159 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 218
           +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY+DVGG 
Sbjct: 122 YVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGGL 181

Query: 219 KEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 278
             Q +++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV
Sbjct: 182 DMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRV 241

Query: 279 IGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 338
            GSE V KY+GEG RMVR++F +AR     I+F DE+                EVQR ++
Sbjct: 242 NGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILI 301

Query: 339 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHT 397
           EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF    
Sbjct: 302 ELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVA 361

Query: 398 KSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
             M++      +L S +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 362 AKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  240 bits (612), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 175 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 234
            M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 235 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 294
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 295 VRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 354
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 355 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 413
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSL 369

Query: 414 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 450
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  238 bits (608), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M+  EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 371 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 428
           RPGR+DRK+EF SL D   R  IF      M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 429 EAGMFAIRARRKVATEKDFLKA 450
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  209 bits (531), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  181 bits (459), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 136/241 (56%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 436 R 436
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  208 bits (529), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  186 bits (472), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 436 R----ARRKVATEK 445
           +    A+R++  +K
Sbjct: 710 KDSIEAQRQLEAKK 723

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  204 bits (518), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  180 bits (457), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 142/250 (56%), Gaps = 1/250 (0%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 436 RARRKVATEK 445
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  207 bits (527), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           D+ Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 436 R 436
           +
Sbjct: 715 K 715

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  207 bits (526), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG     E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 436 R----ARRKVATEKD 446
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  206 bits (524), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 140/241 (58%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD  GR +I     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  206 bits (524), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 144/254 (56%), Gaps = 4/254 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 436 R----ARRKVATEK 445
           +    A+R+   E+
Sbjct: 710 KDSIEAQRRALAEQ 723

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  206 bits (523), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/262 (36%), Positives = 148/262 (56%), Gaps = 5/262 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 436 RAR---RKVATEKDFLKAVEKV 454
           +     +K+  E   +KA E +
Sbjct: 709 KESIELQKLLEESKEVKAEEDI 730

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  206 bits (523), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  206 bits (523), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  187 bits (475), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 142/250 (56%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 436 RARRKVATEK 445
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 436 R----ARRKVATEKD 446
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  187 bits (475), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 143/241 (59%), Gaps = 2/241 (0%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT++D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD E R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 436 R 436
           +
Sbjct: 707 K 707

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  181 bits (458), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 142/251 (56%), Gaps = 3/251 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 436 RARRKVATEKD 446
           +   +   E++
Sbjct: 699 KDSIQANIERE 709

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  184 bits (467), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  204 bits (520), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  204 bits (520), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I  IHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  187 bits (474), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 436 R----ARRKVATEK 445
           R    A+++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  204 bits (520), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 137/241 (56%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 436 R----ARRKVATEKD 446
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 436 R----ARRKVATEKD 446
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQREAEKE 724

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I  IHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 138/241 (57%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 436 R 436
           R
Sbjct: 711 R 711

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  204 bits (518), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 140/241 (58%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +V+++DVGG +E  E+LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R  I +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 436 R 436
           +
Sbjct: 710 K 710

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  203 bits (516), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  181 bits (458), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 144/254 (56%), Gaps = 3/254 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG ++   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 436 RAR---RKVATEKD 446
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 269 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX 328
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 329 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 388 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  + RIHTK+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 196 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 255
           +PS    TV E  +VT+ D+GG  E   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 256 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEI 315
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 316 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 375
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 376 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           D+ +   LPD  GR +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 436 R 436
           +
Sbjct: 707 K 707

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  194 bits (493), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 158/279 (56%), Gaps = 25/279 (8%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 435
           PDL+ RA I +IHTK  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 436 -RARRKVATE--------KDFLKAVEKVINGYKKFSSTS 465
            R+  K+  +         DF+ A+EK++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  193 bits (490), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 157/269 (58%), Gaps = 25/269 (9%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+ ++  ++FFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 435
           PD+ GR  I +IHTK+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 436 -RARRKVATE--------KDFLKAVEKVI 455
            R+  K+A +        KDF+ A++K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  191 bits (486), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 151/269 (56%), Gaps = 25/269 (9%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++++ DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR------ 436
           PD + RA I +IHTK+        + E + ++     GA+LR++CTEA +F I+      
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 437 ----------ARRKVATEKDFLKAVEKVI 455
                      R    T  DF+ A++K++
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIV 612

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  179 bits (454), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 108/156 (69%)

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 346
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  191 bits (484), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+LE RA I RIHTKS        + + ++ L     GA+LR++CTEA + +I+
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQ 602

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 434
           PDL  R+ I  IHTK        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 435 IRARRKV------------------ATEKDFLKAVEKVI 455
           I  +RKV                     +DF+ A+EK++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 154/270 (57%), Gaps = 27/270 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 384 PDLEGRANIFRIHTKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--- 438
           PD++ RA I  IHT+  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 439 -------------RKVATEKDFLKAVEKVI 455
                        +   +  DF+ A+EK++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 153/269 (56%), Gaps = 25/269 (9%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 435
           PDLE R  I  IHTK  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 436 -RARRKVATE--------KDFLKAVEKVI 455
            R+ +K+  +         DF+ A+EK+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 157/279 (56%), Gaps = 25/279 (8%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++++ DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 435
           PD + R+ I +IHTK  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 436 -RARRKV--------ATEKDFLKAVEKVINGYKKFSSTS 465
            R+  K+         T  DF+ A+EK++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  189 bits (480), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 156/271 (57%), Gaps = 29/271 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ ++DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 269 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXX 322
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  I+FFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 323 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 382
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 383 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 435
           LPD + RA I  IHTK         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 436 -----------RARRKVATEKDFLKAVEKVI 455
                      +++ KV T KDF+ A++K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  189 bits (480), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 152/271 (56%), Gaps = 29/271 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    IE+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 435
           PD   R  I +IHTK  S    +  ELI RL   +    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSPP--LSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 436 ---RARRKV--------ATEKDFLKAVEKVI 455
              R+  K+            DF +A+EK++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 158/270 (58%), Gaps = 27/270 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           D+ + +VGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 269 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXX 322
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  I+FFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 323 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 382
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 383 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 435
           LPD++ R+ I  IHTK  +     +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 436 --RARRKVATEK--------DFLKAVEKVI 455
             ++ +K+  +         DF+ A+EK++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  187 bits (476), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 202 MTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKT 261
              E    + ++DV GC E  E++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 262 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXX 321
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 322 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 380
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 381 FSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 437
             LP+LEGR  IF +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 438 RRKVATEKDFLKAVEKVINGYKKFS 462
                    F KA+E+VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  188 bits (478), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 435
           PDL+ R  I  IHTK  +    I  + IS+L   +    GA+LR++CTEA + +I     
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 436 ---RARRKVATE--------KDFLKAVEKVI 455
              ++  K+  +        +DF+ A+EK++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  188 bits (477), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 150/268 (55%), Gaps = 25/268 (9%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 439
           PD+  RA I  IHT+         + E ++ L     GA+LR++CTEA + +I+ R    
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQY 602

Query: 440 -KVAT------------EKDFLKAVEKV 454
            KV+              KDF+ A+EK+
Sbjct: 603 IKVSQVGNKPKGKCQVKAKDFMIAMEKI 630

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  185 bits (470), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V++ DV GC E  +++ E V   L  PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR++FE AR     I+F DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 388 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
               T K F +A+E+VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 151/269 (56%), Gaps = 27/269 (10%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                ++   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 439
           PD   RA I  IHTK  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 440 --------------KVATEKDFLKAVEKV 454
                         KV T KDF+ A++K+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  185 bits (469), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 388 GRANIFRIHTKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
            +    K F +A+E+VI G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H   + +  GI ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  186 bits (473), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 155/269 (57%), Gaps = 25/269 (9%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++++ +VGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 384 PDLEGRANIFRIHTKSMSVERG-IRWELISRLCPNSTGAELRSVCTEAGMFAI------- 435
           PDL+ R+ I +IHTK        +  E ++ L     GA+LR++CTEA + +I       
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRKFPQI 623

Query: 436 -RARRKVATE--------KDFLKAVEKVI 455
            ++  K++ +        +DF+ A++K+I
Sbjct: 624 YQSNLKLSIDPKDVKVKARDFMIALDKII 652

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (473), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + DVGG    I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 269 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  I+FFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 434
           P LE R+ I  IHTK        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 435 IRARRKV------------------ATEKDFLKAVEKVI 455
           I  +RK+                     +DF+ A+EK++
Sbjct: 640 I--QRKLPQIYQSDIKLHIDPSTVNVKARDFMLALEKIV 676

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  184 bits (466), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 149/261 (57%), Gaps = 9/261 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V++ DV GC E  +++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXX--XX 327
                F+ V GSE V+ +VG GA  VR+LFE AR+    I+F DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 388 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
           GR  I+ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 442 ATEKDFLKAVEKVINGYKKFS 462
            T   F +A+E+VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 149/267 (55%), Gaps = 8/267 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           + PS       E P V +SD+GG  E   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD + R  I R  T   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 434 AIRAR---RKVATEKDFLKAVEKVING 457
           +I       KV+TE  F KA+  +  G
Sbjct: 727 SIMENVETEKVSTEH-FEKALRDLSRG 752

 Score =  166 bits (419), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           VTY+ VGG   +IE L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            T+A  + + G  +V KY+GE    +R++F  A   +  IVF DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 330 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 389
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 390 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 436
            +I     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 436
           PD++ R+ I +I T+  S    I + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQ 645

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  183 bits (465), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/263 (37%), Positives = 147/263 (55%), Gaps = 11/263 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E   ++ E V   L  P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 388 GRANIFRIHTKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARR 439
           GR  I+++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 440 KVATEKDFLKAVEKVINGYKKFS 462
                 +F +A+E+VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           VT+ DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  185 bits (469), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  ++FFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 436
           PD++ R+ I +I TK  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  182 bits (463), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E   ++ E V+  L +PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 388 GRANIFRIHTKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
                 + F +A+E+VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  183 bits (465), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     +VF DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 446 DFLKAVEKVINGYKKFS 462
            F +AVE+VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  183 bits (465), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 143/261 (54%), Gaps = 7/261 (2%)

Query: 180 VDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 235
           +DRSK  + L         I PS       E P V +SD+GG  +   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 236 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 295
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 296 RELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 355
           RE+F  AR     I+FFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 356 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRL 414
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  T   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 415 CPNSTGAELRSVCTEAGMFAI 435
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 136/230 (59%), Gaps = 8/230 (3%)

Query: 212 YSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 271
           Y+DVGG K +I+ L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 272 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXN 331
           +A  + + G  +V KY+GE    +RE+F+ A+  +  I+F DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 332 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 390
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 391 NIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 436
           +I +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  183 bits (464), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +  + PD E R  I R  TK   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 434 AI 435
           AI
Sbjct: 727 AI 728

 Score =  167 bits (423), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 131/232 (56%), Gaps = 8/232 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +TY  VGG  ++++ L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
             +A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 389 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 436
           R +I       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  183 bits (465), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 389 RANIFRIHTKSMSVERGI--RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
           R  IF++H   +++   I      ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 513 RKEIFKVHLSKITLAEDIVDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLEH 572

Query: 447 FLKAVEKVINGYKKFS 462
           F  A+E+VI G ++ S
Sbjct: 573 FEHAIERVIGGVERKS 588

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  183 bits (464), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG  E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD E R  I    TK   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 434 AI--RARRKVATEKDFLKAVEKVING--------YKKFSSTS 465
           AI    + K      F KA+E +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 136/247 (55%), Gaps = 10/247 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + Y  VGG  ++I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 234 LLYEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 293

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 294 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDD 350

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E 
Sbjct: 351 SGEVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEA 410

Query: 389 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR--ARRKVA 442
           R +I      +MS ER    E     I+       GA+L ++C E+ M  I+       A
Sbjct: 411 RLDILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQRGLTEGTA 470

Query: 443 TEKDFLK 449
            +K  LK
Sbjct: 471 MDKTLLK 477

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 150/264 (56%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ DV GC E  +++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR+    I+F DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 388 GRANIFRIHTKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR +I+ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
            K    + F +A+E+VI G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 446 DFLKAVEKVINGYKKFS 462
           +F +A+E+VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           VT+ DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF++H   + +  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + ++DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 446 DFLKAVEKVINGYKKFS 462
            F  A+E+VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 138/234 (58%), Gaps = 9/234 (3%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           +V + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 384 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 436
           PD++ R  I +I T+  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/236 (40%), Positives = 140/236 (59%), Gaps = 13/236 (5%)

Query: 209 DVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 268
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 269 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXX 323
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 324 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 436
           PD++ R  I +I TK  +    +  E I++L        GA+LRS+CTEA + +I+
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQ 651

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 446 DFLKAVEKVINGYKK 460
            F +A+E+VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  180 bits (457), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 156/294 (53%), Gaps = 9/294 (3%)

Query: 172 IEEGMRVGVDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLRE 227
           I+ G+   +DR K  + L         I PS       E P V +SD+GG +E  +K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 228 VVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 287
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 288 VGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 347
           VGE  R +RE+F  AR     I+FFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 348 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGI 406
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  TK   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 407 RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKK 460
             E ++      +GAE+  +C EAG+ AI     + T K   +  EK ++G  K
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAI--MEDLETSKVEARHFEKALSGISK 755

 Score =  160 bits (405), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 141/249 (56%), Gaps = 8/249 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + Y+ VGG  ++I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            T+A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 389 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 444
           R +I       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 445 KDFLKAVEK 453
           ++ LK + K
Sbjct: 476 REKLKVILK 484

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  180 bits (457), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 167/311 (53%), Gaps = 19/311 (6%)

Query: 172 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKL 225
           I+ G++   D S   +++ +         I PS       E P V +SD+GG +E   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 226 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 285
           +E+++LPL + + F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 286 KYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 345
           KYVGE  R +RE+F  AR+    I+FFDEI               +     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEI--DALSPDRDGGSSSSAASHVLTSLLNEID 641

Query: 346 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERG 405
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  I + +TK+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 406 -IRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--RKVATEKDFLKAVEKVING----- 457
            I  E ++R     +GAE+  +C EAG+ AI         T + F KA++ +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 458 ---YKKFSSTS 465
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 6/239 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V+Y+ VG   ++IE LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            +DA  + + G  +V KY+G+    +R++F  A+  +  I+F DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 330 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 389
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 390 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
            +I       MS +R    +    +I+       GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 153/272 (56%), Gaps = 16/272 (5%)

Query: 168 SPTDIEEGMRVGV-DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLR 226
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG ++   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 227 EVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 286
           E+++LPL + + FAALGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 287 YVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 346
           YVGE  R +RE+F  AR     I+FFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 347 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGI 406
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  TK+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 407 RWELISRLCPNS---TGAELRSVCTEAGMFAI 435
             EL++ L   +   +GAE+  +C EAG+ AI
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAI 727

 Score =  167 bits (422), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y  VGG K +I+ L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +RE+F  A+  +  I+F DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 389 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 436
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H + + +  G   +L +RL    P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R  +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 145/261 (55%), Gaps = 11/261 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 388 GRANIFRIHTKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRARR 439
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 440 KVATEKDFLKAVEKVINGYKK 460
                + F +A+E+VI G +K
Sbjct: 536 AFVEFRHFEQAIERVIAGLEK 556

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 144/262 (54%), Gaps = 12/262 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 388 GRANIFRIHTKSMSVERGI---------RWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H K +++E  +             ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 439 RKVATEKDFLKAVEKVINGYKK 460
               T + F +A+E+VI G +K
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEK 564

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 389 RANIFRIHTKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H K + +   I ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 146/267 (54%), Gaps = 6/267 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD+  R  I +  TK  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 434 AIRARRKVATEKDFLKAVEKVINGYKK 460
           AI     VA  K  L+  EK   G  +
Sbjct: 735 AIMEDLDVA--KVELRHFEKAFKGIAR 759

 Score =  169 bits (428), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 144/250 (57%), Gaps = 10/250 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG  ++IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 389 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
           R +I       MS +R +      + I+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 445 KDFLKAVEKV 454
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 388 GRANIFRIHTKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRARR 439
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 440 KVATEKDFLKAVEKVINGYKKFS 462
                K F +A+E+VI G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 208/450 (46%), Gaps = 61/450 (13%)

Query: 32  GDIQVLKTYGAAPYAGKLKETEKDLKDIENRIKEKAG----VKESDTGLAPSHLWDIMGD 87
            +  VL   G +  +  L ETE  L+DI N  K+       + E D+ LAP+   D  G+
Sbjct: 300 ANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEVDS-LAPNRANDDAGE 358

Query: 88  RQRLSEEHPLQVARCTKIIRSNGEGESRNEDGLDTATLARNGLDSNEP---------RET 138
            +          +R    + +   G S    G      A N  +S +P         +E 
Sbjct: 359 VE----------SRVVATLLTLMSGMSAA--GRVVVIAATNRPNSVDPALRRPGRFDQEV 406

Query: 139 EEGDDDEDAKYVINLKQIAKFVVG----LGERVSPTDIEEGMRVGVDRSKYHIE------ 188
           E G  D DA+  I LK  +K         GE +     +    VG D S    E      
Sbjct: 407 EIGIPDADARLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI 466

Query: 189 ---LPLPPRIDPS---VTMMTVE----------------EKPDVTYSDVGGCKEQIEKLR 226
              + L   ID S   VTM  VE                E P V +SD+GG +E   K++
Sbjct: 467 QRGMHLYKDIDSSLLKVTMNDVENAMIEIRPSAMREIFLEMPKVFWSDIGGQEELKRKMK 526

Query: 227 EVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 286
           E+++LPL +   FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 527 EMIQLPLEASATFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEVFNK 586

Query: 287 YVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 346
           YVGE  R +RE+F  AR     I+FFDEI               +     +  L+ ++DG
Sbjct: 587 YVGESERAIREIFRKARAASPSIIFFDEI--DALSPDRDGGSSTSAASHVLTSLLNEIDG 644

Query: 347 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVER-G 405
            +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD + R  I +  TK   +E   
Sbjct: 645 VEELKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDYDARLQILQKCTKKFQIENTN 704

Query: 406 IRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           I+ E ++      +GAE+  +C EAG+ AI
Sbjct: 705 IKLEDLAERTAGCSGAEVVLLCQEAGLAAI 734

 Score =  161 bits (407), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +TY  +GG ++++E L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
             +A  + + G  +V KY+GE    +R++F  A+  +  I+F DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 389 RANIFRIHTKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
           R +I   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 445 KDFLKAVEKV 454
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  178 bits (451), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 154/294 (52%), Gaps = 25/294 (8%)

Query: 179 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPER 238
           GV +SK H              +   E    VT+ DV GC+E  +++ E V+  L +P +
Sbjct: 293 GVGKSKAH--------------LFNKETDVKVTFKDVAGCQEAKQEIMEFVDF-LKNPHK 337

Query: 239 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 298
           +  LG   P+G +L GPPGTGKTL A+AVA      F+ V GSE V+ +VG GA  VR+L
Sbjct: 338 YTELGAKIPRGAILSGPPGTGKTLLAKAVAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL 397

Query: 299 FEMARTKKACIVFFDEIXXXXXXXXXXXXX--XXNEVQRTMLELITQLDGFDPRGNIKVM 356
           FE A      I+F DEI                 +E + T+ +L+ ++DGF     + V+
Sbjct: 398 FEQASKMAPSIIFVDEIDAIGKARGKNGSLGGSNDEREATLNQLLVEMDGFSTSDQVVVL 457

Query: 357 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSV--------ERGIRW 408
             TNRP+ LD ALLRPGR DR V+   PD+EGR  I+ +H K +++        ++ +  
Sbjct: 458 AGTNRPDVLDKALLRPGRFDRHVQIDAPDVEGRKLIYLVHLKKLNLDPLYSEDKQKQLLA 517

Query: 409 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFS 462
             ++ L P  TGA++ + C E+ + A R          F +A+E+VI G +K S
Sbjct: 518 GKLAALTPGFTGADIANACNESALIAARKMDPYVQFTHFEEAIERVIAGLEKKS 571

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 143/245 (58%), Gaps = 8/245 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V Y+ VGG K++   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            TDA  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 389 RANIFRIHTKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 444
           R +I R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 445 KDFLK 449
           +D LK
Sbjct: 504 RDDLK 508

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/266 (35%), Positives = 144/266 (54%), Gaps = 5/266 (1%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V + D+GG +E  +K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    P  + R  I +  TK  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 434 AIRARRKV--ATEKDFLKAVEKVING 457
           AI          ++ F KA+  +  G
Sbjct: 759 AIMEDTTTDKVEQRHFTKALAGISRG 784

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  178 bits (452), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV G  E  E++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  178 bits (451), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF++H K +++  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  177 bits (449), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V++ +V GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 388 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
                   F +A+E+VI G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 389 RANIFRIHTKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
           R  IF++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 447 FLKAVEKVINGYKKFS 462
           F +A+E+VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE ART    I+F DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 388 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR +I+ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
            +    + F +A+E+VI G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
             +  F  V GSE V+ +VG GA  VR+LF  AR+    I+F DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 388 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 442 ATEKDFLKAVEKVINGYKK 460
            T   F +A+E+VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 146/266 (54%), Gaps = 6/266 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG +E  +K++E+++LPL + E F+ LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD+  R  I +  TK  +  E G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADRTEGYSGAEVVLLCQEAGLA 734

Query: 434 AIRARRKVATE--KDFLKAVEKVING 457
           AI     V     + F KA E +  G
Sbjct: 735 AIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  172 bits (436), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 146/252 (57%), Gaps = 14/252 (5%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG  ++IE L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 389 RANIFRIHTKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA 442
           R +I       MS ER      GI+   I+       GA+L ++C E+ M  I  +R + 
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTI--QRGLG 474

Query: 443 TEKDFLKAVEKV 454
           T+ +  K   KV
Sbjct: 475 TDANIDKFSLKV 486

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  +++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE  R     I+F DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 388 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
                   F +A+E+VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 143/266 (53%), Gaps = 6/266 (2%)

Query: 201 MMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGK 260
           M   +    V ++ V GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 261 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXX 320
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 321 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 379
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 380 EFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 436
               P+L GR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 437 ARRKVATEKDFLKAVEKVINGYKKFS 462
                     F +AVE+VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  176 bits (445), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 176/334 (52%), Gaps = 25/334 (7%)

Query: 116 NEDGLDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERV-------- 167
           N + ++   + +N LDS       EG+  +D+   INLK  A  +  L   V        
Sbjct: 435 NIEAVEDMDVDKNKLDS------VEGNSQKDSDSEINLKNTANMIDPLPLSVIQRFIHNY 488

Query: 168 -SPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLR 226
             P + ++  ++ +   KY   L   P I P+         PDVT+S+VG  ++   +L 
Sbjct: 489 PDPLNDDQLNQLTI---KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELN 545

Query: 227 EVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 286
             +  P+  PE +  +GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ K
Sbjct: 546 MAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNK 605

Query: 287 YVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 346
           YVGE  R +R++F  AR    C++FFDE+               + V  T+L   T+LDG
Sbjct: 606 YVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDG 662

Query: 347 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSV 402
            + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ + + +I R  T S    +S 
Sbjct: 663 LNDRHGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSK 722

Query: 403 ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           +  ++  +    C N +GA+L ++  E+ + A++
Sbjct: 723 DVDLKEIVADERCRNFSGADLAALVRESSVLALK 756

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +     + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  175 bits (443), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ DV GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 388 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 439 RKVATEKDFLKAVEKVINGYKKFS 462
            K      F +A+E+VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  175 bits (444), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R +IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 446 DFLKAVEKVINGYKKFS 462
            F +A+E+VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  175 bits (443), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 142/262 (54%), Gaps = 12/262 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           + + DV GC+E  +++ E V   L SP+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXX- 328
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 329 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 388 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 438
           GR  I+ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 439 RKVATEKDFLKAVEKVINGYKK 460
                   F +A+E+VI G +K
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEK 563

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  174 bits (442), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 159/306 (51%), Gaps = 12/306 (3%)

Query: 172 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKL 225
           I+ G+ +  D  K+ + + L         I PS       E P V +SD+GG  E   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 226 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 285
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 286 KYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 345
           KYVGE  R +RE+F  AR+    I+FFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 346 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVE-R 404
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  I +  TK  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 405 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSST 464
           G+  + ++      +GAE+  +C EAG+ AI     V T+ +F +  EK   G  +  + 
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAIMEDLDV-TKVEF-RHFEKAFKGIARGITP 760

Query: 465 SRYMQY 470
              + Y
Sbjct: 761 EMLLYY 766

 Score =  170 bits (430), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 151/283 (53%), Gaps = 16/283 (5%)

Query: 167 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 218
           VS  D+      G    +Y++  P   R   +    T E +          ++Y+ VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 219 KEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 278
            ++IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 279 IGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 337
            G  +V KY+GE    +RE+F  AR  +  I+F DEI                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 338 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 397
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R +I     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 398 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 436
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  174 bits (442), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    I+F DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 388 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 442 ATEKDFLKAVEKVINGYKK 460
            T   F +A+E+VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  175 bits (443), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 109/315 (34%), Positives = 170/315 (53%), Gaps = 18/315 (5%)

Query: 131 DSNEPRETEEGDDD--EDAKYVIN---LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY 185
           D+ E  ET  GD+   ++   +I+   L  + +F+    E +S      G ++ +   KY
Sbjct: 452 DNMEIDETANGDESSLKNTANMIDPLPLSVVQQFIRNYPEPLS------GEQLSLLSIKY 505

Query: 186 HIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGID 245
              L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +GI 
Sbjct: 506 EDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVGIS 565

Query: 246 PPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTK 305
            P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR  
Sbjct: 566 APGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARAS 625

Query: 306 KACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTL 365
             C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +
Sbjct: 626 VPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMI 682

Query: 366 DPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELISR--LCPNSTGA 421
           DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +   + +E I R   C N +GA
Sbjct: 683 DPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFSGA 742

Query: 422 ELRSVCTEAGMFAIR 436
           +L ++  E+ + A++
Sbjct: 743 DLAALVRESSVLALK 757

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ AR+   C+VFFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 147/267 (55%), Gaps = 6/267 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG ++   K++E+++LPL + E F  LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD+  R  I +  TK  ++ E GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 434 AIRARRKVATEKDFLKAVEKVINGYKK 460
           AI     V   K  L+  EK   G  +
Sbjct: 735 AIMEDLDVT--KVELRHFEKAFKGISR 759

 Score =  169 bits (427), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 145/250 (58%), Gaps = 10/250 (4%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG +++IE L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 389 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 444
           R +I       MS +R        +LI+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 445 KDFLKAVEKV 454
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    I+F DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 388 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 442 ATEKDFLKAVEKVINGYKK 460
            T   F +A+E+VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 139/255 (54%), Gaps = 6/255 (2%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 330 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 389 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 445
           R  IF +H K + +   I ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 446 DFLKAVEKVINGYKK 460
            F +A+E+VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+S+VG   +   +L   +  P+  PE +  +G
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQPIKRPELYEKVG 557

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 558 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 617

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               CI+FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 618 ASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 674

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 419
            +DPA+LRPGR+D+ +   LP+ + + +I +   KS    +S +  I+  +    C N +
Sbjct: 675 MIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNFS 734

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L ++  E+ + A++
Sbjct: 735 GADLAALVRESSVLALK 751

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P    + +GG  + I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A+    C+VFFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 328 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXX--XXX 327
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    I+F DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 328 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 387
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 388 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 441
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 442 ATEKDFLKAVEKVINGYKK 460
            T   F +A+E+VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ VRELF  AR++   IVF DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 419
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 129/232 (55%), Gaps = 6/232 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P+ +   +GG  + I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A++   C+VFFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 435
           P+   R +I +  +  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELI--SRLCPNST 419
            +DPA+LRPGR+D+ +   LP++E + +I +  TKS    +   + +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A++   C+VFFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I R  +  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 419
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A++   C+VFFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 165/312 (52%), Gaps = 20/312 (6%)

Query: 136 RETEEGDDDEDA-KYVIN------LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 188
           ++TE  D+DE + K   N      L  I KF+    E   P + E+   + +   +Y   
Sbjct: 438 QDTENKDEDEKSLKNTANMIDPLPLTIIQKFIQNFPE---PLNDEQLSNLSI---QYEDF 491

Query: 189 LPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPK 248
           L   P I P+         PDVT++ VG   +   +L   +  P+  PE +  +GI  P 
Sbjct: 492 LKALPTIQPTAKREGFATVPDVTWASVGALTKVRVELNMAIVQPIKKPELYEKVGISAPA 551

Query: 249 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 308
           G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C
Sbjct: 552 GVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPC 611

Query: 309 IVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 368
           ++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA
Sbjct: 612 VIFFDELDALVPRRDSTLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPA 668

Query: 369 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNSTGAELR 424
           +LRPGR+D+ +   LP+ E + +I +   ++    MS +  +   +    C N +GA++ 
Sbjct: 669 MLRPGRLDKTLFIELPNAEEKLDILKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIA 728

Query: 425 SVCTEAGMFAIR 436
           S+  E+ + A++
Sbjct: 729 SLVRESSVLALK 740

 Score =  142 bits (359), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P      +GG ++ + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +   +++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  172 bits (436), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF+ AR +   I+F DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 447 FLKAVEKVINGYKK 460
           F  A +K + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  173 bits (439), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 157/288 (54%), Gaps = 13/288 (4%)

Query: 153 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 212
           L  I KF+    E   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTW 549

Query: 213 SDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTD 272
           ++VG   +   +L   +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 273 ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNE 332
           A FI + G EL+ KYVGE  R +R++F  AR    C++FFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 333 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 392
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 393 FRIHTKSMS--VERGIRWELI--SRLCPNSTGAELRSVCTEAGMFAIR 436
               ++S    +  G+ +  I     C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P    + +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 328 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 142/269 (52%), Gaps = 5/269 (1%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG ++   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD E R  I R  TK    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 434 AIRARRKV--ATEKDFLKAVEKVINGYKK 460
           AI           K F KA+  +  G  K
Sbjct: 729 AIMENLDAEKVDRKHFDKAIAGISRGIDK 757

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG +++IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 389 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 444
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++     +  
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVMKTLQRGVSHSLT 473

Query: 445 KDFLK 449
           KD +K
Sbjct: 474 KDEMK 478

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHTKSMSVERGIRWELI--SRLCPNST 419
            +DPA+LRPGR+D+ +   LPDL  + +I +  I +    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P    S +GG  + + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A++   C+VFFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 328 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  T ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  172 bits (435), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 146/268 (54%), Gaps = 7/268 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           + PS       E P V +SD+GG +E   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 432
           +DR +  + PD   R  I    +   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 433 FAIRARRKVATEKDFLKAVEKVINGYKK 460
            AI     + T++   +  EK ++G  +
Sbjct: 732 AAI--MENLDTKRVEARHFEKALSGISR 757

 Score =  152 bits (385), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 130/234 (55%), Gaps = 16/234 (6%)

Query: 212 YSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 271
           YS VGG  ++I+ L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 272 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXN 331
           +A  + + G  +V K++GE    +RE+F+ A+  +  I+F DEI                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 332 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 391
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 392 IFR---------IHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           I +         +HT S   +  IR   I+       GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLS---DDDIRN--IASRTHGYVGADLIALCRESVMKAIQ 469

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  171 bits (434), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 148/277 (53%), Gaps = 6/277 (2%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V +SD+GG  +   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMF 433
           +DR +    PD + R  I    TK+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 434 AIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQY 470
           AI     + TE    +  EK ++G  +    +  +QY
Sbjct: 729 AI--MENLETENVEQRHFEKALSGISR-GINAEMLQY 762

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 139/249 (55%), Gaps = 8/249 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG  ++IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
             +A  + + G  +V KY+GE    +R++F  AR  +  IVF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 389 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 444
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++        
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVMKTLQRGVVHNLS 473

Query: 445 KDFLKAVEK 453
           KD LK   K
Sbjct: 474 KDELKVTMK 482

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR     I+F DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 447 FLK-AVEKVINGYKK 460
            L+ A +K++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+S VG   +   +L   +  P+  PE +  +G
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVG 544

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 545 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRAR 604

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               CI+FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 605 ASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 661

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 419
            +DPA+LRPGR+D+ +   LP+ E + +I R   +S    ++ +  I   +    C N +
Sbjct: 662 MIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFS 721

Query: 420 GAELRSVCTEAGMFAIR 436
           GA++ ++  E+ + A++
Sbjct: 722 GADIAALVRESSVLALK 738

 Score =  146 bits (369), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P    S +GG  + I +L E++ LP+L PE ++A G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +RELF+ A++   C+VFFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 328 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R  I +    S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   IVF DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GR++I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON}
           Anc_4.259 YLR397C
          Length = 808

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 148/284 (52%), Gaps = 15/284 (5%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           + PS       E P V +SD+GG +E  +K++E+++LPL + E F  LG+  PKG+LLYG
Sbjct: 523 VRPSAMREIFLEMPKVYWSDIGGQEELKQKMKEMIQLPLEASETFNKLGVTAPKGVLLYG 582

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     I+FFDE
Sbjct: 583 PPGCSKTLTAKALATESGINFFAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 642

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 643 IDAISSSREGGSGSDVS--NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 700

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS---TGAELRSVCTEAG 431
           +DR +    PD   R  I +  T     E       +  L   +   +GAE+  +C EAG
Sbjct: 701 LDRHLYVGPPDFNARLQIIKKCTIKFGSEIQNDEPFLRELSAKTGGCSGAEVVLLCQEAG 760

Query: 432 MFAIRARRKV--ATEKDFLKAVEKVING--------YKKFSSTS 465
           + AI A  +V    +  F  A+E +  G        Y++F+S S
Sbjct: 761 LSAIMADYQVDKVGKHHFQNALEGLSRGITEDMLGYYQQFASRS 804

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 210 VTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 269
           ++Y+ VGG  ++IE L+  +ELPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 269 LSYNLVGGLNKEIEILKNAIELPLHKPKLFSRFGVSPPRGILLHGPPGTGKTMLLRCVAN 328

Query: 270 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXX 329
            ++A  + + G  +V KY+GE    +R+ F  A+  +  I+F DEI              
Sbjct: 329 NSNAHVLTINGPSIVSKYLGETESSLRDFFNEAKKYQPSIIFIDEI---DSIAPNRSSDD 385

Query: 330 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 388
             EV+ R +  L+T +DG    G + V+ ATNRPN++D AL RPGR D+++E  +PD++G
Sbjct: 386 SGEVESRVVATLLTLMDGMGNSGRVVVVGATNRPNSIDSALRRPGRFDQEIEIGIPDVDG 445

Query: 389 RANIFRIHTKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 436
           R +I       MS ER  +  E I  +   +    GA+L ++C E+ M AI+
Sbjct: 446 RKDILLKQFHKMSSERHSLSDEDIQSIASKTHGYVGADLSALCRESVMKAIQ 497

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +R+LF  AR++   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  169 bits (429), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 447 FLK-AVEKVINGYKK 460
            L+ A +K++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  170 bits (430), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F+ + GSE  + YVG GA+ +R+LF  AR K   I+F DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GR++I R H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 447 FLKAVEKVINGYKK 460
              A +K++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {ON}
           complement(29676..32195) [2520 nt, 840 aa]
          Length = 839

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 512 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALDKTRVELNMAIVQPIKRPELYEKVG 571

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 572 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 631

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 632 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 688

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL----CPNST 419
            +DPA+LRPGR+D+ +   LP+ + + +I +  T+S         EL + +    C N +
Sbjct: 689 MIDPAMLRPGRLDKTLFIELPNEDEKLDIIKTLTRSNGTPLADDVELQTIISDERCRNFS 748

Query: 420 GAELRSVCTEAGMFAIR 436
           GA+L ++  E+ + A++
Sbjct: 749 GADLAALVRESSVLALK 765

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 205 PSSDLKSLGGMDDVIAQLMELIGLPILHPEIYQSTGVEPPRGVLLHGPPGCGKTSIANAL 264

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 265 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKAIAPCLMFFDEIDAITPKRDGGAQ 324

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 325 REME--RRIVAQLLTSMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 382

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 PNEVSRLHILKKMSENLKIDGEIDFAQLAKLTPGFVGADLKALSTAAGTCAIK 435

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 139/251 (55%), Gaps = 4/251 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +R+LF  AR++   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 447 FLKAVEKVING 457
           F  A +K++ G
Sbjct: 511 FEWAKDKILMG 521

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +RELF  AR +   IVF DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GR +I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  169 bits (428), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +R+LF  AR++   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  169 bits (429), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 153/283 (54%), Gaps = 16/283 (5%)

Query: 167 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 218
           VS  D+ +     V+ S  ++  P+  R   +    T   KP         + Y  VGG 
Sbjct: 185 VSKCDLNQDSTTTVEDSSPYLSPPVIFRRGSTKVEFTKASKPSSRFNLSHSIGYDSVGGL 244

Query: 219 KEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 278
            ++IE L+  + LPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN TDA  + +
Sbjct: 245 AKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVANTTDAHILTI 304

Query: 279 IGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 337
            G  +V KY+GE    +RE+F+ A+  +  I+F DEI                EV+ R +
Sbjct: 305 NGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDDSGEVESRVV 361

Query: 338 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 397
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E R +I     
Sbjct: 362 ATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEERIDILMKQF 421

Query: 398 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 436
           + MS E+  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 422 ERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

 Score =  169 bits (428), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 143/278 (51%), Gaps = 5/278 (1%)

Query: 195 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYG 254
           I PS       E P V ++D+GG      K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 255 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDE 314
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 315 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 374
           I                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 375 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 432
           +DR +    PD   R  I +  T   S++    + L  ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 433 FAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQY 470
            AI     V   K   +  EK ++G  +  +      Y
Sbjct: 731 AAI--MEDVEANKVESRHFEKALSGISRIITPEMLAYY 766

>TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {ON}
           Anc_4.23 YLL034C
          Length = 861

 Score =  170 bits (430), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/257 (35%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 184 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 243
           KY   L   P I P+         PDVT+  +G   +   +L   +  P+  PE +  +G
Sbjct: 506 KYEDFLKALPTIQPTAKREGFATVPDVTWESIGALDKIRAELNLAIVQPVKRPELYEKVG 565

Query: 244 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 303
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 566 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFSRAR 625

Query: 304 TKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 363
               C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 626 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 682

Query: 364 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK----SMSVERGIRWELISRLCPNST 419
            +DPA+LRPGR+D+ +   LP+ E + +I +  TK     ++ +  +   +    C N +
Sbjct: 683 MIDPAMLRPGRLDKTLFIELPNFEEKLDILKTITKVNGTPLASDVDLSIIINDERCRNYS 742

Query: 420 GAELRSVCTEAGMFAIR 436
           GA++ S+  E+ + A++
Sbjct: 743 GADIASLVRESSVLALK 759

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 202 PTSSLSSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 261

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI V    +V    GE  + VRELFE A++   C++FFDEI            
Sbjct: 262 AGELQVPFISVSAPSVVSGMSGESEKKVRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 321

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 322 REME--RRIVAQLLTSMDELSMEKTDGKPVIVIGATNRPDALDAALRRAGRFDREICLNV 379

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P    R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 380 PSEVSRLHILKKMSNNLRIDGHIDFSKLAKLTPGFVGADLKALVTAAGTCAIK 432

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  169 bits (427), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 207 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 266
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 267 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXX 326
            A      F  + GSE  + YVG GA+ +R+LF  AR++   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 327 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 386
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 387 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 446
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 447 FLKAVEKVINGYKK 460
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23
           YLL034C
          Length = 794

 Score =  169 bits (428), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 162/310 (52%), Gaps = 19/310 (6%)

Query: 137 ETEEGDDDEDAKYVINL------KQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELP 190
           + E+ D D D K   NL        I KF+    +   P + E+   + +   KY   L 
Sbjct: 416 DMEDMDVDTDLKNTANLIDPLPLSIIQKFINNFPD---PLNNEQLNDLSI---KYDDFLK 469

Query: 191 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGI 250
             P I P+         PDV++S VG  ++   +L   +  P+  PE +  +GI+ P G+
Sbjct: 470 ALPTIQPTAKREGFATVPDVSWSSVGALQKIRLELNMAIVQPIKRPELYEKVGINAPAGV 529

Query: 251 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIV 310
           LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    CI+
Sbjct: 530 LLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFARARASIPCII 589

Query: 311 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 370
           FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+L
Sbjct: 590 FFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAML 646

Query: 371 RPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL----CPNSTGAELRSV 426
           RPGR+D+ +   LP+ E + +IF+   +S         +L   +      N +GA+L ++
Sbjct: 647 RPGRLDKTLFIELPNAEEKLDIFKTLIRSNGTPIANDVDLAKIIEDDRSKNYSGADLAAL 706

Query: 427 CTEAGMFAIR 436
             E+ + A++
Sbjct: 707 VRESSILALK 716

 Score =  149 bits (375), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P +T   +GG  + + +L E++ LP+L PE +AA GI+PP+G+LL+GPPG GKT  A A+
Sbjct: 178 PSITLKSLGGMDDVVAQLMELIGLPILHPEIYAATGIEPPRGVLLHGPPGCGKTTIANAL 237

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A   +  FI +    +V    GE  + +R++F+ A++   C++FFDEI            
Sbjct: 238 AGELNVPFINISAPSIVSGMSGESEKKLRDVFQEAKSIAPCLIFFDEIDAITPKRDGGAQ 297

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 298 REME--KRIVAQLLTSMDELTMEHTDGKPVIVIGATNRPDALDSALRRAGRFDREICLNV 355

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +    ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 356 PNEISRLHILKKMASNLKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 408

>NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON}
           Anc_7.215 YER047C
          Length = 870

 Score =  169 bits (429), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 108/338 (31%), Positives = 175/338 (51%), Gaps = 15/338 (4%)

Query: 105 IIRSNGEGESRNEDGLDTATLARNGLDSNEPRETEEGDDDEDAKYV--INLKQIAKFVVG 162
           I+ +N   E  + D  D   + +   DS+   E +  D    A  +  + L  I KF+  
Sbjct: 462 IVSNNNTIEDVDADADDKMDIDQVTEDSHSTEEEDPSDLKNTANIIDPLPLSIIQKFIKN 521

Query: 163 LGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI 222
             +   P + E+  ++ +   KY   L   P I P+         PDVT+++VG   +  
Sbjct: 522 FPD---PLNTEQLGQLAI---KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALGKIR 575

Query: 223 EKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSE 282
            +L   +  P+  PE +  +GI  P G+LL+GPPG GKTL A+AVAN + A FI + G E
Sbjct: 576 IELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPE 635

Query: 283 LVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELIT 342
           L+ KYVGE  R +R++F  AR    C++FFDE+               + V  T+L   T
Sbjct: 636 LLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---T 692

Query: 343 QLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS--M 400
           +LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ + + +I     +S   
Sbjct: 693 ELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNYDEKLDIITTLARSNGT 752

Query: 401 SVERGIRWELISR--LCPNSTGAELRSVCTEAGMFAIR 436
            +   +++  I +   C N +GA+L ++  E+ + A++
Sbjct: 753 PLADDVQFSEIIKDERCRNFSGADLAALVRESSVLALK 790

 Score =  146 bits (368), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 208 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 267
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 219 PTSNLESLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 278

Query: 268 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIXXXXXXXXXXXX 327
           A      FI +    +V    GE  + +RELFE A+    C++FFDEI            
Sbjct: 279 AGELKVPFISISAPSVVSGMSGESEKKIRELFEEAKALAPCLMFFDEIDAITPKRDGGAQ 338

Query: 328 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 383
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 339 REME--RRIVAQLLTSMDELTMEQTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 396

Query: 384 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 436
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+S+ T AG  AI+
Sbjct: 397 PNEVSRLHILKKMSQNLKIDGSIDFLKLAKLTPGFVGADLKSLTTAAGTCAIK 449

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,831,814
Number of extensions: 1913432
Number of successful extensions: 9736
Number of sequences better than 10.0: 557
Number of HSP's gapped: 9314
Number of HSP's successfully gapped: 662
Length of query: 471
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 358
Effective length of database: 40,524,141
Effective search space: 14507642478
Effective search space used: 14507642478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)