Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E027905.348ON41141121320.0
ZYRO0F00550g5.348ON4154109031e-118
Suva_2.4865.348ON4154186138e-75
Skud_4.5835.348ON4154186023e-73
YDR317W (HIM1)5.348ON4144265875e-71
Smik_4.5765.348ON4154225876e-71
Kpol_1051.45.348ON4264255432e-64
CAGL0H07161g5.348ON4244184934e-57
TPHA0D020605.348ON4964333822e-40
AGR348W5.348ON5423743799e-40
Ecym_81855.348ON4713773654e-38
Kwal_34.159895.348ON5064483532e-36
TBLA0A031005.348ON3723733463e-36
KAFR0C018805.348ON3453323401e-35
SAKL0G08910g5.348ON5052473366e-34
KLTH0H14784g5.348ON5144023191e-31
KLLA0B10120g5.348ON3482332708e-26
Kpol_312.97.148ON2211771085e-05
Kwal_47.188627.148ON2241371067e-05
ZYRO0D09548g7.148ON2251371051e-04
KLTH0H00264g7.148ON2221661032e-04
KNAG0L00930singletonON2291151014e-04
NCAS0E02080singletonON2251901014e-04
Ecym_44797.148ON224102996e-04
TBLA0A105007.148ON23798910.007
CAGL0H09768g7.148ON233141900.008
ADR005W7.148ON22475840.048
NCAS0E020907.148ON225158830.070
NDAI0E036407.148ON225169820.085
YER004W (FMP52)7.148ON23175790.24
TDEL0H031107.148ON224164780.29
Smik_5.1187.148ON23175770.39
KLLA0D13684g7.148ON224106770.39
SAKL0F04686g7.148ON223120750.62
Suva_5.917.148ON22975740.85
TBLA0F033107.148ON16190721.3
KNAG0D051206.201ON92640741.6
Skud_5.1037.148ON227153721.8
CAGL0B00286g1.3ON36040712.8
TPHA0L007607.148ON226103693.4
Skud_16.2588.475ON23994703.4
KAFR0G027507.148ON225105693.6
TBLA0F030008.248ON1543100704.2
Ecym_62518.745ON23042694.4
SAKL0G09658g5.327ON43661694.6
ZYRO0C12716g3.443ON252844704.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E02790
         (411 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   825   0.0  
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   352   e-118
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   240   8e-75
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   236   3e-73
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   230   5e-71
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   230   6e-71
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   213   2e-64
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   194   4e-57
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   151   2e-40
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   150   9e-40
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   145   4e-38
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   140   2e-36
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   137   3e-36
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   135   1e-35
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   134   6e-34
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   127   1e-31
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...   108   8e-26
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    46   5e-05
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    45   7e-05
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    45   1e-04
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    44   2e-04
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               44   4e-04
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      44   4e-04
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    43   6e-04
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    40   0.007
CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {O...    39   0.008
ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic hom...    37   0.048
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      37   0.070
NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON...    36   0.085
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    35   0.24 
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    35   0.29 
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    34   0.39 
KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa] ...    34   0.39 
SAKL0F04686g Chr6 complement(377594..378265) [672 bp, 223 aa] {O...    33   0.62 
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    33   0.85 
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    32   1.3  
KNAG0D05120 Chr4 complement(933748..936528) [2781 bp, 926 aa] {O...    33   1.6  
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    32   1.8  
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...    32   2.8  
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    31   3.4  
Skud_16.258 Chr16 (468426..469145) [720 bp, 239 aa] {ON} YPL024W...    32   3.4  
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    31   3.6  
TBLA0F03000 Chr6 complement(724116..728747) [4632 bp, 1543 aa] {...    32   4.2  
Ecym_6251 Chr6 (473229..473921) [693 bp, 230 aa] {ON} similar to...    31   4.4  
SAKL0G09658g Chr7 (823183..824493) [1311 bp, 436 aa] {ON} simila...    31   4.6  
ZYRO0C12716g Chr3 (1008641..1016227) [7587 bp, 2528 aa] {ON} sim...    32   4.7  

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/411 (96%), Positives = 398/411 (96%)

Query: 1   MIVIQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNK 60
           MIVIQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNK
Sbjct: 1   MIVIQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNK 60

Query: 61  LIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNN 120
           LIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNN
Sbjct: 61  LIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNN 120

Query: 121 VSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWC 180
           VSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWC
Sbjct: 121 VSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWC 180

Query: 181 ELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKRHYVDYELTFK 240
           ELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKRHYVDYELTFK
Sbjct: 181 ELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKRHYVDYELTFK 240

Query: 241 LAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPL 300
           LAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPL
Sbjct: 241 LAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPL 300

Query: 301 VGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMY 360
           VGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMY
Sbjct: 301 VGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMY 360

Query: 361 RKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSEQMDHIALH 411
           RKPGSWMLGYCIP             DEASDEASDPVEIITSEQMDHIALH
Sbjct: 361 RKPGSWMLGYCIPATKAAYVAASKATDEASDEASDPVEIITSEQMDHIALH 411

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  352 bits (903), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/410 (43%), Positives = 268/410 (65%), Gaps = 10/410 (2%)

Query: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYC 64
           Q + DH L FGS+GLIGSLTL+ELLK +LYL    ++Q +L   E+ ++++F  NK  YC
Sbjct: 11  QSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYC 70

Query: 65  INRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSDE 124
           +NRK+  +     NE  ++  K  P+ F   DY     TS  P   + SN SL NNV +E
Sbjct: 71  VNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEE 130

Query: 125 SGTLYIHN--NSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCEL 182
            GT+ +    ++    L++ ++ ++YQ+EY S++ K LLITF+F I+Q+   DS++W +L
Sbjct: 131 DGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADL 190

Query: 183 LPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTF 239
           LP IFSG V L  E E + T+ +LP LD++ TMICTLG  S   + S   R++V+Y+LTF
Sbjct: 191 LPSIFSGEVELVPE-ESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTF 249

Query: 240 KLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGP 299
           ++ Q+F +CE KRLVI+T+FNN L+ H+ PYF+ K +LENDLQ+K+ P L +LVVLRPGP
Sbjct: 250 QIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGP 309

Query: 300 LVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTM 359
           +VG H     + L + +S ++ +Q+ +YKE+C++ K +  KE R+IGF+T+ASEL+A+ M
Sbjct: 310 IVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAM 369

Query: 360 YRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSEQMDHIA 409
           YRKPGS +LGYC+P             +    E    + I+TS+++DH+ 
Sbjct: 370 YRKPGSSVLGYCVPASKAAYATAYMATNPTLGE----LRIVTSKEIDHLT 415

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  240 bits (613), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 220/418 (52%), Gaps = 25/418 (5%)

Query: 7   YNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYCIN 66
           + D  L FGSSGL G  TL+ LL  + Y+ N  ++Q +L++   +N  N   NK I+CIN
Sbjct: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEIN-ENVVLNKHIFCIN 66

Query: 67  RK-IGYKNILLDNEQYL-------KADKLAPISFNKADYRFEKITSICPSVKKHSNQSLV 118
           RK +  +   +    Y+       K  +    S  + + + E   S            + 
Sbjct: 67  RKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGIIR 126

Query: 119 NNVS-DESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSS 177
           N++  D+ GT             Y+R   +Y + Y     +   I +NF++ Q+  P S+
Sbjct: 127 NSMDKDKKGTF---------SFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQST 177

Query: 178 KWCELLPDIFSGCVAL-RSEAEP-DGTTNK-LPPLDEIPTMICTLGAGS---RQSKAKRH 231
            W +LLP++FSG   L R + +  D  ++K LP L+ I TM+C LG+ +   R+S+    
Sbjct: 178 SWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNS 237

Query: 232 YVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGK 291
           +VDY L+F LAQ F N   K+LV++T+FNN  +     YFR K+KLENDL+  L  +L +
Sbjct: 238 FVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297

Query: 292 LVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRA 351
           L++LRPGP+ G+HG P+   + I  +  + ++  YY  Y  + K     E R++G RTR 
Sbjct: 298 LIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRL 357

Query: 352 SELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSEQMDHIA 409
           SE+IA ++YR PGS +LGY +P             ++ S EA   VE+I S Q+D IA
Sbjct: 358 SEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  236 bits (602), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/418 (34%), Positives = 216/418 (51%), Gaps = 19/418 (4%)

Query: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63
           I  + D+ L FGSSGL G  TL+ LL  + Y+ N  ++Q +L++ + +   +   NK ++
Sbjct: 5   ISVFTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIK-EDVVLNKHVF 63

Query: 64  CINRK-IGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVS 122
           CINR+ +  +   L    Y+    +  I++    Y     T+     +  S  +   +  
Sbjct: 64  CINRRNVTEQKSFLKTIDYVN---MKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNF 120

Query: 123 DES---GTLYIHNNSAGNV-LKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSK 178
           +E    G  Y      GN    Y++   +Y + Y     +   I +NF + Q+  P S  
Sbjct: 121 EEGFIRGAAY--EGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSES 178

Query: 179 WCELLPDIFSGCVALRSEAEPDGTT----NKLPPLDEIPTMICTLGAGS---RQSKAKRH 231
           W  LL  IFS    L  + + D  T      LP L +I TM+CTLG+ S   R+++    
Sbjct: 179 WPRLLSRIFSKEQKLE-KFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNS 237

Query: 232 YVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGK 291
           +VDY L F LAQ F N   KRLV+VT+FNN L+     YFR K+KLENDL+  L  +L +
Sbjct: 238 FVDYHLVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKE 297

Query: 292 LVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRA 351
           LV+LRPGP+ G+HG P+   L +  +    ++ILYY  Y  + K     E R++G RT+ 
Sbjct: 298 LVILRPGPMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKL 357

Query: 352 SELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSEQMDHIA 409
           SELIA ++YR PGS +LGY +P             ++ S EA   VE+I S Q+D IA
Sbjct: 358 SELIASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKRSKEAGPKVEMINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  230 bits (587), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/426 (34%), Positives = 213/426 (50%), Gaps = 36/426 (8%)

Query: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63
           +  + D+ L FGSS L+G   L+ LL  +LY+ N  ++Q +L++   +   N   NK ++
Sbjct: 5   VNTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEIK-GNVVLNKHVF 63

Query: 64  CINRK-IGYKNILLDNEQYLKADKLAPISFNKADY----RFEKITSICPSVKK-----HS 113
           C+NR+ I  +   +    Y+    +  +++    Y    R EK T   PS        + 
Sbjct: 64  CVNRRCINEEKSFMKTIDYIN---MRSVTWQGGRYYLRSRKEKDTEKVPSSPNTFCYDNF 120

Query: 114 NQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIAC 173
            +  + N  +E G         G    Y++   +Y + Y     K + I  NF + Q+  
Sbjct: 121 EEGFIKNTPEERG-------KDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLII 173

Query: 174 PDSSKWCELLPDIFSGCVALRSEAEPDGTTNK-------LPPLDEIPTMICTLGAGS--- 223
           P S  W +LLP IFSG   L    E     NK       LP L +I TM+C+LG+ S   
Sbjct: 174 PRSETWPKLLPRIFSGTQKL----EKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARV 229

Query: 224 RQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQH 283
           R+++    + DY L F LAQ F N   KRLV+ T FNN  +     YFR K+KLENDL  
Sbjct: 230 RRTQVPSSFADYYLPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDE 289

Query: 284 KLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFR 343
            L  +L +LV+LRPGP+ G+HG P+   L   +ST  L++I YY  Y    K     E R
Sbjct: 290 ALPNKLKELVILRPGPMCGQHGNPINVELGKENST-FLEKIFYYPHYLLVYKKKYISEAR 348

Query: 344 RIGFRTRASELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSE 403
           RIG RT+ SE+IA ++YR PGS +LGY +P             +  S EA   +E+I+S 
Sbjct: 349 RIGLRTKLSEIIASSIYRMPGSALLGYAVPVSKVSYVASLMAIERKSKEAGPKLEVISSY 408

Query: 404 QMDHIA 409
           Q+D I 
Sbjct: 409 QIDMIV 414

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  230 bits (587), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 210/422 (49%), Gaps = 27/422 (6%)

Query: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63
           I  + D+ L FGSSGL G  TL+ +L  + Y+ N  ++Q +LN+   +   +   NK ++
Sbjct: 5   INAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIK-GDVVLNKHVF 63

Query: 64  CINRK-IGYKNILLDNEQYLKADKLAPISFNKADY----RFEKITSICPS-----VKKHS 113
           CINR+ I  +   + +  Y+    +  I++ +  Y    R E  T   PS          
Sbjct: 64  CINRRSITEEKSFMKSIDYIN---MKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120

Query: 114 NQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIAC 173
            +  +   +DE+G            + Y++   +Y + Y S   +   I + F + Q+  
Sbjct: 121 EEGFIKKTTDENG-------KDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLII 173

Query: 174 PDSSKWCELLPDIFSGCVALRSEAEPDGT---TNKLPPLDEIPTMICTLGAGS---RQSK 227
           P S  W  LL  IFSG   L      + T      LP L +I TM+CTLG+ S   R+++
Sbjct: 174 PRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQ 233

Query: 228 AKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKP 287
               +VDY L F LAQ F N   KRLVI+T+FNN  +     YFR K+KLENDL+  L  
Sbjct: 234 VPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPN 293

Query: 288 RLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGF 347
           +  +L++LRPGP+ G+HG  +   L +  +     +ILYY  Y    K     E R+IG 
Sbjct: 294 KPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGL 353

Query: 348 RTRASELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPVEIITSEQMDH 407
           RT+ SELIA + YR PGS +LGY +P             +  S EA   +E+I S Q+D 
Sbjct: 354 RTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDM 413

Query: 408 IA 409
           IA
Sbjct: 414 IA 415

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  213 bits (543), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 135/425 (31%), Positives = 217/425 (51%), Gaps = 31/425 (7%)

Query: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNT-------CEHLNLSNFR 57
           + +++     GS+GL     L  LL  + YL N   I+++LN          H  ++  +
Sbjct: 13  KNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIK 72

Query: 58  FNKLIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSL 117
             K I+CINR+   + + L N+  L++ K+  I F   +YR +K     P    + +  L
Sbjct: 73  IVKNIFCINRR--SQTLDLFNKDALESVKVGRIKFKDLEYRLDK----TPGETSYESSYL 126

Query: 118 VNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSS 177
            N +  ESG +        + L +    +  Q+ YK++    L I F   +  I  P S+
Sbjct: 127 TNEI--ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSN 184

Query: 178 KWCELLPDIFSGCVALRSEAEPDGTT--NKLPPLDEIPTMICTLGAGSRQSKAKR---HY 232
           +W  LLP IF+    +    + + +     LP L  IPTMI +LG   RQ   +      
Sbjct: 185 QWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRA 244

Query: 233 VDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKL 292
           +D++LT KL Q+F N   K+LV++TTFNN ++  +  YF  K K+E  LQ++L P+L +L
Sbjct: 245 IDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304

Query: 293 VVLRPGPLVGEHGRPLTKSLT------IGHSTNMLKQILYYKEYCFQCKLALFKEFRRIG 346
           V+LRPGP+V   G P+T ++       +  S N+++Q +  K+Y    KLA  K++R  G
Sbjct: 305 VILRPGPIV---GVPMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTG 361

Query: 347 FRTRASELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDE--ASDEASDPVEIITSEQ 404
              R ++++A+TMYRKPG+ +LGYCIP             +   AS  +   V+IITS Q
Sbjct: 362 IAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQIITSRQ 421

Query: 405 MDHIA 409
           +D + 
Sbjct: 422 IDELV 426

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  194 bits (493), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 208/418 (49%), Gaps = 25/418 (5%)

Query: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYC 64
           + +  + L FGS+GL GSL  + LL    YL +   +++ L       L N      +YC
Sbjct: 17  KTFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLENVTIKTCLYC 76

Query: 65  INRKIGYKNILLDNEQYLK---ADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNV 121
            NRKIG     LD  +YLK   A+   P  FN + Y + K T +   + +    S   N 
Sbjct: 77  FNRKIGEP---LD--KYLKSPSANSFGPFCFNGSQYHYNKGTCVPLDIDQDIETS---ND 128

Query: 122 SDESGTLYIHNNSAGNVL-------KYHRSMQTYQVEYKSENSKKLLITFNFVILQIACP 174
           +   G LY + +   NV        +Y+     Y +EY S     L + F F  +Q+   
Sbjct: 129 ATFDGFLY-YKDKGKNVTGKNPISGEYYGKEYMYYLEYMSAEGNLLKLNFIFNHIQLIIK 187

Query: 175 DSSKWCELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKR---H 231
           +S  W  ++P IFS  V   S  E        P L +I TMI T+G  + ++K      +
Sbjct: 188 NSFSWPSVIPIIFSDEVEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYN 247

Query: 232 YVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGK 291
            +DY+L   L ++F+N + K ++IVT+FNN +I  + PYF+ K KLE+ L + + P L  
Sbjct: 248 DIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKT 307

Query: 292 LVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRA 351
           L +LRPGPLVG H      + +I  ++++ ++ L +K+   Q       + R  G   +A
Sbjct: 308 LTILRPGPLVGRHSDIYPTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSIKA 367

Query: 352 SELIARTMYRKPGSWMLGYCIPXXXXXXXXXXXXXDEASDEASDPV-EIITSEQMDHI 408
           SE++ART YR PGS +LGYCIP             D+   E  +P+  ++TSE+MD++
Sbjct: 368 SEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDKYLHE--EPLTRVVTSEEMDNM 423

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  151 bits (382), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/433 (28%), Positives = 205/433 (47%), Gaps = 66/433 (15%)

Query: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFR---FNK 60
           I +++D+ L  GS+GLIG   LK     DLY+ + + +++ + + E+ + +  +     K
Sbjct: 28  IDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKK 87

Query: 61  LIYCINRK------------IG--YKNILLDNEQ-YLKADKLAPI--------SFNKA-- 95
             Y + RK            +G   K + LD +  YL+ D L  I        SF K+  
Sbjct: 88  TAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLT 147

Query: 96  -DYRFEKIT-----SICPSVKKHSNQSLVNNVS-----DESGTLYI--HNNSAGNVL--- 139
                E +T      +  + K++   S+ N  S     D+S    +  +N S GNV+   
Sbjct: 148 TKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQP 207

Query: 140 ------KYHRSMQTYQVE--YKSENSKKLLITFNFVILQIACPDSSKWCELLPDIFSGCV 191
                 + + ++Q Y     + S +   L I F+  +  ++  DS+ W  LLP +F    
Sbjct: 208 QEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNT 267

Query: 192 ALRSE----AEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKR-HYVDYELTFKLAQSFN 246
            L          D T  KLP L E+  M+ +LG+ S   K +    +DY+L   L  SFN
Sbjct: 268 KLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFN 327

Query: 247 NCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGR 306
           N   K+++I+T+ N  +      Y   K  LE DL+  L  ++ +LV+LRPGPLV   G 
Sbjct: 328 NTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLV---GT 384

Query: 307 PLTKSLTIGHSTNM------LKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMY 360
           P+T  L  G + ++      LKQ++ YK + F  K+AL +  +  GF    + ++A+T Y
Sbjct: 385 PMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFY 444

Query: 361 RKPGSWMLGYCIP 373
           R+PG+ +LGY IP
Sbjct: 445 RRPGTSLLGYTIP 457

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  150 bits (379), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 110/374 (29%), Positives = 181/374 (48%), Gaps = 60/374 (16%)

Query: 9   DHFLFFGSSGLIGSLTLKELLKADLYLGNP-ENIQKRLNTCEHLNLSNFRFNKLIYCINR 67
           ++++  GS+GL GS  L++L+    ++G P E +  R                  +C +R
Sbjct: 171 ENYVLLGSTGLTGSQVLQDLITP--WIGAPLEGVTART----------------FWCFSR 212

Query: 68  KIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSDESGT 127
           K     I + N   L     A + F    +           V + ++  L+ ++S+  G 
Sbjct: 213 KFQDVEIDISN---LPKTWTAIVEFEGEKH-----------VIRKNDVRLIRHLSECGGM 258

Query: 128 LYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCELLPDIF 187
           L          LK H     + V   +   +   I     ++Q+  PDS +W +L   +F
Sbjct: 259 LG---------LKCHWDQYNWDVVLTTGEVRNATIN----VVQVVQPDSRRWPDLFNKMF 305

Query: 188 SGCV-ALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQ 243
           +G V    + +E       +P + EI T+I TLG+ S   R+SKA R +VDY L  ++A+
Sbjct: 306 TGGVRTFNAYSEI-----YMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAK 360

Query: 244 SF----NNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGP 299
           +F         K +VIVT+FN++ +  +  YFRTK +LENDL + + P L  L +LRPGP
Sbjct: 361 TFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGP 419

Query: 300 LVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTM 359
           L+GEHG     S T   + NML +   YK+   + +     + + +G  T+ +EL+A+  
Sbjct: 420 LLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKAT 479

Query: 360 YRKPGSWMLGYCIP 373
           Y  PG+W++GY IP
Sbjct: 480 YHLPGNWIVGYSIP 493

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  145 bits (365), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 106/377 (28%), Positives = 180/377 (47%), Gaps = 55/377 (14%)

Query: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63
           + +  D+ +  GS+GL GS  LK  + A    G                L + +  K I+
Sbjct: 95  VNEKGDNVIILGSTGLTGSQVLKGCM-APWTSGV---------------LYDLKLTKNIW 138

Query: 64  CINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSD 123
           C NR++   +  +         KL P      +Y  E      P + +  +  +  +++ 
Sbjct: 139 CFNRRLKTVDFSIS--------KLPPTWTAVVNYGGE------PHIIRKYDLKIKQHIT- 183

Query: 124 ESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCELL 183
           E G L        + L++      ++++  ++  K + +     + QI   DS KW +  
Sbjct: 184 EIGKL--------DGLEFQWDQFDWELKLPTDEVKNVTVN----VFQIIQNDSKKWDKTF 231

Query: 184 PDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFK 240
            ++F+G      +   D     LP +D++ T+I TLG+ S   R+ K  R +VDY L   
Sbjct: 232 SELFTG----NRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMD 287

Query: 241 LAQSFNNCEGKRL----VIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLR 296
           +A+ F   + K L    VIVT+FNN+ +  L PYFRTK KLENDL + + P L  L +LR
Sbjct: 288 MAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILR 346

Query: 297 PGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIA 356
           PGPL+G+HG+ +  +  +   + +L +   +K    + KL    + + +G   + +ELIA
Sbjct: 347 PGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIA 406

Query: 357 RTMYRKPGSWMLGYCIP 373
           +  Y  PG+W++GY IP
Sbjct: 407 KATYHLPGNWIVGYSIP 423

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  140 bits (353), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 126/448 (28%), Positives = 199/448 (44%), Gaps = 65/448 (14%)

Query: 9   DHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNT--------------------- 47
           D  L FG +GL G L    L +  +YL    ++Q+++++                     
Sbjct: 77  DSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMRRTRSP 136

Query: 48  -CEHLNLS-NFRFNKLIYCINRK-IGYKNILLDNEQYLKADKLAPISFNKADYRFEKITS 104
            C  L    +    K ++C  R+ +  + I LD         L     +  DY+  K+  
Sbjct: 137 LCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDG--------LDASWEHSIDYKGSKM-- 186

Query: 105 ICPSVKKHSNQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKK----- 159
           +C       N S          T +  + S    +     +Q +      +NS+      
Sbjct: 187 VC----SKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGET 242

Query: 160 ----LLITFNFVILQIACPDSSKWCELLPDIFSGCVALRSEAEPDGTTNKL---PPLDEI 212
               L+I     I+ I   DS KW  LL  IF    + R     D     L   PPL +I
Sbjct: 243 CRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQI 302

Query: 213 PTMICTLGAGS---RQSKAKRHYVDYELTFKLAQSF--NNCEG--KRLVIVTTFNNILIR 265
            TM+ +LG+ S   ++ K  RH+ DYEL   LA +F  +   G  K++VI+T+FNN+ + 
Sbjct: 303 NTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLS 362

Query: 266 HLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHS----TNML 321
               YF++K  LE DL  K++  L KLV+LRPGPLVG H   L     I       T M 
Sbjct: 363 STSDYFQSKLMLEQDLVTKVQA-LDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMF 421

Query: 322 KQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPGSWMLGYCIPXXXXXXXX 381
           K +L +K+ C + KL L +E  ++G RT+ SEL+AR  Y++  S +LG+ +P        
Sbjct: 422 K-VLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVA 480

Query: 382 XXXXXDEASDEASDPVEIITSEQMDHIA 409
                   S +++  VE+I S++++ +A
Sbjct: 481 SIRAV--FSPDSASFVELIKSDEIEKMA 506

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  137 bits (346), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 114/373 (30%), Positives = 182/373 (48%), Gaps = 64/373 (17%)

Query: 10  HFLFFGSSGLIGSLTLKELLKADLYLGN----------PENIQKRLNTCEHLNLSNFRFN 59
           +++FFGS+G+ G  TL  LL  + YL            P++ Q +   C+  +  +    
Sbjct: 6   NYIFFGSTGMTGFTTLTNLLNINSYLQAKDPQSAIDNLPQDFQWQ--ACD--DSLDLYLV 61

Query: 60  KLIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFE-----KITSICPSVKKHSN 114
           K I+CINR+     I LD E+ + ++    IS N  D  FE        S+  ++ + + 
Sbjct: 62  KNIFCINRRFFDSPIYLD-EKIISSN----ISINYKDKTFELQFQSNTNSVSNNITEQNE 116

Query: 115 QSLVNNVSD------ESGTLYIHNNSA-------GNVLKYHRSMQTYQVEYKS------- 154
             L    +D      ++G + +             + + YH + Q  Q+ +K        
Sbjct: 117 LKLPLVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNENE 176

Query: 155 ---ENSKKLLITFNFVI--LQIACPDSSKWCELLPDIFSGCVALRSEAE-----PDGTTN 204
              +N ++  I  N++I   Q   P S  W E+LP+IF     L S+        D  TN
Sbjct: 177 NDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTN 236

Query: 205 K-----LPPLDEIPTMICTLGAGSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTF 259
           +     LP L++I  MICTLG      + K   +D++LTF+L+  F+N  GK+LVIVT F
Sbjct: 237 EKSNIVLPKLEDIQVMICTLGTNLLCDQKK---IDFDLTFQLSNWFSNRLGKKLVIVTAF 293

Query: 260 NNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH--GRPLTKSLTIGHS 317
           NN L+     YF  K++LE  L++ L   LG+LV+LRPGPL+G H       +++ + HS
Sbjct: 294 NNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHS 353

Query: 318 TNMLKQILYYKEY 330
           T +LKQ+ +YK +
Sbjct: 354 TKILKQLWFYKTF 366

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  135 bits (340), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/332 (31%), Positives = 171/332 (51%), Gaps = 33/332 (9%)

Query: 9   DHFLFFGSSGLIGSLTLKELLKADLYLGNPEN-IQKRLNTCEHLNLSNFRFNKLIYCINR 67
           +H LFFGSSGL+GS +L  LL  +  L N +N     + +     + +  F+K+IYC NR
Sbjct: 7   EHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVSGVYDIAFDKIIYCFNR 66

Query: 68  ---KIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSDE 124
               I YK        +   +K +   F    Y               SN    NN  + 
Sbjct: 67  TPQNIRYK-------YHSDFEKNSQFDFGGTKYTL-------------SNNPEPNNSFES 106

Query: 125 SGTLYIHNNSAGNVLKYHRSMQTYQVEY--KSENSKKLLITFNFVILQIACPDSSKWCEL 182
            G L    N     +K    +  Y  E+   +E  ++L +T+N   +QI   +S KW +L
Sbjct: 107 KGQLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDL 166

Query: 183 LPDIFSG----CVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKR---HYVDY 235
           LP +F+G     +A + +        KL  +++I T++CTLGA S  +K +    + +DY
Sbjct: 167 LPILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDY 226

Query: 236 ELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVL 295
           +LT+ L ++F   E K+++IVT+FNN LI ++ PYFRTK +LENDL+  L+P + +L +L
Sbjct: 227 DLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYIL 286

Query: 296 RPGPLVGEHGRPLTKSLTIGHSTNMLKQILYY 327
           RPGP+ G+H    ++  T   + N + + ++Y
Sbjct: 287 RPGPIKGKHRSKESEISTNIRTLNPITRAIHY 318

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  134 bits (336), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 131/247 (53%), Gaps = 25/247 (10%)

Query: 148 YQVEYKSEN---------SKKLLITFNFVILQIACPDSSKWCELLPDIFSGC---VALRS 195
           Y+ E++ E+         ++ L+I+    ++QI  P+S  W  LL   F      VAL  
Sbjct: 220 YKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHV 279

Query: 196 EAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQSF--NNCE- 249
           + +   T    P L ++ T++  LG+ +   ++S   R +VDY+L FK+A+ F  N+ E 
Sbjct: 280 QGQV-PTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEH 338

Query: 250 --GKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRP 307
              K++V++T+FNN  +    PYF TK KLE DL  ++ P L +LV+LRPGPL+G H   
Sbjct: 339 GIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPGPLIGSHTPE 397

Query: 308 LTKSLTIGHSTNMLK---QILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPG 364
                    +  +LK    + YYK+ C+  K    +   ++G +T+ +E+ AR +YR   
Sbjct: 398 FIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSC 457

Query: 365 SWMLGYC 371
           SWM GY 
Sbjct: 458 SWMFGYS 464

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  127 bits (319), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/402 (28%), Positives = 184/402 (45%), Gaps = 52/402 (12%)

Query: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYC 64
           Q+  D+ L  G++GL GSL L  L +  +YL    ++Q ++++    +L  F  +  I+ 
Sbjct: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHN-IFV 135

Query: 65  INRKIGYKNILLDNEQYLKADKL-----APIS-----FNKADYRFEKITS------ICPS 108
              K    NIL+  +       L      PI+      +  D  +E          IC  
Sbjct: 136 KKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGK 195

Query: 109 VKKHSNQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSK---------K 159
                + +L  N +     L   +N  G  +     +Q++  +   ENS+          
Sbjct: 196 GGISRDCTLERNAAMYE--LASTHNCPGREIILQ--LQSFSFKLVYENSRDPHGDTCGHA 251

Query: 160 LLITFNFVILQIACPDSSKWCELLPDIFSGCVALRSEAEPDG------TTNKLPPLDEIP 213
           L++  N  ++ +   DS +W  LL D+F G   ++    P G      +  + P L ++ 
Sbjct: 252 LMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVG 310

Query: 214 TMICTLGAG---SRQSKAKRHYVDYELTFKLAQSFNNCEG----KRLVIVTTFNNILIRH 266
           T++  LG+     R+S   RHYVDYEL   LAQ F   +     K++V+VT+FN+ L+  
Sbjct: 311 TLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLST 370

Query: 267 LLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH-----GRPLTKSLTIGHSTNML 321
           +  YF+TK KLE DL  K+   +  LV+LRPGPLVG H       P T   T   +   L
Sbjct: 371 VSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAA--L 427

Query: 322 KQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKP 363
             IL  K+ CF  K+ L ++  ++G R + SEL AR  Y+ P
Sbjct: 428 FHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP 469

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score =  108 bits (270), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 116/233 (49%), Gaps = 30/233 (12%)

Query: 150 VEYKSENSKKLLITFNFVILQIACPDSSKWCELLPD-IFSGCVALRSEAEPDGTTNKLPP 208
           + Y +     + I  N  +  I  PDS+KW +++P  IF          +P         
Sbjct: 88  ISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMIPHHIFIN--------DPSADL----- 134

Query: 209 LDEIPTMICTLGAGSRQSK---AKRHYVDYELTFKLAQSF--NNCEGKRL---VIVTTFN 260
                ++I  LG+ S +SK     R +VD  L   + ++   N+   ++L   +I+T+FN
Sbjct: 135 -----SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDILSQKLSQYIIMTSFN 189

Query: 261 NILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGH-STN 319
           N  I  + PYF+ K +LE + Q  L+     +V+LRPGPL+G+HG   T S T+      
Sbjct: 190 NFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHGS--TSSFTVPELDDR 247

Query: 320 MLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPGSWMLGYCI 372
           +L  IL YK+  F   +    E++ +G  TR SEL+A+  Y  PG++ +GY +
Sbjct: 248 LLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMPGAFFVGYPV 300

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 74/177 (41%), Gaps = 39/177 (22%)

Query: 170 QIACPDSSKWCELLPD----IFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQ 225
           QI   DS+KW EL+PD    +FSG    R+ A   G  N                     
Sbjct: 45  QIVEKDSTKWSELIPDDTKYLFSGLATTRAAA--GGLDN--------------------- 81

Query: 226 SKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKL 285
               ++ +DY+L  +LA++        LV+V++         + Y + K ++E D+   +
Sbjct: 82  ----QYKIDYDLNIELAKAAKEKGCSTLVLVSS-AGANEHSWIAYLKMKGEIERDM---I 133

Query: 286 KPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYC-FQCKLALFKE 341
           K      ++LRPG ++GE     +     G+   +    ++Y+  C F  K  ++ E
Sbjct: 134 KLGFDHTIILRPGAILGER---TSHHKGFGNDFGVFVGRMFYRSKCQFLVKYPVYAE 187

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 65/137 (47%), Gaps = 12/137 (8%)

Query: 198 EPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKRH--YVDYELTFKLAQSFNNCEGKRLVI 255
           E +   N +P   E   ++ T  A +R+   K H  +VD++L  +LAQ       K  V+
Sbjct: 55  ESETWLNSVP---EKSDVVFTALATTREQAGKEHFYWVDHDLNLQLAQKAKENGCKTFVL 111

Query: 256 VTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIG 315
           V++      +    YF+TK+++E D+   L     K ++LRPG L G   +P  K + + 
Sbjct: 112 VSS-AGASEKSPFFYFKTKAEIERDI---LALNFEKTIILRPGALFGARDKP--KGI-VS 164

Query: 316 HSTNMLKQILYYKEYCF 332
            ++  L   LY   + F
Sbjct: 165 RASAKLGSYLYRTRFQF 181

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 168 ILQIACPDSSKWCELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSK 227
           + QI   DSSKW +L P+       ++      GTT                 AGS ++ 
Sbjct: 44  VKQIVETDSSKWAQLFPE-----TGVKFYFSAFGTTRA--------------AAGSAENF 84

Query: 228 AKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKP 287
            K   +D++L  +LA++        +V+V++        +LPYF+ K ++E D+   L  
Sbjct: 85  YK---IDHDLNVELAKAAKTKGCTTMVLVSSVGANE-NSMLPYFKDKGEIERDI---LAL 137

Query: 288 RLGKLVVLRPGPLVGEH 304
                ++LRPGPL+G  
Sbjct: 138 DFDHTIILRPGPLLGRQ 154

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 68/166 (40%), Gaps = 41/166 (24%)

Query: 175 DSSKWCELLPD----IFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKR 230
           DSS W   +P+    +FSG    R EA                             K   
Sbjct: 54  DSSNWSAAVPENYDILFSGLATTRGEA----------------------------GKENF 85

Query: 231 HYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLG 290
           + VD+++  +LA+S    +G    +V +        +  Y +TK +LE D+   L     
Sbjct: 86  YKVDHDMNLQLARSAKE-KGYSTYVVVSSTGADENSMFYYMKTKGELERDI---LALGFE 141

Query: 291 KLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYK--EYCFQC 334
           + ++LRPGPL+GE  R  +K L  G S+  +  I+Y    +  F C
Sbjct: 142 RTIILRPGPLLGE--RTKSKGLLNGLSSK-IGSIVYRTKLQSVFGC 184

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 198 EPDGTTNKLPPLDEIP----TMICTLGAGSRQSKAKRHY-VDYELTFKLAQSFNNCEGKR 252
           EPD T      + +IP     +IC LG    +S A+  Y VD++LT +LA      +   
Sbjct: 52  EPDSTLWGRA-MRDIPGNLDVLICALGTTRARSNAEEQYAVDHDLTLELATVAKREKHAH 110

Query: 253 LVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRP 307
            V+V +           Y R K  +E D+    + +    V+LRPG L+GE  +P
Sbjct: 111 TVVVVSSTGAHPESRFFYARMKGDVERDIT---ELQFNHTVLLRPGILLGERYKP 162

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 41/190 (21%)

Query: 157 SKKLLITFNFVILQIACPDSSKWCELLPD----IFSGCVALRSEAEPDGTTNKLPPLDEI 212
           +++ L   + +  QI  PD+SKW  L+P+    +F+G +++ S A               
Sbjct: 33  TRRALPKSDSIATQIVEPDNSKWSHLIPENTKYLFTG-LSMTSYA--------------- 76

Query: 213 PTMICTLGAGSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFR 272
                 LG    Q K     +D++L  +LA++    +G   ++V + +   +     Y R
Sbjct: 77  ------LGGFDNQYK-----IDHDLNLELAKA-AKAKGCSTIVVVSSDRASLDSRFSYMR 124

Query: 273 TKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCF 332
            K ++E D+   +       ++LRPG L+GE   P T   +  H    +   ++Y+    
Sbjct: 125 MKGEIERDI---VALDFDHTIILRPGILLGER-DPQTAHKSFTHDAMRMIGGMFYR---- 176

Query: 333 QCKLALFKEF 342
             +LA   E+
Sbjct: 177 -SRLAWLAEY 185

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 10/102 (9%)

Query: 209 LDEIPTMICTLGAGSRQSKAK------RHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNI 262
           +D IP  I  L +    +KA       ++ +D+ L   +A++      K LV+V++    
Sbjct: 57  IDSIPDGINVLFSALGTTKAAAGSIENQYKIDHGLNLAVAKAAKEKGCKTLVLVSSLG-A 115

Query: 263 LIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH 304
            I   LPYF+ K +LE D+   L     + ++LRPG L+GE 
Sbjct: 116 SIESRLPYFKMKGELERDV---LALGFERTILLRPGVLLGER 154

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 6/98 (6%)

Query: 208 PLDEIPTMICTLGAGSRQSKA--KRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIR 265
           P D+I  ++  L    + +    +++Y+D++L    A+          V+V++       
Sbjct: 63  PTDKIDILMTGLATTKKAAGGAQQQYYIDHDLNIDFAKKAKENGCSTFVVVSSAGASADS 122

Query: 266 HLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGE 303
               Y + K ++E DL+         L++LRPGPL+GE
Sbjct: 123 RFF-YLKMKGEIERDLK---AIDFDHLIILRPGPLLGE 156

>CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004w
          Length = 233

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 56/141 (39%), Gaps = 40/141 (28%)

Query: 170 QIACPDSSKWCELLPD-----IFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSR 224
           QI   DSS W  LLP      +F+     R+ A            D              
Sbjct: 48  QIVDKDSSSWASLLPKENFKFLFTSLATTRAAA---------GGFD-------------- 84

Query: 225 QSKAKRHYVDYELTFKLAQS--FNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQ 282
               K++ +D++L  +LA++   N CE   LV  T  N       +PY R K ++E D+ 
Sbjct: 85  ----KQYQIDHDLNLELAKASKANGCETIVLVSSTGANK---NSWMPYLRMKGEIEEDI- 136

Query: 283 HKLKPRLGKLVVLRPGPLVGE 303
             +       ++LRP  L+G+
Sbjct: 137 --IALNFKHTIILRPSALLGD 155

>ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER004W
          Length = 224

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 230 RHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRL 289
           ++ VD++L   +A++     G R+ ++ +     +   LPY + K  +E DL   L    
Sbjct: 83  QYKVDHDLNIAVAKAAKE-RGCRVCVIVSAIGASVNARLPYNKLKGDIERDL---LALEF 138

Query: 290 GKLVVLRPGPLVGEH 304
            + V+LRPG L+GE 
Sbjct: 139 ERTVILRPGVLLGER 153

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 62/158 (39%), Gaps = 36/158 (22%)

Query: 167 VILQIACPDSSKWCELLPD----IFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAG 222
           V  QI   D+SKW  L+PD    IF+     R                        +G  
Sbjct: 43  VASQIVETDNSKWTGLIPDDTKFIFTALATTRG----------------------AVGGF 80

Query: 223 SRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQ 282
             Q K     +D++L   LA++    +G   V++ + +   +     Y R K ++E D+ 
Sbjct: 81  DNQYK-----IDHDLNVDLAKAAKE-KGCSTVVLVSSSGASLDSRFSYMRMKGEIERDI- 133

Query: 283 HKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNM 320
             L       ++LRPG L+G+  + +      G+ T M
Sbjct: 134 --LALDFDHTIILRPGILLGDRDKGINHK-GFGNGTAM 168

>NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON}
           Anc_7.148 YER004W
          Length = 225

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 68/169 (40%), Gaps = 42/169 (24%)

Query: 148 YQVEYKSENSKKLLITFNFV-----------ILQIACPDSSKWCELLPDIFSGCVALRSE 196
           Y VEY +E S K+   F              I Q+   D+SKW  ++PD           
Sbjct: 15  YFVEY-AEKSSKISKIFTVTRRSLPQKVGPRITQLVETDNSKWASMIPD----------- 62

Query: 197 AEPDGTTNKLPPLDEIPTMICTLGA--GSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLV 254
                         EI  +  +L    G+     +++ +D++L  +LA++    +G   +
Sbjct: 63  -------------KEINVLFTSLSTTRGAAGGFDEQYKIDHDLNIELAKAAKE-KGCSTI 108

Query: 255 IVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGE 303
           ++ +         + Y R K ++E D+   +       ++LRPG L+G+
Sbjct: 109 VLVSSRGAHADSRMAYTRMKGEIERDI---IALGFDHTIILRPGILLGQ 154

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 229 KRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPR 288
           K++ +D++L  +LAQ+    +G   +++ +           Y + K ++E D+   +   
Sbjct: 85  KQYKIDHDLNLQLAQAAKE-KGCETIVLVSSAGAHPDSRFGYMKMKGEIERDV---IALD 140

Query: 289 LGKLVVLRPGPLVGE 303
              +++LRPGPL+GE
Sbjct: 141 FKHIIILRPGPLLGE 155

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 64/164 (39%), Gaps = 45/164 (27%)

Query: 155 ENSKKL---------LITFNFVILQIACPDSSKWCELLPD-----IFSGCVALRSEAEPD 200
           ENS++L          + F    +Q    D++KW + +P+     +F+G    R      
Sbjct: 21  ENSRELGEICTITRRALPFQSTAVQKVDKDTTKWGQYIPNEHLEFVFTGLATTR------ 74

Query: 201 GTTNKLPPLDEIPTMICTLGAGSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFN 260
                                G+     K++ +D++L  +LA+          V+V++  
Sbjct: 75  ---------------------GAAGGFDKQYKIDHDLNIELAKVAKEKGCSTFVLVSS-G 112

Query: 261 NILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH 304
                 +  Y + K ++E D+   L       ++LRPGPL+G+ 
Sbjct: 113 GAKEDSMFAYMKMKGEIERDI---LALGFDHTIILRPGPLLGDR 153

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 229 KRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPR 288
           K++ +D++L  +LA++  + +G   +++ +           Y + K ++E D+   +   
Sbjct: 85  KQYKIDHDLNLQLARAAKD-KGCETIVLVSSAGAHADSRFGYMKMKGEIERDV---IALN 140

Query: 289 LGKLVVLRPGPLVGE 303
               ++LRPGPL+GE
Sbjct: 141 FKHTIILRPGPLLGE 155

>KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa]
           {ON} similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 224

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 203 TNKLPPL-DEIPTMICTLGAGSRQSKA---KRHYVDYELTFKLAQSFNNCEGKRLVIVTT 258
           TNK   L  E  T++ T  A +R +      ++ +D+++  +LA+     +G ++ ++ +
Sbjct: 54  TNKWGELIPEDATVLLTGLATTRAAAGGFENQYKIDHDMNVELAK-VAKAKGYKVCVLVS 112

Query: 259 FNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH 304
                    LPY + K + E D+   +     K ++LRPG L+GE 
Sbjct: 113 SLGANENSFLPYLKLKGETERDI---IALDFDKTIILRPGGLLGER 155

>SAKL0F04686g Chr6 complement(377594..378265) [672 bp, 223 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 223

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 18/120 (15%)

Query: 199 PDGTTNKLPPLDE---------IPTMICTLGAGSRQSKAKRHY-----VDYELTFKLAQS 244
           P+  +NK+ P+ E         +P  I  + +G   ++A   +     +D++L  +LA++
Sbjct: 40  PNPVSNKVDPIVEKNTLEWPKAVPEGIRVIFSGLATTRAAGGFENQYKIDHDLNIELAKA 99

Query: 245 FNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEH 304
               +G    ++ +         +PY + K  +E D+   +     K ++LRPG L+G+ 
Sbjct: 100 AKE-KGCSTCVIVSSGGANDNSRIPYLKLKGDIERDI---IALGFEKTIILRPGILLGDR 155

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 229 KRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPR 288
           K++ +D++L  +LA++  +  G   +++ +     +     Y + K ++E D+   +   
Sbjct: 85  KQYKIDHDLNMQLARAAKD-RGCDTIVLVSSAGAHVDSRFGYMKMKGEIERDI---IALN 140

Query: 289 LGKLVVLRPGPLVGE 303
               ++LRPGPL+G+
Sbjct: 141 FKHTIILRPGPLLGK 155

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 216 ICTLGAGSRQSKAKRHYVDYELTFKLAQSF--NNCEGKRLVIVTTFNNILIRHLLPYFRT 273
           I    AGS Q   +++ +D+ L   LA+    N C    +++ ++  N   R    Y + 
Sbjct: 6   ITRAAAGSTQ---EQYRIDHNLNIHLAKKAKENGCS-TFVLVSSSLANADSR--FTYLKM 59

Query: 274 KSKLENDLQHKLKPRLGKLVVLRPGPLVGE 303
           K ++E DL+         L++LRPG L+GE
Sbjct: 60  KGEIERDLE---AIGFDHLIILRPGKLLGE 86

>KNAG0D05120 Chr4 complement(933748..936528) [2781 bp, 926 aa] {ON}
           Anc_6.201 YPL195W
          Length = 926

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 254 VIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLV 293
           ++VT  NN +I  LL  F   SK+E  L+HKL P++ +L+
Sbjct: 244 ILVTIDNNWIIIRLLKLFTNLSKVEPKLKHKLLPKIVELM 283

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 61/153 (39%), Gaps = 29/153 (18%)

Query: 168 ILQIACPDSSKWCELLPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSK 227
           ++ +   D+S+W EL+ D+    V   + A        L                     
Sbjct: 45  VVTVVEKDNSQWSELVTDVMHPQVLFTALATTRAAAGGLD-------------------- 84

Query: 228 AKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKP 287
             ++ +D++L  +LA++    +G   +++ +           Y + K ++E D+   +  
Sbjct: 85  -NQYKIDHDLNLQLARAAKE-KGCETIVLVSSAGAHPDSRFGYMKMKGEIERDV---IAL 139

Query: 288 RLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNM 320
                ++LRPGPL+GE     TKS   G   N+
Sbjct: 140 NFKHTIILRPGPLLGER----TKSKQSGFGGNL 168

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 184 PDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS 223
           PDI+ G  ++  E   D   NK+ PL++I  ++C++G G 
Sbjct: 146 PDIWEGHASMVDEIVED-FKNKMIPLNKIKAIVCSVGGGG 184

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 50/103 (48%), Gaps = 10/103 (9%)

Query: 204 NKLPP-LDEIPTMICTLGAGSRQSKAKRHYVDYELTFKLAQSF--NNCEGKRLVIVTTFN 260
           N++P  LD + T + T   G+  S   ++ +D++L  +L +    N C   + V++ + +
Sbjct: 60  NEVPKGLDVVFTSLSTT-KGAAGSLENQYKIDHDLNLQLLEKAKENGC---KTVVLISSS 115

Query: 261 NILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGE 303
                    Y + K ++E D+    K      ++LRPG L+GE
Sbjct: 116 GANEHSWAGYLKMKGEIERDVT---KLGFDHTIILRPGVLLGE 155

>Skud_16.258 Chr16 (468426..469145) [720 bp, 239 aa] {ON} YPL024W
           (REAL)
          Length = 239

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 210 DEIPTMICTLGAGSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLP 269
           D+I     +   GSR+    R Y +      +AQ  N    K+L++V     +L + L+ 
Sbjct: 13  DDITPPANSSALGSREQLVFRAYQNEPWLAGIAQ--NLILDKKLIVVD--RELLFQVLMV 68

Query: 270 YFRTKSKLE--NDLQHKLKPRLGKLVVLRPGPLV 301
              TKSKL   +D++ +L PR  K+  LR GP V
Sbjct: 69  ENITKSKLTLIDDIKTRLNPRNQKVDRLRSGPQV 102

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 10/105 (9%)

Query: 203 TNKLPPLDEIPTMICTLGAGSRQ--SKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFN 260
           +N +  LDE   ++ T  A +R       ++ +D++L  +LA++    +G   +++ T +
Sbjct: 57  SNIISGLDENIDVLFTALATTRAVGGTGYQYKIDHDLNVELAKAARE-KGCSTIVIVTAH 115

Query: 261 NILIRHLLPYFRTKSKLENDLQHKLKPRLG--KLVVLRPGPLVGE 303
                    Y + K ++E D+       LG  + ++LRPG L+GE
Sbjct: 116 GAHADSRFFYTKMKGEIERDISD-----LGFNRTIILRPGILLGE 155

>TBLA0F03000 Chr6 complement(724116..728747) [4632 bp, 1543 aa] {ON}
           Anc_8.248 YDR104C
          Length = 1543

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 45/100 (45%), Gaps = 12/100 (12%)

Query: 270 YFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLT---------IGHSTNM 320
           YF+T S   N  + KLK  L       P P++ ++  P+T + +         I   TN 
Sbjct: 199 YFKTSSNKHNSNKRKLKSHLVSFSTDTPAPIISDYTTPITPNTSTETDNGSDNIRQDTNT 258

Query: 321 LKQILY---YKEYCFQCKLALFKEFRRIGFRTRASELIAR 357
           +  IL    +++  ++  + +  E  +  + +  ++L+AR
Sbjct: 259 ISNILENNGFRDPLWKDTVIIPTESTKTIYSSVKNQLLAR 298

>Ecym_6251 Chr6 (473229..473921) [693 bp, 230 aa] {ON} similar to
           Ashbya gossypii AFR554W
          Length = 230

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 70  GYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKK 111
           G+K+  L+   Y +ADKL     N+ D +F+K+  IC  +K+
Sbjct: 37  GHKDTSLNETGYEQADKLGSYLVNEQDIKFDKV--ICSDLKR 76

>SAKL0G09658g Chr7 (823183..824493) [1311 bp, 436 aa] {ON} similar
           to uniprot|Q06640 Saccharomyces cerevisiae YDR306C
           Hypothetical ORF
          Length = 436

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 9/61 (14%)

Query: 104 SICPSVKKHSNQSLVNNVSDESGTLY-------IHNNSAGNVLKYHRSMQTYQ--VEYKS 154
           S CP + +H+  ++++ + D   TLY       +H NS   V +Y  +++T Q  V+Y S
Sbjct: 289 SFCPKINEHAVYTVLSKIGDNLQTLYFHYPMPALHENSLDYVFRYCSNLKTIQLMVDYCS 348

Query: 155 E 155
           +
Sbjct: 349 K 349

>ZYRO0C12716g Chr3 (1008641..1016227) [7587 bp, 2528 aa] {ON}
           similar to uniprot|Q06116 Saccharomyces cerevisiae
           YPR117W Hypothetical ORF
          Length = 2528

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 220 GAGSRQSKAKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNIL 263
            A   +S A  H++ YE   +L QS + C  K LVI+  +++ L
Sbjct: 181 AATHLESGASIHHIGYEFKVRLDQSRDECTDKMLVIIQNWSSYL 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,887,104
Number of extensions: 1862296
Number of successful extensions: 5236
Number of sequences better than 10.0: 67
Number of HSP's gapped: 5348
Number of HSP's successfully gapped: 70
Length of query: 411
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 299
Effective length of database: 40,638,807
Effective search space: 12151003293
Effective search space used: 12151003293
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)