Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E027805.349ON34734717780.0
Skud_4.5845.349ON3683627253e-93
YDR318W (MCM21)5.349ON3683636977e-89
Smik_4.5775.349ON3683636942e-88
Suva_2.4875.349ON3683396881e-87
ZYRO0D10120g5.349ON3293546381e-80
KAFR0C018705.349ON3413625921e-73
KNAG0C055205.349ON3853835934e-73
Kpol_1051.55.349ON3703715733e-70
SAKL0G08888g5.349ON3793715594e-68
TPHA0D020705.349ON3733765552e-67
CAGL0H07139g5.349ON3583525183e-62
TBLA0H019805.349ON3593654566e-53
KLTH0H14806g5.349ON3463584077e-46
Kwal_34.159865.349ON2312383369e-37
NDAI0I015505.349ON2762793391e-36
AGR349W5.349ON2422433342e-36
Ecym_81845.349ON2482433343e-36
NCAS0F028505.349ON2812982953e-30
KLLA0B10142g5.349ON2933281582e-11
YLR371W (ROM2)4.219ON135694721.9
Suva_8.1582.175ON28982668.9
SAKL0A04114g6.228ON46529668.9
Skud_10.1975.187ON19473659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E02780
         (347 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   689   0.0  
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   283   3e-93
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   273   7e-89
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   271   2e-88
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   269   1e-87
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   250   1e-80
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   232   1e-73
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   233   4e-73
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   225   3e-70
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   219   4e-68
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   218   2e-67
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   204   3e-62
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   180   6e-53
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   161   7e-46
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   134   9e-37
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   135   1e-36
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   133   2e-36
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   133   3e-36
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   118   3e-30
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    65   2e-11
YLR371W Chr12 (862714..866784) [4071 bp, 1356 aa] {ON}  ROM2GDP/...    32   1.9  
Suva_8.158 Chr8 (276218..277087) [870 bp, 289 aa] {ON} YOR106W (...    30   8.9  
SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly...    30   8.9  
Skud_10.197 Chr10 complement(363729..364291,364369..364390) [585...    30   9.9  

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/347 (97%), Positives = 337/347 (97%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 61  DVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESIAQFID 120
           DVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESIAQFID
Sbjct: 61  DVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESIAQFID 120

Query: 121 TNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLKVNKETNKTE 180
           TNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLKVNKETNKTE
Sbjct: 121 TNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLKVNKETNKTE 180

Query: 181 INREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFIDVHALFNKTNGG 240
           INREMIGIRLEVFNESIARFEKP          SDSWLLFKHTVPIFIDVHALFNKTNGG
Sbjct: 181 INREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKHTVPIFIDVHALFNKTNGG 240

Query: 241 AIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAAVSFSKNEVQFR 300
           AIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAAVSFSKNEVQFR
Sbjct: 241 AIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAAVSFSKNEVQFR 300

Query: 301 LMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHLDQL 347
           LMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHLDQL
Sbjct: 301 LMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHLDQL 347

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  283 bits (725), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 152/362 (41%), Positives = 230/362 (63%), Gaps = 20/362 (5%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS+++DLQQDI++L  EI  L K R+ LK  ++    ++ + +P+++ F+ +F QFPQL 
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60

Query: 61  DVLSEETTARHEESTQDPIS--LKRKRNTDVNSPKKDKSFRGDH-----------PPVFQ 107
           + L +E     E   +D  S  +       ++ PKK      D             P+ Q
Sbjct: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120

Query: 108 HQMFDESIAQFIDTNILTSPSKARRRMK----DTKYDEDAPRNQVLLENVYRMFGITYFP 163
           HQMFD ++A  +DT+ILTSPSK +R++K    DT  D +   + +++ENVYRMFGIT+FP
Sbjct: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTS-DRNDLEDSIIMENVYRMFGITFFP 179

Query: 164 VVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHT 223
           +VDP DLK+   +++  ++REM+GIRLEVF+E  ++FEKP          S+SW LFKHT
Sbjct: 180 LVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHT 239

Query: 224 VPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDL 283
           +P FIDV  +FN+TNGG +ISH+N+YLFAK V+ QL+E+  R Q  +DL +  +I +LDL
Sbjct: 240 IPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDL 299

Query: 284 DLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNV--KPQLETIFLGPLHELEIKL 341
           DL+++ VSF   +V+  L + +++IVSCS++ E  D +   K + E + LG L +LE+KL
Sbjct: 300 DLQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKL 359

Query: 342 KH 343
            H
Sbjct: 360 NH 361

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  273 bits (697), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 148/363 (40%), Positives = 226/363 (62%), Gaps = 22/363 (6%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS ++DLQQDI++L  EI  L + R+ LK +++    ++ + +P+V+ F+ +F QFPQL 
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 61  DVLSEETTARHEESTQD-----------PISLKRKRNTDVNS----PKKDKSFRGDHPPV 105
           + L  E     E   +D           PI  + K+   + +    P+++   +    P+
Sbjct: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQ--PM 118

Query: 106 FQHQMFDESIAQFIDTNILTSPSKARRRMKD---TKYDEDAPRNQVLLENVYRMFGITYF 162
            QHQMFD  +A  +DT+ILTSPSK +R++K    +  D     + ++LENVYRMFGIT+F
Sbjct: 119 VQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFF 178

Query: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKH 222
           P+VDP DLK+   + +  ++REM+GIRLEVF+E  ++FEKP          S+SW LFKH
Sbjct: 179 PLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKH 238

Query: 223 TVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLD 282
           T+P FIDV  +F+ TNGG +ISH++ YLFAK V+ QL+E+  R Q  +DL +  +I +LD
Sbjct: 239 TIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLD 298

Query: 283 LDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALD--GNVKPQLETIFLGPLHELEIK 340
           LDLE++ VSF   +++  L + +++IVSCS++ +  D   N K + E   LG L +LE+K
Sbjct: 299 LDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELK 358

Query: 341 LKH 343
           L H
Sbjct: 359 LNH 361

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  271 bits (694), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 148/363 (40%), Positives = 228/363 (62%), Gaps = 22/363 (6%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS+++DLQQDI++L  EI  L K R+ LK  ++    ++ +++P+V+ F+ +F QFPQL 
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLN 60

Query: 61  DVLSEETTARHE--------ESTQDPISL-------KRKRNTDVNSPKKDKSFRGDHPPV 105
           + L  E     E         S   P +L       + K N D N P+++   +    P+
Sbjct: 61  NFLFNEHPELEEMDDRGVSIASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQ--PM 118

Query: 106 FQHQMFDESIAQFIDTNILTSPSKARRRMKD---TKYDEDAPRNQVLLENVYRMFGITYF 162
            QHQMFD  +A  +DT+ILTSPSK +R++K       D+    + +++ENVYR+FGIT+F
Sbjct: 119 VQHQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFF 178

Query: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKH 222
           P+VDP DLK+  ++++  ++REM+GIRLEVF+E  ++FEKP          S+SW LFKH
Sbjct: 179 PLVDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKH 238

Query: 223 TVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLD 282
           TVP FIDV  +F+ TNGG ++S+++ YLFAK V+ QL+E+  R Q  +DL +  +I +L+
Sbjct: 239 TVPSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLN 298

Query: 283 LDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALD--GNVKPQLETIFLGPLHELEIK 340
           LDLE++  SF   +V+  L + +++IVSCS++ +  D   N K + E   LG L +LE+K
Sbjct: 299 LDLESSMASFFVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELK 358

Query: 341 LKH 343
           L H
Sbjct: 359 LNH 361

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  269 bits (688), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 213/339 (62%), Gaps = 16/339 (4%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS+++DLQQD+++L  EI  L K R+ LK +LR    ++ + +P+++ F+ +F QFPQL 
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 61  DVLSEETTARHEESTQD-PISLKRKRNTDV-NSPKKDKSFRGDH-----------PPVFQ 107
           + L  E     +   +D  + LK    T +   PKK      D             P+ Q
Sbjct: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120

Query: 108 HQMFDESIAQFIDTNILTSPSKARRRM---KDTKYDEDAPRNQVLLENVYRMFGITYFPV 164
           H+MFD  +A  +DT ILTSPSK +R++   +    D+    + ++LEN+YRMFGIT+FP+
Sbjct: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180

Query: 165 VDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTV 224
           VDP DLK+   +++  ++REM+GIRLEVFNE  ++FEKP          S+SW LFKHT+
Sbjct: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 225 PIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLD 284
           P +IDV A+FN TNGG +IS ++ YLFAK V+ QL+E+  R Q+ +DL +  +I NLDLD
Sbjct: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300

Query: 285 LEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVK 323
           L+++ VSF   +V+  L L +++IVSCS++ E  D N K
Sbjct: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQK 339

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  250 bits (638), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 217/354 (61%), Gaps = 38/354 (10%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           M  +E+L+QDI++LTREI  L ++RD LK +    +  +L+NHPVVK F+SVF +FP+LY
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 61  DVLSEETT--------ARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFD 112
           +VL+ E             E ST D   +KR++    +                Q++MFD
Sbjct: 61  EVLARENQIVDSNDNDTSDEPSTVDSSFVKRRKLEFSDGS-------------VQNKMFD 107

Query: 113 ESIAQFI-DTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLK 171
           +SIA  + DT+  TSP K R ++++ K       +QV +EN YR+FGIT+FP+VDP+D+ 
Sbjct: 108 KSIADLLGDTSSSTSPGKRRSKLQNFK----GLESQVSIENAYRLFGITFFPLVDPSDIN 163

Query: 172 VNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFIDVH 231
             +     +INR+M+GIRLEVFNE + +FEKP           +SW LFKHT+P FID+ 
Sbjct: 164 FQR----NDINRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHTIPAFIDLE 219

Query: 232 ALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAAVS 291
           ++F K + G I +++ +YLFAK VY QL+ ++ R+Q +E+L    +I NL++DL+ AAVS
Sbjct: 220 SIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQIAAVS 279

Query: 292 FS-KNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHL 344
           F  +   + RL L  DQ++SC    +  D +   +L+ + LGP+ EL++KL  L
Sbjct: 280 FDIQGMKRVRLFLQDDQVISC----DTFDDD---ELKMLLLGPVKELKLKLGRL 326

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  232 bits (592), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 128/362 (35%), Positives = 205/362 (56%), Gaps = 40/362 (11%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS +E+L+QDI +L RE                     K   + V++ F+ +F QFPQL 
Sbjct: 1   MSNIEELEQDIASLRRE---------------------KQPANTVMREFEELFQQFPQLR 39

Query: 61  DVLSEETTARHEESTQDPI------------SLKRKRNTDVNSPKKDKSFRGDHPPVFQH 108
           D+L +E     +E+  +P+            S KR +    ++  +D+    +  P+ +H
Sbjct: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPL-EH 98

Query: 109 QMFDESIAQFIDTNILTSPSKARRRMKDTKYDE------DAPRNQVLLENVYRMFGITYF 162
            +FD+S+   +DT IL+SPSK R+R+             D   +Q+++EN++R+FGIT+F
Sbjct: 99  NLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFF 158

Query: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKH 222
           PVVDP+DL++N ET + +  REM+GIRL++F+E   +++KP          SD+W +FKH
Sbjct: 159 PVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKH 218

Query: 223 TVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLD 282
           T+P +I V  +F + + G  IS+E+IYLF+K +Y QL++ +AR   L+     G+I NL 
Sbjct: 219 TIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLR 278

Query: 283 LDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLK 342
           + L +  VSFS    +  L L  + I+SCS V    D +V+ + E +F GPL +LE KL+
Sbjct: 279 ISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLR 338

Query: 343 HL 344
            L
Sbjct: 339 QL 340

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  233 bits (593), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 207/383 (54%), Gaps = 43/383 (11%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELR----RNDADKLANHPVVKNFQSVFHQF 56
           M ELEDL+QDIDAL +EI  L K    +K E+R         K   + V++ F+SVF +F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 57  PQLYDVL--------------------------SEETTARHEESTQDPISLKRKR----- 85
           PQLYD+L                          + +T  R   +T  P+   + +     
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 86  -NTDVNSPKKDKSFRGDHPPVFQHQMFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAP 144
             +D + P+ +   +   P   +HQMFD+S+   +DT+IL+SPSK +R       D    
Sbjct: 121 NRSDEDLPEDEWVLKNQVP--IEHQMFDQSVGDLLDTDILSSPSKRKRNPAQHGADTSRL 178

Query: 145 RNQVLLENVYRMFGITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPX 204
             ++LLEN YR+FGITYFPVVDP DL++N ET K  I REM+G+R +VFN+  ++FEKP 
Sbjct: 179 HEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKPF 238

Query: 205 XXXXXXXXXSDSWLLFKHTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTA 264
                    +  W +FKHT+P  IDVH+LF+   GG   S+ +IYLF+K VY +L++ + 
Sbjct: 239 YVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSSL 298

Query: 265 RMQNLEDLMSSGVIDNLDLDLEAAAVSFSKNE---VQFRLMLHKDQIVSCSLVGEALDGN 321
           R+++   L   G+I++L  DL +  VSF       +  +L +  +++VS  +  +     
Sbjct: 299 RLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKLTIQNNEVVSVYV--KKGKEE 356

Query: 322 VKPQLETIFLGPLHELEIKLKHL 344
           VK +L     GP+ +LE KLK L
Sbjct: 357 VKSKLAMFLTGPIDDLEGKLKQL 379

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  225 bits (573), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 208/371 (56%), Gaps = 27/371 (7%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS+L +L+QD+ AL REI  L K RD +KD+L  N+ ++    P+ K+F+ +F   PQLY
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 61  DVL---------------SEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPV 105
           D+L                E    +H  S    IS KR +  + ++   +  +     P+
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGKHMTS---EISNKRVKPNEQDTDISEDEWILKSQPL 117

Query: 106 FQHQMFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRN--------QVLLENVYRMF 157
            QH+MF+  I+  I+T+ILTSPSK + ++ +   D +  +         ++ +EN++R+F
Sbjct: 118 VQHKMFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRLF 177

Query: 158 GITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSW 217
           GIT+FP+VDPTDLK+NKE    EI REM+GIRLE++NE  + FEKP           DSW
Sbjct: 178 GITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDSW 237

Query: 218 LLFKHTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGV 277
           ++FKHT+P +ID+ + +   N G + +++ I +FAK VY +LI    R Q ++ L     
Sbjct: 238 MIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTELEY 297

Query: 278 IDNLDLDLEAAAVSFSK-NEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHE 336
           I +   D+ ++ V  +  ++ +  L L  + IVSC +  + ++  +K + + I LG + E
Sbjct: 298 IRDCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTDRMEPMLKNKWQIILLGTIDE 357

Query: 337 LEIKLKHLDQL 347
           L  KL  L+ +
Sbjct: 358 LPNKLSQLNNM 368

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  219 bits (559), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 205/371 (55%), Gaps = 36/371 (9%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGL-------KDELRR--NDADKLANHPVVK---- 47
           MS+L++ QQDIDAL REI  L +++D L       +D+L R  ++++K+   PV++    
Sbjct: 1   MSKLQEHQQDIDALNREIASLAQQQDELHLHIQKYEDQLERLRHESEKV---PVIELTTD 57

Query: 48  NFQSVFHQFPQLYDVLSEETTARHEESTQDPISLKRKRNTDVNSPKK---DKSFRGDHP- 103
            +  +F  FP L+ +LSE+   +      D  +L   + +   SP+K   ++      P 
Sbjct: 58  EYGPIFEAFPHLHKLLSEKLFQQESNRGHDNTALSTPKKSTTISPRKRVVNQVLPPSMPE 117

Query: 104 --------PVFQHQMFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYR 155
                   P  +H+MFD  IA  IDT ILTSPSK + ++     ++    + V LENVYR
Sbjct: 118 HEWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVHNNKQNLIDYVRLENVYR 177

Query: 156 MFGITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSD 215
           M GIT FPVVDP+DLKVNKET + EI REM+G+RLEVFNE ++ FEKP           D
Sbjct: 178 MTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKKSSKRD 237

Query: 216 SWLLFKHTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSS 275
           SW +FKHT+P +ID+  LF KTNGG I  +   YLFAK VY+ L++ + + Q  E L   
Sbjct: 238 SWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFEVLARE 297

Query: 276 -GVIDNLDLDLEAAAVSF--SKNEVQFRLMLHKDQIVSCSLVGEALDGNVK--PQLETIF 330
              I  ++ DL    VSF  S   + F+ +L  D     ++ G ++  N +   + E   
Sbjct: 298 DSRISQIESDLAVNVVSFKVSFKNLSFKTVLQMDW---NNVHGASIKLNSEHVRRWENYL 354

Query: 331 LGPLHELEIKL 341
           LGP+ E   KL
Sbjct: 355 LGPVDEFPRKL 365

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  218 bits (555), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/376 (33%), Positives = 222/376 (59%), Gaps = 32/376 (8%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           MS L++L+QDIDAL +E+  L  ++  L++E+     +     P+++ F  +F+QFP L+
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 61  DVLSEETTARHE---ESTQDPI------SLKRKR----NTDVNSPKKDKSFRGDHPPVFQ 107
           ++LS+E   R E   +  +D +      + KRK+    N D N P+ +  +  +  P+ +
Sbjct: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHE--WILNKQPIIE 118

Query: 108 HQMFDESIAQFIDTNILTSPSKARRRM--------------KDTKYDEDAPRNQVLLENV 153
           H++F   +++ I+T+ILTSPSK ++ +              K+   +E+  R +++ EN 
Sbjct: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELER-KIIKENT 177

Query: 154 YRMFGITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXX 213
           +R+FGI+YFPVVDP DL  +K  N+    REMIGIRLEVF++++  FEKP          
Sbjct: 178 FRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237

Query: 214 SDSWLLFKHTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLM 273
           S++W LFK+T+P +ID++ +F + N G ++++E+IY+FAK VY QL+ +  R +NL  L 
Sbjct: 238 SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQ 297

Query: 274 SSGVIDN--LDLDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFL 331
            + ++ +  +DL+L+   ++      +  L L KD++ S S+  E LD + + + +   L
Sbjct: 298 EANIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLL 357

Query: 332 GPLHELEIKLKHLDQL 347
           GP+  +  K+++L Q+
Sbjct: 358 GPVSGISRKIRYLSQM 373

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  204 bits (518), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 199/352 (56%), Gaps = 12/352 (3%)

Query: 4   LEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLYDVL 63
           +E+L QD++ALT EI  L ++   L+++L+  +   +       +F  +F + P L D+L
Sbjct: 6   VEELLQDVEALTSEINGLQEKSKKLREQLKHPEQ-FIKFDKAFGDFNDIFEKNPGLRDLL 64

Query: 64  SEETTARHEESTQD----PISLKRKRNTDVNSPK----KDKSFRGDHPPVFQHQMFDESI 115
                 +      D    P++ ++K  + V + K     +  +     P+ +H++FDES+
Sbjct: 65  LGYEIDKSATDVDDTNIIPVTPQKKSRSSVVNEKLHSLPEHEWVLKTQPLVEHRLFDESV 124

Query: 116 AQFIDTNILTSPSKARRRMKDTKYDEDA--PRNQVLLENVYRMFGITYFPVVDPTDLKVN 173
              IDT+IL SPSK +++++    +      +  +  EN+YR+FGI+YFP+VDP+DL  +
Sbjct: 125 RDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEPIQYENIYRLFGISYFPLVDPSDLIFD 184

Query: 174 KETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFIDVHAL 233
            +T K  + R+M+GIR ++FNES   FEKP          SD W LFK+TVP +IDV  +
Sbjct: 185 SKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAKSDDWKLFKYTVPNYIDVEGI 244

Query: 234 FNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAAVSFS 293
           F +  GG I +++++YLFAK +Y  L+E+  R +    L   G+ID+LD+DL++  +  +
Sbjct: 245 FAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLEKDGIIDDLDMDLQSLVIKCT 304

Query: 294 -KNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHL 344
            +   +    +H+  I++C++  + +  + K +L  +  G LH+L+ KL  L
Sbjct: 305 LQGTTKIEFHIHQYSIIACTIKSKIMSDDEKERLAMMLQGSLHDLKYKLISL 356

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  180 bits (456), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 195/365 (53%), Gaps = 30/365 (8%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLK------DELRRNDADKLANHPVVKNFQSVFH 54
           MSE+ +L++ I  L  EI  L K+ + LK       E++ N   K  N P   NF     
Sbjct: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFP---NF----- 52

Query: 55  QFPQLYDVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPP--VFQHQMFD 112
             P+L +VL+  +    +ES  +  S   +  ++ N  +  K      P     +H++FD
Sbjct: 53  -IPELQNVLTSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFD 111

Query: 113 ESIAQFIDTNILTSPSKARRRMKDTK---YDEDAPRNQVLLENVYRMFGITYFPVVDPTD 169
           + I++ +   +++ PS+ R+RMK  +   +  +  +N V+LE VYRM GIT+FPVVDPTD
Sbjct: 112 DEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTD 171

Query: 170 LKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFID 229
           L+         I REM+GIRLE++N+ I+ FEKP          S  W +FK+T+P +ID
Sbjct: 172 LEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYID 231

Query: 230 VHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAA 289
           +H+LF K N G I +  +I+LFAK VY  L  ++ ++Q  + L +  V +NL++DL    
Sbjct: 232 IHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQ 291

Query: 290 VSF-SKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETI-------FLGPLHELEIKL 341
           +SF  K+    R+ L +  I++C++  E+ +  +  +  T        F GP+ +L  KL
Sbjct: 292 ISFLFKSIYNIRISLKEWDIITCTI--ESTESYINKETRTFYRKWEIQFQGPIKKLVSKL 349

Query: 342 KHLDQ 346
           +   Q
Sbjct: 350 EQFRQ 354

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  161 bits (407), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 182/358 (50%), Gaps = 28/358 (7%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           M E ED  Q I++L  EI  L  +   L+DEL+   A K     V   F+ +F + P+L 
Sbjct: 1   MVEEEDNDQYINSLNAEILQLKNKCRVLEDELQ---AQKKGVSEVPVEFEGLFQKNPELK 57

Query: 61  DVLSEETTARHEESTQDPISLKRKR----------NTDVNSPKKDKSFRGDHPPVFQHQM 110
             LS++     +   Q P S  +KR          N   + P+ +   +   P   +H+ 
Sbjct: 58  HTLSQKIFKETDSFPQTPYSSPKKRPLKSSAAQLSNLSPDIPESEWVLKTQVP--VEHKF 115

Query: 111 FDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDL 170
           FD ++A  I+T+ILTSPSK +R  +   ++E   + Q+  EN+YRM GI+ FPVVDP+DL
Sbjct: 116 FDSAVADLIETDILTSPSKRKRAAQSRAHEELVQKVQI--ENIYRMLGISTFPVVDPSDL 173

Query: 171 KVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFIDV 230
           +   E ++  I R+M+G+RLE+FNE    FE P          +  W +F+HTVP ++ V
Sbjct: 174 E-GTEEDEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWNIFRHTVPSYVGV 232

Query: 231 HALFNKTNGGAIISHEN-IYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAA 289
             +F +     ++++++ IY FAK VY+ L+ ++ + Q          I  L++D    +
Sbjct: 233 EQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAISQLEIDPSCTS 292

Query: 290 VSF--SKNEVQFRLMLHKDQIVSCSLVG-EALDGNVKPQLETIFLGPLHELEIKLKHL 344
           VSF   K     +L L    +++CS +  E +  N +       LGP+  L  +++ L
Sbjct: 293 VSFHIEKLGCFVKLKLDATDVIACSCIPHENVSWNAQ------MLGPVVSLPDRIESL 344

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  134 bits (336), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 123/238 (51%), Gaps = 11/238 (4%)

Query: 110 MFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTD 169
           MFD ++A   +T+ILTSPSK ++ +   K+ E   +  +  EN+YR  G++ FPVVDP+D
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDI--ENLYRTIGLSTFPVVDPSD 58

Query: 170 LKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFKHTVPIFID 229
           ++   E  +T   R MIG+RLE+FNE    FE P          +  W +F+HT+P ++ 
Sbjct: 59  VE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVG 117

Query: 230 VHALFNKTNG-GAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAA 288
           V  LF +T     +     IY F K VY  L+ ++ + Q  + L  SG++  L +D    
Sbjct: 118 VERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCT 177

Query: 289 AVSFS--KNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHL 344
           + SF   +  V  +L L +  I +CS +  +       +     LGP+  L  +L+ L
Sbjct: 178 SASFQMMQGSVSVKLKLSETDITACSSIPRS-----SQKWTATILGPVQSLPRRLQTL 230

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  135 bits (339), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 143/279 (51%), Gaps = 26/279 (9%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDAD-KLANHPVVKNFQSVFHQFPQL 59
           MS++ DL+QDI AL  E+  L  +RD LKD  +    D  +A     +  QS+  QFPQL
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKDIQKDTSIAETNADRQLQSLLDQFPQL 60

Query: 60  YDVL------SEETTARHEESTQDPISLKRKRNTDVNSPK---KDKSFRGDHP------- 103
           +D+L       + +   H     D   L RKR ++  SP    K  S   + P       
Sbjct: 61  HDILLSDNAIDKSSPVLHNNGEDDTSLLSRKRKSEHGSPNTKHKRLSLSANLPEHEWVLK 120

Query: 104 --PVFQHQMFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITY 161
             P  +H+MFD S+A  + T+IL+SPSK     K+ + D +  R  +LLE+ Y+  G+ +
Sbjct: 121 MQPPIEHKMFDTSVADVLGTDILSSPSKRIIETKERQSD-NLQRTLILLEDFYKKLGVNF 179

Query: 162 FPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDSWLLFK 221
             + DP DL++N++    ++  +M+G+R E+ +   A+              SD W+ +K
Sbjct: 180 LQLFDPNDLEMNEKMEALQMKGDMLGVRFELPSSEGAQ---KYYLLLKKETASDYWIPYK 236

Query: 222 HTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLI 260
           H++P  IDV+  F      A  SHE+IYL AK +Y QL+
Sbjct: 237 HSLPNIIDVNEYFVNV---AAESHEDIYLIAKDIYLQLL 272

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 133/243 (54%), Gaps = 16/243 (6%)

Query: 110 MFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPR---NQVLLENVYRMFGITYFPVVD 166
           MFD ++A F+DT +L SPSK R ++  T+ ++   R   N + +EN YRM GIT+FP+VD
Sbjct: 1   MFDPALAPFLDTELLRSPSK-RGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVD 59

Query: 167 PTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXX-XXXSDSWLLFKHTVP 225
           P  L    + N+  +N EM+GIRLEVFNE+  RF+ P           +  W LFKHT+P
Sbjct: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118

Query: 226 IFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDL 285
             +D   +++ T  GAI S  ++YLFAK  Y +LI++  R+Q +  L    + +N+  D 
Sbjct: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARL-DPYLFENIRTDS 177

Query: 286 EAAAVSF----SKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKL 341
            AA +SF        +   ++L   ++ SC      LD     +   + +G L +L  K+
Sbjct: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQ-----LDQQQHDEWAHVLVGALADLPNKV 232

Query: 342 KHL 344
           + L
Sbjct: 233 RVL 235

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 129/243 (53%), Gaps = 15/243 (6%)

Query: 107 QHQMFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQ----VLLENVYRMFGITYF 162
           +H+MFD +IA F DT I+ SPSK  + MK +      P N+    V +EN YRM GIT+F
Sbjct: 6   EHRMFDPTIASFFDTEIVRSPSKRNKLMKSSA-TSIRPDNELEKFVEIENCYRMSGITFF 64

Query: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXSDS-WLLFK 221
           P+VDP  L  N   + T +  E++GIRLEVFNE+  ++E P          ++  W L+K
Sbjct: 65  PLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYK 124

Query: 222 HTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNL 281
           HT+P  ID+  +++ T  G I   + +Y+FAK  Y +L+ +  R+Q + +L    + +N+
Sbjct: 125 HTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNL-DPQLFENI 183

Query: 282 DLDLEAAAVSF---SKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELE 338
            +D  A  +SF    +  +     L    I+ C      +D     +   I LGPL +L 
Sbjct: 184 KVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCD-----IDIERHNEWSKIILGPLVDLP 238

Query: 339 IKL 341
            K+
Sbjct: 239 DKI 241

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  118 bits (295), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 145/298 (48%), Gaps = 54/298 (18%)

Query: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60
           M+E+ DL+QDI AL  E+  L K+RD LK + +        + P+V     +  QFPQL 
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 61  DVL--------SEETTARHEESTQDPISLKRK-----------------RNTDVNSPKKD 95
           ++L        S  +T+  EES +     KRK                  N + + P+ +
Sbjct: 61  EILLSKPSVTESSRSTSNEEESDK-----KRKLDNEKIQAFQDAKKSKLNNENDDLPEHE 115

Query: 96  KSFRGDHPPVFQHQMFDESIAQFIDTNILTSPSKARRRMKDTK----YDEDAPRNQVLLE 151
              +   P   +H+MFD S+A  ++T +L+SPSK R  +K+ +     ++   +   LLE
Sbjct: 116 WVLKNQRP--VEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLE 173

Query: 152 NVYRMFGITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXX 211
           NV+R+ GI++F  VDP DL+            +MIGIRL+ FN+  ++            
Sbjct: 174 NVFRIVGISFFDAVDPNDLE-----------SDMIGIRLDPFNQP-SKVYYIILKKEAKN 221

Query: 212 XXSDSWLLFKHTVPIFIDVHALFNKTNGGA------IISHENIYLFAKTVYRQLIELT 263
                W + KHT+P +I+V   F ++          I +H++IYL AK VY +L+ L+
Sbjct: 222 NREGLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKLLLLS 279

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 134/328 (40%), Gaps = 68/328 (20%)

Query: 1   MSELEDLQQDIDALTREIG----DLVKERDGL-KDELRRNDADKLANHPVVKNFQSVFHQ 55
           M E E +QQDI+AL REI      +     G  KDE++  DA               + Q
Sbjct: 1   MEETEAVQQDIEALEREIQTIKIQIANAHSGASKDEVKIPDA---------------YKQ 45

Query: 56  FPQLYDVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESI 115
           F  L + ++     R +E+T   I+L         SP+K  +  G      Q Q  D SI
Sbjct: 46  F--LSENINFSNLMRKDENTTLSINL---------SPRKPGTTTG------QIQGIDSSI 88

Query: 116 AQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTDLKVNKE 175
                 +   +     + + D           V  EN  R+ G++ FPV        N +
Sbjct: 89  RSNFGVSSGHNEVAGFKSITDF----------VQWENSVRLIGVSLFPV--------NYD 130

Query: 176 TNKTEINREMIGIRLEVFNESIARFEKPXXXXXXXXXXS-DSWLLFKHTVPIFIDVHALF 234
                 N E +GIRLE+F+E   +++ P              W LFKH +P +I++H  +
Sbjct: 131 ------NIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHW 184

Query: 235 NKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDN----LDLDLEAAAV 290
                    S  NI  FA   Y+ L+++ +R+Q    L  + V D     L +D     V
Sbjct: 185 QLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNV 244

Query: 291 SF--SKNEVQFRLMLHKDQIVSCSLVGE 316
           SF    + ++ ++    D+I+ C+  GE
Sbjct: 245 SFRLGADIIKIKVDDGDDEIIDCTFNGE 272

>YLR371W Chr12 (862714..866784) [4071 bp, 1356 aa] {ON}  ROM2GDP/GTP
           exchange factor (GEF) for Rho1p and Rho2p; mutations are
           synthetically lethal with mutations in rom1, which also
           encodes a GEF; Rom2p localization to the bud surface is
           dependent on Ack1p
          Length = 1356

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 62  VLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPPVFQHQMFDESIAQFIDT 121
           +LS++T  +    TQ   SL    NT V+SPKK +     HP V    M          +
Sbjct: 100 ILSQQTNIKEVPDTQ---SLSSADNTPVSSPKKARDATSSHPIVHAKSM----------S 146

Query: 122 NILTSPSKARRRMK---DTKYDEDAPRNQVLLEN 152
           +I ++ + A R+ K   D      +PRN+V  +N
Sbjct: 147 HIYSTSNSASRQAKHYNDHPLPPMSPRNEVYQKN 180

>Suva_8.158 Chr8 (276218..277087) [870 bp, 289 aa] {ON} YOR106W
           (REAL)
          Length = 289

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 37/82 (45%)

Query: 265 RMQNLEDLMSSGVIDNLDLDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVKP 324
           + + L DL+ +    +  L+ E   +   ++  + R M+  + I +C+ V + ++GN+  
Sbjct: 26  KTRELSDLIEAFAEQSRILEKECTKIGSKRDSKELRYMIETELIPNCTSVRDKIEGNIAI 85

Query: 325 QLETIFLGPLHELEIKLKHLDQ 346
                  G    L+ K + L Q
Sbjct: 86  HPNGKLSGDFRNLKTKYQSLQQ 107

>SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 465

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 89  VNSPKKDKSFRGDHPPVFQHQMFDESIAQ 117
           +NSPK  K+F G  P  FQH   +E + Q
Sbjct: 31  LNSPKPAKTFPGSQPVSFQHSDIEEKLLQ 59

>Skud_10.197 Chr10 complement(363729..364291,364369..364390) [585
           bp, 194 aa] {ON} YJL024C (REAL)
          Length = 194

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 123 ILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRM-------FGITYFPVVDPTDLKVNKE 175
           +L    K + R+       D P+ ++LLE VY +       F  ++  +V P  L ++ E
Sbjct: 5   VLIFNKKCQPRLVKFYTPVDLPKQKLLLEQVYELISQRNSDFQSSF--LVTPPSLLLSNE 62

Query: 176 TNKTEINREMIGI 188
            N++E+N E I I
Sbjct: 63  NNRSEVNNEDIQI 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,319,593
Number of extensions: 1664136
Number of successful extensions: 6140
Number of sequences better than 10.0: 63
Number of HSP's gapped: 6318
Number of HSP's successfully gapped: 63
Length of query: 347
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 237
Effective length of database: 40,868,139
Effective search space: 9685748943
Effective search space used: 9685748943
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)