Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E027705.350ON25825812241e-172
ZYRO0D10142g5.350ON2552476769e-89
NCAS0F028605.350ON2532435926e-76
KLTH0H14828g5.350ON2512445847e-75
KAFR0C018605.350ON2592515813e-74
Kpol_339.115.350ON2582515735e-73
Kwal_34.159845.350ON2512425526e-70
NDAI0C043105.350ON2592585459e-69
CAGL0H07117g5.350ON2602525232e-65
Suva_2.4885.350ON2742625182e-64
SAKL0G08866g5.350ON2552415134e-64
Skud_4.5855.350ON2742625032e-62
Smik_4.5785.350ON2742534991e-61
TPHA0E011305.350ON2772614782e-58
YDR319C5.350ON2742624693e-57
KLLA0B10153g5.350ON2672484467e-54
KNAG0C055105.350ON2642674206e-50
Ecym_81835.350ON2652484092e-48
AGR350C5.350ON2612444075e-48
TBLA0A031105.350ON2752233912e-45
KNAG0F025106.117ON246771064e-05
KAFR0A046406.117ON237146976e-04
Skud_7.1466.117ON316152986e-04
TBLA0F025006.117ON327104940.002
AAR165W6.117ON362110900.007
YGL126W (SCS3)6.117ON380115890.008
CAGL0I00330g6.117ON37164850.026
KLLA0F09526g6.117ON33749840.039
Smik_7.1456.117ON38092830.047
SAKL0A07062g6.117ON42941830.049
NDAI0I017506.117ON38139810.076
ZYRO0A09240g6.117ON37258800.098
TPHA0J018106.117ON39037790.16
Ecym_30686.117ON36746750.44
Kpol_461.26.117ON39737740.56
TDEL0G035306.117ON36843740.57
Kwal_14.17966.117ON36336674.3
KLTH0H06556g6.117ON36338674.6
NCAS0D031606.117ON39044674.8
ZYRO0F00528g6.12ON7727616.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E02770
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   476   e-172
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   265   9e-89
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   232   6e-76
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   229   7e-75
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   228   3e-74
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   225   5e-73
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   217   6e-70
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   214   9e-69
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   206   2e-65
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   204   2e-64
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   202   4e-64
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   198   2e-62
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   196   1e-61
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   188   2e-58
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   185   3e-57
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   176   7e-54
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   166   6e-50
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   162   2e-48
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   161   5e-48
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   155   2e-45
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    45   4e-05
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    42   6e-04
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    42   6e-04
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    41   0.002
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    39   0.007
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    39   0.008
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    37   0.026
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    37   0.039
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    37   0.047
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    37   0.049
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    36   0.076
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    35   0.098
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    35   0.16 
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    33   0.44 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    33   0.56 
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    33   0.57 
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    30   4.3  
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    30   4.6  
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    30   4.8  
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    28   6.8  

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  476 bits (1224), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/258 (91%), Positives = 237/258 (91%)

Query: 1   MLLLIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKG 60
           MLLLIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKG
Sbjct: 1   MLLLIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKG 60

Query: 61  NLVWTVDFVCLALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITF 120
           NLVWTVDFVCLALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITF
Sbjct: 61  NLVWTVDFVCLALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITF 120

Query: 121 FIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
           FIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF
Sbjct: 121 FIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180

Query: 181 RSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVL 240
           RSYMERESVVFP                     MLMVTAVYYHTVLEKVLGCALGYVCVL
Sbjct: 181 RSYMERESVVFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVL 240

Query: 241 VMYWLIPRSRRFNGLLYS 258
           VMYWLIPRSRRFNGLLYS
Sbjct: 241 VMYWLIPRSRRFNGLLYS 258

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  265 bits (676), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 169/247 (68%)

Query: 11  KIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVC 70
           K AA +YP+ELV+GC +A+++G +RLE QR+ +Y L   N IN IFAY+GN +WT+ F  
Sbjct: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68

Query: 71  LALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLT 130
           LA +Q+Y+K     ++PRDART    P+ SLLK+Y  KIILKN+LLAI F  ID+IF+LT
Sbjct: 69  LAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVKIILKNLLLAIIFLFIDNIFILT 128

Query: 131 GGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVV 190
           GGSC +   T SAE+C  +GG W+GGFDISGHFCFLV+ISMILWLEL    S++  E +V
Sbjct: 129 GGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMV 188

Query: 191 FPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSR 250
                                  +LMVT++YYHT+LEK+LGCA+GY+C ++MYWLIP   
Sbjct: 189 KRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHD 248

Query: 251 RFNGLLY 257
               +LY
Sbjct: 249 IVRKVLY 255

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  232 bits (592), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 154/243 (63%), Gaps = 2/243 (0%)

Query: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75
           +YP  LVLG +I  I+ E+ L+ Q+  YY+L SKNI+N +FAY GNL+W + F  +A  Q
Sbjct: 13  VYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQ 72

Query: 76  IYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCL 135
           ++++ R   LLPRDA+  +   L+ L+KQY  K +LK +LL ITF  ID +F+ TGG C 
Sbjct: 73  VWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFLFTGGQCT 132

Query: 136 NGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPXXX 195
            G    SAE+C+  GG W+GGFDISGHFCFL+N+S+ILW ELS    Y+  E +      
Sbjct: 133 YGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEEL--EMET 190

Query: 196 XXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGL 255
                             ML VTA+YYHT+LEK+LGC LGY C L+MYWLIP   + N +
Sbjct: 191 IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHYKLNHI 250

Query: 256 LYS 258
           LYS
Sbjct: 251 LYS 253

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  229 bits (584), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 151/244 (61%), Gaps = 3/244 (1%)

Query: 14  ASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLAL 73
           A +YP+ L+ G V+  +     L+ Q+ TYYLL   N+IN +FAYKGNL+WT+ FV LA 
Sbjct: 11  AFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAA 70

Query: 74  VQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGS 133
            QI ++     LLPRDART        L K+Y  KIILKN+LL + FF+ID +FV TGGS
Sbjct: 71  YQIKIRVSRSDLLPRDARTTYPARWHRLGKEYAVKIILKNLLLYVIFFVIDCVFVWTGGS 130

Query: 134 CLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPX 193
           C +   T+SAERCR  GG+W+ GFDISGHFCFL N+S+ILWLELS  + Y+  +      
Sbjct: 131 C-SSSATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDERT--P 187

Query: 194 XXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFN 253
                               +L VTA+YYHT LEK+LG  +GY+C ++MYWL+P      
Sbjct: 188 SKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPSHTALR 247

Query: 254 GLLY 257
            LLY
Sbjct: 248 QLLY 251

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  228 bits (581), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 154/251 (61%), Gaps = 2/251 (0%)

Query: 10  PKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFV 69
           P I + IYP  L LG  ++ ++ ++    Q+   YLL S NIIN IFAY GNLVW + F 
Sbjct: 8   PLIISLIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFS 67

Query: 70  CLALVQIYVKCRNHALLPRD-ARTNSSGPLKS-LLKQYTSKIILKNVLLAITFFIIDSIF 127
            +A +QIY++     LLP D    +S   +++ LLK+Y  K +LK  +L + F IID+IF
Sbjct: 68  FVASLQIYIRSHTFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIF 127

Query: 128 VLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERE 187
           +LTGGSC  G  TRSAE+C+  GG W GGFDISGHFCFL NIS+ILW+EL  +  Y E E
Sbjct: 128 ILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEE 187

Query: 188 SVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIP 247
            +                        +L+VT++YYHT+LEK+LGC +GY C LVMYWLIP
Sbjct: 188 ELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIP 247

Query: 248 RSRRFNGLLYS 258
              R   LLY+
Sbjct: 248 NQPRMKSLLYA 258

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  225 bits (573), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 158/251 (62%), Gaps = 4/251 (1%)

Query: 11  KIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVC 70
           ++ + IYP E+++G  ++ I+G+ +LE QR  +Y+L S NI+N +FAY GN VW V F+ 
Sbjct: 7   RVVSLIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIF 66

Query: 71  LALVQIYVKCRNHALLPRDARTNSSGPL----KSLLKQYTSKIILKNVLLAITFFIIDSI 126
           L LVQIY + +  +LL      N    L    K L+KQY  K+ILKN++L + F +ID++
Sbjct: 67  LCLVQIYYRSKRFSLLISSESFNGRDQLIARGKPLVKQYICKLILKNLMLILVFSVIDNV 126

Query: 127 FVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMER 186
           F+ +GG C +G  TRS++RCR   G W+GGFDISGHFCFLV ISMILW+EL QF+ +++ 
Sbjct: 127 FIFSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDL 186

Query: 187 ESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLI 246
           E +                        +L +T+VYYHT +EKVLGCA+GY+   VMY +I
Sbjct: 187 EGLSGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHII 246

Query: 247 PRSRRFNGLLY 257
           P +     +LY
Sbjct: 247 PNNEFLYSILY 257

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  217 bits (552), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 115/242 (47%), Positives = 145/242 (59%), Gaps = 3/242 (1%)

Query: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75
           +YP  L  G +I  ++   RLE QR +YYLL S NI+N +FAY+GNL WT+ F  LA+ Q
Sbjct: 13  VYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAVFQ 72

Query: 76  IYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCL 135
           +++      LLPRDAR+        L KQYT K+ILKNVLL + F  ID++FV TGGSC 
Sbjct: 73  VWLHAEQSDLLPRDARSVHRVGGVRLAKQYTVKLILKNVLLYLAFLFIDNLFVWTGGSC- 131

Query: 136 NGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPXXX 195
           +   TRSAERCR  GG W  GFDISGHFCFL NIS+ILW EL   +  +  + +      
Sbjct: 132 STSSTRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKKISSDDI--SPTK 189

Query: 196 XXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGL 255
                             +L VTAVYYHT+LEKVLG  +GY+C  +MY +IP       L
Sbjct: 190 TWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMYLVIPNHSGLRSL 249

Query: 256 LY 257
           LY
Sbjct: 250 LY 251

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  214 bits (545), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 116/258 (44%), Positives = 157/258 (60%), Gaps = 4/258 (1%)

Query: 4   LIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLV 63
           ++P   P+I   IYP  L +G +I  +L  + L+  +  YY+L SKNI N + AY GN V
Sbjct: 3   ILPIPWPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKV 61

Query: 64  WTVDFVCLALVQIYVKCRNHALLPR--DARTNSSGPLKSLLKQYTSKIILKNVLLAITFF 121
           W++ F+ L+++QI ++  N  LLPR  D+  +    + SL+KQY  K +LKNVLLA  F 
Sbjct: 62  WSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLFL 121

Query: 122 IIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFR 181
           IIDS+F+LTGG C   +   SAE C+  GG+W+GGFDISGHFCFL+NIS+ILW ELS   
Sbjct: 122 IIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLN 181

Query: 182 SYME-RESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVL 240
             +E RE                          +L VTAVYYHT+LEK+LGC LG+VC +
Sbjct: 182 KVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPI 241

Query: 241 VMYWLIPRSRRFNGLLYS 258
           VMY+ IP + +    LY 
Sbjct: 242 VMYYFIPNNVKLKQTLYK 259

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  206 bits (523), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 147/252 (58%), Gaps = 2/252 (0%)

Query: 9   TPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDF 68
           T K  +  YP+ L+LGC ++ +L E+    QR  YYLL SKN+ N I AYKGN VW   F
Sbjct: 5   TRKQVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLF 64

Query: 69  VCLALVQIYVKCRNHALLPRDART--NSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSI 126
           + +A VQ  ++ ++ +LLP D R    S+     ++K+Y  K  LK  +L + F +ID +
Sbjct: 65  MGVAAVQYNLRTKSQSLLPTDTRALVVSNKTKLQIIKEYFCKYFLKLFILDVIFLVIDGV 124

Query: 127 FVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMER 186
           F++TGGSC   + + SAE C+  GG+W GGFDISGHFCFLVNISMILW+EL     ++  
Sbjct: 125 FIMTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCG 184

Query: 187 ESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLI 246
              V                       ML+VTA YYHT+ EK++GC  GY+C  VMY LI
Sbjct: 185 YDTVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLI 244

Query: 247 PRSRRFNGLLYS 258
           P S   N L Y+
Sbjct: 245 PNSHDLNKLFYA 256

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  204 bits (518), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 158/262 (60%), Gaps = 17/262 (6%)

Query: 13  AASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLA 72
           A  +YP+++++G VI+ ++ E+ L  Q++TY LL+S N++N IFAYK N +W + F  LA
Sbjct: 12  AYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFFSLA 71

Query: 73  LVQIYVK--CRNHAL-LPRDARTNSS-----GPLKSLLK---------QYTSKIILKNVL 115
           L+QIY     R   L LP  +    S     G  + LLK         QY  K +LKN+L
Sbjct: 72  LLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVLKNLL 131

Query: 116 LAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           L ++F  ID +FV TGG C +G  T SAE+CR+  G+W GGFDISGHFCFLVNISMILW+
Sbjct: 132 LFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISMILWM 191

Query: 176 ELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALG 235
           EL  F  +++ E +++                      +L VTA+YYHT+LEK+LGC +G
Sbjct: 192 ELHLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCLMG 251

Query: 236 YVCVLVMYWLIPRSRRFNGLLY 257
           Y+C + +Y ++PR    +  LY
Sbjct: 252 YICPVFIYHILPRIELLHDYLY 273

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  202 bits (513), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 149/241 (61%), Gaps = 3/241 (1%)

Query: 17  YPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQI 76
           YPL L+LG ++  ++    L+ Q+  YYLL S+N+IN +FAY+GN ++ + F+ LA +QI
Sbjct: 18  YPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQI 77

Query: 77  YVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCLN 136
           ++  +N  LLPR++ ++       L +QY  K +LK +LL + F+IID +F+ TGG C +
Sbjct: 78  HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVC-S 136

Query: 137 GDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPXXXX 196
              TRSAERCR+ GG W+GGFDISGHFCFL N+S+ILW EL  ++ Y+    +       
Sbjct: 137 ISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNEL--RVNRK 194

Query: 197 XXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGLL 256
                            +L VTA YYHTV EKVLG  +GY C  VMY LIP + + N L+
Sbjct: 195 FAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLM 254

Query: 257 Y 257
           Y
Sbjct: 255 Y 255

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 151/262 (57%), Gaps = 17/262 (6%)

Query: 13  AASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLA 72
           A  IYP ++++G +I+ ++  + L  Q++TY LL+S N+ N +FAYK N +W   F  LA
Sbjct: 12  AYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFFSLA 71

Query: 73  LVQIYVK-CRNHALLPRDARTNSSGPLKS----------------LLKQYTSKIILKNVL 115
            +QIY        +LP    ++ +GP  S                +  QY  K ILK++L
Sbjct: 72  FLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILKSLL 131

Query: 116 LAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           L + F  ID +F+ TGG C +G  T SAE+CR+  G+WQGGFDISGHFCFLVNISMILW+
Sbjct: 132 LYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWM 191

Query: 176 ELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALG 235
           EL  F  +++ E + +                      +L VTA+YYHTVLEK+LGC +G
Sbjct: 192 ELHLFSKFVQAEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMG 251

Query: 236 YVCVLVMYWLIPRSRRFNGLLY 257
           Y+C + +Y ++P+    +  +Y
Sbjct: 252 YICPIFIYHVLPKIGLLHDYIY 273

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  196 bits (499), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 152/253 (60%), Gaps = 17/253 (6%)

Query: 13  AASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLA 72
           A  IYP ++++G +I+ ++    L+ Q++T+ LL+S N+ N IFAYK N +W + F  LA
Sbjct: 12  AYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLA 71

Query: 73  LVQIYVK-CRNHALLPRDARTNSSGP-----------LKS-----LLKQYTSKIILKNVL 115
            +Q+Y        +LP    ++ + P           LK+     ++ QY  K ILK +L
Sbjct: 72  FLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYML 131

Query: 116 LAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           L ++F  ID +F+ TGG C +G  TRSAE+CR+  G+W GGFDISGHFCFLVNISMILW+
Sbjct: 132 LFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWM 191

Query: 176 ELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALG 235
           EL  F  +++ E +V+                      +L VTA+YYHT+LEK+LGC +G
Sbjct: 192 ELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMG 251

Query: 236 YVCVLVMYWLIPR 248
           Y+C + +Y ++P+
Sbjct: 252 YICPIFIYHILPK 264

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  188 bits (478), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 142/261 (54%), Gaps = 12/261 (4%)

Query: 10  PKIAASI-YPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDF 68
           P  A SI Y   L+ G  +  ILG + LE  + ++Y L SKN IN IFAY GNLVW + F
Sbjct: 17  PLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLF 76

Query: 69  VCLALVQIYVKCRN-HALLPRDARTN----------SSGPLKSLLKQYTSKIILKNVLLA 117
             +  + ++ +  N   LLP  A             +      L KQY  K  +K+  L 
Sbjct: 77  CLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLF 136

Query: 118 ITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLEL 177
           + FF ID++FVL+GGSC +G  T  +E CR + G+W+GGFDISGHFCFL+ IS+ILW EL
Sbjct: 137 VIFFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCEL 196

Query: 178 SQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYV 237
            +    ME ES                         +L +TA+YYHT  EKVLGC LG+V
Sbjct: 197 YKLHKRMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFV 256

Query: 238 CVLVMYWLIPRSRRFNGLLYS 258
             L+MY+ IP +   NGLLY 
Sbjct: 257 TPLLMYYTIPSNEFLNGLLYK 277

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  185 bits (469), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/262 (38%), Positives = 146/262 (55%), Gaps = 17/262 (6%)

Query: 13  AASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLA 72
           A  IYP ++ +G +++ ++  + L  Q+ T  LL+S NI N IFAYK N +W   F  LA
Sbjct: 12  AYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFFSLA 71

Query: 73  LVQIYVK--CRNHAL-LPRDARTNSSGPLKS--------------LLKQYTSKIILKNVL 115
            +QIY     R   L LP  +   SS  L                ++ QY  K +LK +L
Sbjct: 72  FLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLKYLL 131

Query: 116 LAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           L + F  ID +F+ TGG C +G  T SAE+CR+  G+W GGFDISGHFCFLV+ISMILW+
Sbjct: 132 LFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWM 191

Query: 176 ELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALG 235
           EL  F  +++ E + +                      +L VTA+YYHT+LEKVLGC +G
Sbjct: 192 ELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMG 251

Query: 236 YVCVLVMYWLIPRSRRFNGLLY 257
           ++C + +Y ++P+    +  LY
Sbjct: 252 FICPVFIYHILPKIGILHNYLY 273

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  176 bits (446), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 146/248 (58%), Gaps = 10/248 (4%)

Query: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75
           IYP  ++ G  I+ ++GED LE +R+ +Y +  +N++N +FAYKG  ++ V F  L  +Q
Sbjct: 21  IYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQ 80

Query: 76  IYVKCRNH-ALLPR---DARTNSSGPLKSL---LKQYTSKIILKNVLLAITFFIIDSIFV 128
           +YV+ ++  +LLP    +   NS   LK +   LK Y+ K +L  ++L   F  ID +FV
Sbjct: 81  VYVRMKHEESLLPTSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDHLFV 140

Query: 129 LTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERES 188
            TGG+C   D T+SAE+CR  GG W GGFDISGHFCFL NIS+ LW EL     Y  + +
Sbjct: 141 WTGGNCDLSD-TKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHT 199

Query: 189 VVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPR 248
           + +                      +L +T++YYHT  EKVLGCA GY C+LV+Y+++PR
Sbjct: 200 ISW--NSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPR 257

Query: 249 SRRFNGLL 256
            +  N  L
Sbjct: 258 IKHVNKFL 265

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  166 bits (420), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 150/267 (56%), Gaps = 13/267 (4%)

Query: 2   LLLIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGN 61
           +LL   + P +   +YP  L +G ++  ++ E   +  ++  Y   SKN++N +FAYKGN
Sbjct: 1   MLLDKLIWPNVVL-LYPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGN 59

Query: 62  LVWTVDFVCLALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFF 121
           LVWTV F+ +A++  ++K  +    P + R         +++QY  K++LKN LL + F 
Sbjct: 60  LVWTVLFLYIAVLSYFIKTMSRD--PLEQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFL 117

Query: 122 IIDSIFVLTGGSC--LNGDV--TRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLEL 177
           +ID +F+ TGG C  + G++   RSAE C+ +GGQW+ GFDISGHFCFL+NIS+ILW EL
Sbjct: 118 VIDGVFIATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAEL 177

Query: 178 SQFRSYMERESVV------FPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLG 231
              +  + RE +       +                      +L VTA +YHT  EK++G
Sbjct: 178 QLLQDAIRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIG 237

Query: 232 CALGYVCVLVMYWLIPRSRRFNGLLYS 258
           CA GYVC  VMY LIP S R N   Y 
Sbjct: 238 CAFGYVCPFVMYHLIPTSPRLNEFFYG 264

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 135/248 (54%), Gaps = 9/248 (3%)

Query: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75
           +YP  +  G V+  + G +RLE  R+++YLL   N++N +F   GN VW V ++ +A VQ
Sbjct: 21  VYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQ 80

Query: 76  IYVKCRNHALLPRDARTNSSGPLKS------LLKQYTSKIILKNVLLAITFFIIDSIFVL 129
            Y++ +    LP       S   +       L+KQ+  K+ LK VLL   F++ID +F+ 
Sbjct: 81  CYIRTKESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFIW 140

Query: 130 TGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESV 189
           TGG C   D T+S+  C    G+W GGFDISGHFCF+ N+S+ILW EL     Y+    +
Sbjct: 141 TGGRCTVSD-TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199

Query: 190 VFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRS 249
                                   +L VTA++YHT+LEKVLG  LGYVC +VMY +IP  
Sbjct: 200 --RLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPYY 257

Query: 250 RRFNGLLY 257
            +   +LY
Sbjct: 258 PKLQRILY 265

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  161 bits (407), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 136/244 (55%), Gaps = 14/244 (5%)

Query: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75
           +YP  L+ G VI  ILGE+ +E  R+T+YLL   N +N +F + G L+WT+    +  +Q
Sbjct: 19  LYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLALQ 78

Query: 76  IYVKCRNHALLPRDARTNSSGPLK--------SLLKQYTSKIILKNVLLAITFFIIDSIF 127
            +V+      LP DAR    GP+K        S+  Q   K++L   +L   F+ +D +F
Sbjct: 79  YHVRTTEFDPLPLDAR--ELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQALFWFMDHLF 136

Query: 128 VLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERE 187
           V TGG C   D T+ +  CR  GG+W GGFDISGHFC ++N+S++LWLEL++ + YM  +
Sbjct: 137 VWTGGRCTVSD-TKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYMHSQ 195

Query: 188 SVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIP 247
            +                        +L +TA+YYHT +EK+LG   GY   LV+Y+++P
Sbjct: 196 EI---QLRKFAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYYVLP 252

Query: 248 RSRR 251
           R  R
Sbjct: 253 RINR 256

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  155 bits (391), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 123/223 (55%), Gaps = 7/223 (3%)

Query: 43  YYLLESKNIINGIFAYKGNLVWTVDFVCLALVQIYVKCRNHAL-LPRDARTNS------S 95
           ++L+ S +  N +FAY GN V+   F+ +  +Q+Y    +  L LP + RT S      +
Sbjct: 53  FWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQT 112

Query: 96  GPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQG 155
                + K+Y  K+ILK   L + F  ID +FVLTGG C NG  TR A  CR   G+W G
Sbjct: 113 KHYLRIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWVG 172

Query: 156 GFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXXXXML 215
           GFDISGHFCFLV +S+I+WLEL +   ++    +                        ML
Sbjct: 173 GFDISGHFCFLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVSILILWIVML 232

Query: 216 MVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGLLYS 258
            VT++YYHT +EK+LGC +GY+C +VMY ++PR+  F   +Y 
Sbjct: 233 CVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIYK 275

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 11/77 (14%)

Query: 97  PLKSLLKQYT----SKIILKNVLLAITFFIIDSIFVLTGGSCLNGDVT-------RSAER 145
           PL  LL++YT    +  +    L      ++D +FV +GGSCL    T        ++  
Sbjct: 78  PLLPLLRRYTITTAAWYVFTQQLWLNVPPLMDLVFVWSGGSCLLDPATTPGTLWLSTSAA 137

Query: 146 CRISGGQWQGGFDISGH 162
           CR  GG WQGG D SGH
Sbjct: 138 CRRHGGLWQGGHDPSGH 154

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 60/146 (41%), Gaps = 20/146 (13%)

Query: 122 IIDSIFVLTGGSCLNGDVTRSAE----RCRISGGQWQGGFDISGHF-------CFLVN-I 169
           I+D IFV TGG C  G  +         C+  GG W  G D SGH         F++N  
Sbjct: 91  IMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIFLLSIMTTFMINEF 150

Query: 170 SMILWLELSQFRS-------YMERESVVFPXXXXXXXXXXXXXXXXXXXXXMLMVTAV-Y 221
           S I  + ++Q R         ++R+  V                        L++T++ Y
Sbjct: 151 SKIRRVSMTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLVITSINY 210

Query: 222 YHTVLEKVLGCALGYVCVLVMYWLIP 247
           YHT+ E++ G    Y+ +  +Y  +P
Sbjct: 211 YHTLSEQLSGLLFAYIIMGPLYLFLP 236

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 57/152 (37%), Gaps = 15/152 (9%)

Query: 92  TNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGG 151
           + S G ++ +L+   S  +  +    I  FI D +          G +T SA+ CR  GG
Sbjct: 170 SRSVGSIQDVLQTAESANVTASAAAGINSFIHDQMHRW------QGPLTTSAQ-CRRFGG 222

Query: 152 QWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPXXXXXXXXXXXXXXXXXXX 211
            W GG D SGH      + M L   L + R +  R                         
Sbjct: 223 HWAGGHDPSGHVFLTTLMCMFL---LGELRVFGRR-----ALAHLYAQKWHLLGMVTWLW 274

Query: 212 XXMLMVTAVYYHTVLEKVLGCALGYVCVLVMY 243
             +L   A ++HTV E + G    Y+   V+Y
Sbjct: 275 QLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query: 134 CLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPX 193
            ++  V  S+++CR  GG W GG D SGH  FL+ + ++ +L +S     + +++ +F  
Sbjct: 228 SIDPTVENSSQKCRKIGGAWSGGHDPSGH-MFLLTLMIMTFLTIS-----ISKDNYLF-- 279

Query: 194 XXXXXXXXXXXXXXXXXXXXMLMVTAVYYHTVLEKVLGCALGYV 237
                                 MVT   +HT  E++ G    Y+
Sbjct: 280 ------VRLIAAMFGLMSSYSFMVTIFNFHTFAEQITGFMAAYI 317

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 43/110 (39%), Gaps = 19/110 (17%)

Query: 88  RDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCLN----------- 136
            D+    +  L+ LL+ +T+     + L   T + I  +  LTGG C N           
Sbjct: 133 HDSEGRRTRSLQKLLQWFTAHGAQGDELRERTMYWIRCM--LTGGQCENTGLDPTELNSY 190

Query: 137 ------GDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
                     RS+  C   GG W GG D SGH   +  + M +  EL  F
Sbjct: 191 IQDSVTASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMCMFMLGELQVF 240

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 71  LALVQIYVKCRNHALLPRDAR--TNSSGPLKSLLKQ---YTSKIILKNVLLAITFFIIDS 125
           LAL+   +    H    R  +    S G ++  L+     T K +  +   AI  FI D 
Sbjct: 146 LALIHNVLTLHGHHQEHRQQQLWDRSIGSIQGALQATQPKTPKNVTASAAAAINTFIHDQ 205

Query: 126 IFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
           +          G +T SA+ CR  GG W GG D SGH      + M L  EL  F
Sbjct: 206 MHRW------QGPLTTSAQ-CRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVF 253

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 118 ITFFIIDSIFVLTGGSCLNGDVT-RSAERCRISGGQWQGGFDISGHFCFLVNISMILWLE 176
           I  FI + I   T G+    + T  ++  CR++GG WQGG D SGH   L  + + L  E
Sbjct: 206 INDFIKNFISNTTVGNSSGANSTLDNSFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGE 265

Query: 177 LSQF 180
             QF
Sbjct: 266 SKQF 269

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 139 VTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERE 187
           + +S+  C  +GG W GG D SGH   +  + M+++ ELS ++S   R 
Sbjct: 171 LVKSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQSRAFRH 219

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 38/92 (41%), Gaps = 12/92 (13%)

Query: 93  NSSGPLKSLLKQYTSKIILKNVLL----AITFFIIDSIFVLTGGSCLNGDVTRSAERCRI 148
            S G +K  L   T     KN  L    AI  FI D +          G +T SA+ CR 
Sbjct: 170 RSIGSIKDALHA-TDASAPKNATLSAAAAINTFIHDQMHRW------QGPLTTSAQ-CRR 221

Query: 149 SGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
            GG W GG D SGH      + M L  EL  F
Sbjct: 222 FGGHWAGGHDPSGHVFLATLMCMFLLGELRVF 253

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 142 SAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRS 182
           S+++C+  GG W GG D SGH   +  + M L  EL  F S
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGELQMFWS 306

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 142 SAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
           ++ +CR+ GG W  G D SGH   L  + M L  ELS F
Sbjct: 220 TSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGELSTF 258

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 10/58 (17%)

Query: 118 ITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           I  FI DSI  +        +++ SA  CR +GG W+GG D SGH    +N  MI++L
Sbjct: 188 INIFIHDSIKSVR-------EISTSAA-CRATGGHWKGGHDPSGH--IFLNTLMIMFL 235

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 143 AERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQ 179
           + +C+ +GG W GG D SGH   L  + M++  EL +
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPK 258

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 142 SAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERE 187
           + + CR  GG W GG D SGH   +  ++M L  EL  F   + R 
Sbjct: 204 NGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELRLFSDKVGRR 249

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 143 AERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQ 179
           +  CR  GG W GG D SGH   L  + M++  E+ +
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPR 266

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 133 SCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175
           S  +G    S+  CR  GG W GG D SGH  FL+ + MI++L
Sbjct: 192 SLFSGVTRNSSAVCRTLGGYWVGGHDPSGH-IFLITL-MIMYL 232

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 215 LMVTAVYYHTVLEKVLGCALGYVCVLVMYW 244
            +VT+V +HT+ E+V G A  Y+   V+YW
Sbjct: 328 FLVTSVVFHTLSEQVSGLAFAYLVAGVIYW 357

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 142 SAERCRISGGQWQGGFDISGHFCFLVNISMILWLEL 177
           S+  CR  GG W GG D SGH   +  + M L  EL
Sbjct: 202 SSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGEL 237

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%)

Query: 141 RSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELS 178
            S+  CR  GG W GG D SGH   +  + M L  EL 
Sbjct: 201 NSSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQ 238

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 137 GDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQF 180
           G ++ SA  CR  GG W  G D SGH   +  ++M +  EL  F
Sbjct: 222 GRISTSA-MCRSHGGYWTMGHDPSGHIFLITLMTMFILGELQFF 264

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 28.1 bits (61), Expect = 6.8,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 67 DFVCLALVQIYVKCRNHALLPRDARTN 93
          +++C+   +++ KC  HAL   DA TN
Sbjct: 46 EYICVPFKRVFEKCLGHALEVTDADTN 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.144    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,095,763
Number of extensions: 820998
Number of successful extensions: 2307
Number of sequences better than 10.0: 41
Number of HSP's gapped: 2307
Number of HSP's successfully gapped: 45
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)