Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E027505.352ON56456426450.0
ZYRO0D10186g5.352ON63558011221e-146
KAFR0C018505.352ON64658710411e-134
CAGL0H07095g5.352ON66160310401e-133
NDAI0C043205.352ON70655410391e-132
NCAS0F028705.352ON70034510261e-131
YDR320C (SWA2)5.352ON6685269881e-125
Kpol_339.135.352ON6863409891e-125
KNAG0C055005.352ON5854819521e-121
Suva_2.4895.352ON6595899491e-120
Smik_4.5795.352ON6675209491e-120
Skud_4.5865.352ON6425689261e-116
TPHA0E011105.352ON6933739291e-116
TBLA0H019705.352ON8403858921e-109
SAKL0G08822g5.352ON5825548531e-106
Kwal_34.159775.352ON5975697618e-93
Ecym_81815.352ON6613296691e-78
KLLA0B10197g5.352ON6215326643e-78
KLTH0H14872g5.352ON6233106442e-75
AGR352C5.352ON6484386392e-74
TDEL0B051402.152ON5991271207e-06
NCAS0B070102.152ON6251901198e-06
TDEL0B013108.506ON3801291124e-05
KAFR0F007202.152ON6081601135e-05
CAGL0K09240g6.328ON142781012e-04
Skud_2.2828.506ON3851321053e-04
Smik_14.2072.152ON6171281063e-04
NDAI0B043402.152ON6641231054e-04
YBR155W (CNS1)8.506ON3851321045e-04
NCAS0H008306.21ON338811036e-04
Kpol_1048.212.152ON5971281037e-04
YCR060W (TAH1)6.328ON11169948e-04
CAGL0H07425g8.506ON3801321010.001
Suva_14.2192.152ON6171281020.001
TPHA0I015102.152ON6031271010.001
Skud_10.2511.456ON3931441000.001
Skud_14.2112.152ON6171281010.001
KAFR0C058905.617ON5751211000.001
TPHA0D038606.328ON12070930.002
KAFR0J025706.328ON12172920.002
ZYRO0G06512g2.152ON604123990.002
Skud_3.1356.328ON11870910.002
YNL121C (TOM70)2.152ON617128990.003
KLLA0F24046g2.152ON604116980.003
TBLA0H033808.506ON375123970.003
Kpol_1028.516.328ON11766900.004
Kpol_513.28.506ON37476960.004
Smik_2.2958.506ON385132960.004
SAKL0E10956g2.152ON600127950.006
Smik_3.1596.328ON11569850.015
AAR054C6.328ON133111860.016
SAKL0H10934g8.506ON380128910.016
Kwal_27.118908.506ON334127890.023
Smik_10.3061.456ON394157890.026
KNAG0H035302.152ON614123900.030
KNAG0B032005.617ON57968890.032
ZYRO0F08624g8.506ON379131890.032
TBLA0E033005.617ON58291890.033
TPHA0D028805.617ON58573890.034
NCAS0B024008.506ON380134880.036
Suva_3.956.328ON11168810.047
AGL268C8.506ON37970860.058
CAGL0L12936g2.152ON600127870.059
CAGL0L04048g2.152ON587133870.061
KAFR0E029808.506ON380254860.063
Kwal_55.199355.617ON593105870.065
TBLA0C055302.152ON610123870.068
KLLA0B09966g8.506ON370143860.069
TDEL0A048405.617ON57691850.093
NCAS0D045006.328ON12174800.094
NDAI0C052908.506ON379140840.11
NDAI0F028102.152ON609128850.12
Suva_4.4058.506ON38573840.12
YJR032W (CPR7)1.456ON393134830.14
KLTH0B05170g2.152ON593127830.16
KLTH0E02178g5.617ON593139830.18
KLTH0E11748g8.506ON37864820.18
KAFR0B066103.481ON511139830.18
TBLA0I023106.328ON11674770.18
Suva_12.1141.456ON370141820.18
ZYRO0B04224g3.481ON513120830.20
SAKL0A01672g6.328ON12865780.20
TPHA0L014208.506ON374110820.21
CAGL0H08195g5.617ON58391820.21
Ecym_55825.617ON58463820.21
NDAI0B057903.481ON52370820.22
SAKL0F03102g3.481ON513132820.22
NDAI0F009105.617ON583128820.26
KLTH0H02068g7.313ON370127810.27
NCAS0G008105.617ON58468810.28
ZYRO0A05676g5.617ON57296810.29
Skud_8.1782.152ON638174810.32
Suva_15.3142.152ON644125810.34
AEL062C1.456ON38378790.49
NDAI0I004406.328ON12867740.53
NDAI0D008106.21ON349133780.55
SAKL0G07084g5.617ON58573790.56
KNAG0A039508.506ON38667780.56
YHR117W (TOM71)2.152ON639125790.60
Smik_8.1952.152ON63588780.81
Skud_15.1925.617ON58968770.83
YOR027W (STI1)5.617ON58968770.85
TPHA0J003406.21ON33863760.97
KLLA0A07062g5.617ON58182771.0
Kwal_33.147672.152ON594123761.1
ADR230W5.689ON685134761.1
NCAS0F034903.481ON51269761.1
Suva_8.805.617ON58668761.4
KLLA0C08910g6.328ON11556711.4
Ecym_82042.152ON597129751.4
TPHA0D032203.481ON51376751.5
Kpol_1018.695.617ON59068751.7
TDEL0B053001.456ON397134741.7
ZYRO0E03300g1.456ON397141741.8
NCAS0G024802.152ON596112751.8
Suva_7.4083.481ON513131741.8
KLTH0C06204g7.412ON62767742.1
Ecym_20906.328ON17262712.1
Ecym_25598.506ON370128732.3
Smik_6.2153.481ON51389742.3
Smik_15.2055.617ON58968742.4
Ecym_44133.481ON510119732.5
ACR005W6.21ON327140732.6
AEL224W5.617ON58073732.8
CAGL0M08030g1.456ON387144732.8
SAKL0E01210g6.21ON32368722.8
Suva_15.1826.21ON346145722.9
SAKL0D11110g1.456ON432141714.5
KLLA0B10912g3.481ON51266715.0
ZYRO0C07788g6.21ON334101705.2
Suva_2.5895.514ON23579695.4
YGR123C (PPT1)3.481ON51389706.1
AAR083C3.481ON53866706.1
YOR007C (SGT2)6.21ON34668706.1
Kpol_1067.251.456ON391144697.2
ABR131W2.152ON594120698.0
CAGL0D05060g3.481ON510132698.0
KLTH0H12276g1.406ON1606150698.3
TBLA0C015901.456ON408140688.9
Ecym_30256.21ON31863689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E02750
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...  1023   0.0  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   436   e-146
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   405   e-134
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   405   e-133
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   404   e-132
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   399   e-131
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   385   e-125
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   385   e-125
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   371   e-121
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   370   e-120
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   370   e-120
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   361   e-116
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   362   e-116
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   348   e-109
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   333   e-106
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   297   8e-93
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   262   1e-78
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   260   3e-78
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   252   2e-75
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   250   2e-74
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    51   7e-06
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    50   8e-06
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    48   4e-05
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    48   5e-05
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    44   2e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   3e-04
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    45   3e-04
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    45   4e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    45   5e-04
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    44   6e-04
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    44   7e-04
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    41   8e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   0.001
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    44   0.001
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    44   0.001
Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032...    43   0.001
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    44   0.001
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    43   0.001
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.002
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    40   0.002
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    43   0.002
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    40   0.002
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    43   0.003
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    42   0.003
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.003
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    39   0.004
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    42   0.004
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.004
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    41   0.006
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    37   0.015
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.016
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    40   0.016
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    39   0.023
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    39   0.026
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    39   0.030
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    39   0.032
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    39   0.032
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    39   0.033
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    39   0.034
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    39   0.036
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    36   0.047
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.058
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    38   0.059
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    38   0.061
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    38   0.063
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    38   0.065
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    38   0.068
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    38   0.069
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    37   0.093
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    35   0.094
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    37   0.11 
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    37   0.12 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.12 
YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}  CPR7Pepti...    37   0.14 
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    37   0.16 
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    37   0.18 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    36   0.18 
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    37   0.18 
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    34   0.18 
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    36   0.18 
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    37   0.20 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    35   0.20 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.21 
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    36   0.21 
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    36   0.21 
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    36   0.22 
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    36   0.22 
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     36   0.26 
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    36   0.27 
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    36   0.28 
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    36   0.29 
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    36   0.32 
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    36   0.34 
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    35   0.49 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.53 
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    35   0.55 
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    35   0.56 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    35   0.56 
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    35   0.60 
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    35   0.81 
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    34   0.83 
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    34   0.85 
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    34   0.97 
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    34   1.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    34   1.1  
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    34   1.1  
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    34   1.1  
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    34   1.4  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    32   1.4  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    33   1.4  
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    33   1.5  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    33   1.7  
TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.4...    33   1.7  
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    33   1.8  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    33   1.8  
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    33   1.8  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   2.1  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    32   2.1  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    33   2.3  
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    33   2.3  
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    33   2.4  
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    33   2.5  
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    33   2.6  
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    33   2.8  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    33   2.8  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    32   2.8  
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    32   2.9  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    32   4.5  
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    32   5.0  
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    32   5.2  
Suva_2.589 Chr2 (1046223..1046930) [708 bp, 235 aa] {ON} YDR412W...    31   5.4  
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    32   6.1  
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    32   6.1  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    32   6.1  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    31   7.2  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    31   8.0  
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    31   8.0  
KLTH0H12276g Chr8 (1044900..1049720) [4821 bp, 1606 aa] {ON} sim...    31   8.3  
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    31   8.9  
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    31   9.3  

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/564 (89%), Positives = 507/564 (89%)

Query: 1   MSDPFAXXXXXXXXXXXXXXXKEATPEVKQEKLPGRNQINVHDDLDELFGLKKRDETVVK 60
           MSDPFA               KEATPEVKQEKLPGRNQINVHDDLDELFGLKKRDETVVK
Sbjct: 1   MSDPFADLLSSFRSGGSDSVSKEATPEVKQEKLPGRNQINVHDDLDELFGLKKRDETVVK 60

Query: 61  NQVVGDSFDAAFEAFDRPQKVEKSLEESPXXXXXXXXXXXXAKLMSLNLDIDQATDYYER 120
           NQVVGDSFDAAFEAFDRPQKVEKSLEESP            AKLMSLNLDIDQATDYYER
Sbjct: 61  NQVVGDSFDAAFEAFDRPQKVEKSLEESPEMVVDEVKDMEVAKLMSLNLDIDQATDYYER 120

Query: 121 GVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKFDSGSFFSLASGILEKGRQFVDQ 180
           GV                              TPEEKFDSGSFFSLASGILEKGRQFVDQ
Sbjct: 121 GVLYEQLSRQRREQELIRRREQMLRQQQQQQQTPEEKFDSGSFFSLASGILEKGRQFVDQ 180

Query: 181 FSGFPQEQDRLTRVRVEQDLPVERPKSVEPPTVEVEEGNLLGEFQEKINLEEPKRSPTPP 240
           FSGFPQEQDRLTRVRVEQDLPVERPKSVEPPTVEVEEGNLLGEFQEKINLEEPKRSPTPP
Sbjct: 181 FSGFPQEQDRLTRVRVEQDLPVERPKSVEPPTVEVEEGNLLGEFQEKINLEEPKRSPTPP 240

Query: 241 PQATLLDFDNGTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSL 300
           PQATLLDFDNGTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSL
Sbjct: 241 PQATLLDFDNGTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSL 300

Query: 301 NSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRT 360
           NSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRT
Sbjct: 301 NSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRT 360

Query: 361 FKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKA 420
           FKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKA
Sbjct: 361 FKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKA 420

Query: 421 TSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAG 480
           TSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAG
Sbjct: 421 TSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAG 480

Query: 481 KGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKR 540
           KGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKR
Sbjct: 481 KGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKR 540

Query: 541 MIAEDVFSSLSVAWEKFKLANDIN 564
           MIAEDVFSSLSVAWEKFKLANDIN
Sbjct: 541 MIAEDVFSSLSVAWEKFKLANDIN 564

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  436 bits (1122), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/580 (43%), Positives = 335/580 (57%), Gaps = 58/580 (10%)

Query: 41  VHDDLDELFGLKKRDETVVK------NQVVGDSFDAAFEAFD-RPQKVEKSLEESPXXXX 93
           + DD ++LFG+K    T         N    + FD+A +     P+K  +S E  P    
Sbjct: 58  IDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQITPEKQRQSAEREPEQLV 117

Query: 94  XXXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXX 152
                   AKLMSL   ID A   YE+G+                               
Sbjct: 118 DEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKKKLHRRELQRLMAETNWERE 177

Query: 153 TPEEKFD-SG----SFFSLASGILEKGRQFVDQFSGFPQEQDRLTRVRVEQ--------- 198
           TPE   D SG      FS+ASGI  KG++ VD  S FP E++ L   R E+         
Sbjct: 178 TPETNNDESGKNNVDLFSIASGIFNKGKKIVDHLSLFPDEENDLLPYRSERLKQRQTFEP 237

Query: 199 DLPVERPK---------------------SVEPPTVEVEEGNLLGEFQEKINLEEPKRSP 237
           +LP  RP+                       + PT++ +EG+LLG+FQ+K++L       
Sbjct: 238 ELP-RRPRKDPTPNPRTQGTPQVEYESTLQYQQPTIQAQEGDLLGDFQDKLSLRSQGNKS 296

Query: 238 TPPPQA----TLLDFD----NGTPPE----RIKTITP-VPISHLEISGYKEYKDRGTEFF 284
           T   Q+    TLLDFD    N T       R  ++ P VPI+ +E+SGY E+KDR  E F
Sbjct: 297 TSASQSPSNETLLDFDAPSANSTSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELF 356

Query: 285 KAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKD 344
           K GDYV+A QEYEKS N+LP  H LRI++YSNL A+  K G+YK  L     AL++FP+D
Sbjct: 357 KTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPED 416

Query: 345 PNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMG 404
              W + IQ+S+P +T+++MWPKIV RRAEAFEH EN++ A   YQSLIEKN   +KIM 
Sbjct: 417 TTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMD 476

Query: 405 GKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKA 464
           GKRRCQKVLNP +PK      + +  P  S +    K Y N+++VK++N++   ++ ++ 
Sbjct: 477 GKRRCQKVLNPEKPKVVQKKPASSKSPSPSPNHSD-KKYKNLQKVKEDNRKQAEEDTQRH 535

Query: 465 ALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVA 524
           ALYD V+ QI+ W++GK +DIRHLL+NL TVLTW DWKPVS +DLVMPKKVKITY++AVA
Sbjct: 536 ALYDRVYDQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVA 595

Query: 525 KTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           KTHPDKI  SL L+K+MIAE VFSSLS AWEKFK  NDIN
Sbjct: 596 KTHPDKISDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  405 bits (1041), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/587 (41%), Positives = 337/587 (57%), Gaps = 83/587 (14%)

Query: 41  VHDDLDELFGLKKRDETVVKNQ------VVGDSFDAAFEAFDRPQKVEKSLEESPXXXXX 94
           +HDD +ELFG    +   V  +       V D  +  +EA     K +  ++E       
Sbjct: 80  IHDDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEA-----KQDSVVDE------- 127

Query: 95  XXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP 154
                  A+LMSL L I++A  YY +G+                                
Sbjct: 128 -VKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFGGNTNKD 186

Query: 155 EEK----FDSG---SFFSLASGILEKGRQFVDQFSGFPQEQDRLTRVRVEQDLPVERPKS 207
           ++     FDS    + FS+ASG+  KG++F+DQ + +P+E DRL+R R   ++   +P  
Sbjct: 187 DKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDISEISSMKPLR 246

Query: 208 VEP----------------------PTVEVEE------GNLLGEFQEKINLEEPKRSPTP 239
             P                      PT EV++       +LL  FQ  + L++ K   + 
Sbjct: 247 KSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDNKEELSK 306

Query: 240 PPQATLLDFDNG-TPPERIKTITP------------------VPISHLEISGYKEYKDRG 280
             ++ LLD DN  +   + K++T                   +PIS +E+SGY EY  RG
Sbjct: 307 --ESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELSGYNEYNSRG 364

Query: 281 TEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEM 340
           + FFK GDY+SA +EYEKSLN+LPQ+H LRI+AYSN+TAA  K+GEY   +   + AL++
Sbjct: 365 SSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKL 424

Query: 341 FPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFND 400
           FPK+   W+  IQDS+P +++K++W K+V R+AEA EH+EN+E A + Y SLIE N F+D
Sbjct: 425 FPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSD 484

Query: 401 KIMGGKRRCQKVLNPTEPKATS--PNRS-PTPVPKVSEDTKQPKTYANVERVKQENQRNE 457
           KIM GKRRCQKVLNP   K T   P+ S P  VP     T   + Y +VER+K++N++ E
Sbjct: 485 KIMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVP-----TPSTQKYESVERIKEQNRQEE 539

Query: 458 LQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKI 517
             EAEK  LYD V  +I +WK+ K +DIRHLLANL T+LTW +WKP+S +DLVMPKKVK+
Sbjct: 540 ENEAEKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKV 599

Query: 518 TYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           TY+KA+AKTHPDKI SSL LE +MIAE+ FS+LSVAW+KFK  N++N
Sbjct: 600 TYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  405 bits (1040), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/603 (39%), Positives = 339/603 (56%), Gaps = 80/603 (13%)

Query: 40  NVHDDLDELFG-LKKRDETVVKNQVVGDSFD----------------AAFEAFDRPQKVE 82
           N+HDDLD+LFG + K+++ V  N    D  D                     FD P + E
Sbjct: 61  NIHDDLDDLFGSIPKKEDVVQDNHTSIDGLDLFQSSSHVVSKTEPDNQEINPFDNPFETE 120

Query: 83  KSLEESPXXXXXXXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXX 142
              E               AKLMSL L+ID+A+ YYERG+                    
Sbjct: 121 HKSESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVLRKRKQKASNGYQQR 180

Query: 143 XXXXXXXXXXTPEEKFD---SGSFFSLASGILEKGRQFVDQFSGFPQEQD-RLTRVRVEQ 198
                          FD   SGS  SL SGIL KG++ V+Q S + +E++ R+ + +  +
Sbjct: 181 SNIDRKQGGGEIRNIFDTRGSGSE-SLFSGILNKGKELVNQLSTYTEEENERMNKFKGYE 239

Query: 199 DLP-----VERPKSVEP-----------------PTVEVEEGNLLGEFQEKINLEEPK-- 234
           +       +E+  S++P                 P+ E +  +   +  +++  E P   
Sbjct: 240 EYSMSETYLEKENSMDPGVFSRSSQEKIPQRAARPSHE-KSNSSRSKINKRMTTEAPHKP 298

Query: 235 ----------------RSPTPPPQATLLDFDN---------GTPPERIKTITPVPISHLE 269
                           R  + P + TLLDFDN          T  +   +IT +PISH+E
Sbjct: 299 FNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVNTSNQNTVSITQIPISHIE 358

Query: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329
           ISGY E+K RGT++FK GDY SA +EYEKSLN+LP  H LRI+AYSN+ A+  K+G++ +
Sbjct: 359 ISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQ 418

Query: 330 CLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDY 389
            + D + A+++ P++ +LW   IQ+S P+R++ ++WPKI+ R+AE++E IE Y+ AL  Y
Sbjct: 419 SVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAY 478

Query: 390 QSLIEKNNFNDKIMGGKRRCQKVLN-PTEPKATSPNRSPTPVPK------VSEDTK-QPK 441
           Q+L+EKN F++K++ GKRRCQ  L   ++PK+  P++S TP P       V+  T+   K
Sbjct: 479 QTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEVVNK 538

Query: 442 TYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDW 501
              N E++K+EN+R    E +K ALYD V   I SWK GK DDIR+LL+NL  V+TW  W
Sbjct: 539 KSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWTQW 598

Query: 502 KPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLAN 561
           KPV +S+LV+P+KVKITYMKAVAK HPDK+PSSL LE++MIAE VFS+LS +WE FK +N
Sbjct: 599 KPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKKSN 658

Query: 562 DIN 564
           DIN
Sbjct: 659 DIN 661

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  404 bits (1039), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/554 (41%), Positives = 311/554 (56%), Gaps = 92/554 (16%)

Query: 102 AKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP------- 154
           A+LMSL L IDQA  YY++G+                              T        
Sbjct: 154 ARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFD 213

Query: 155 ---------EEKFDSGSFFSLASGILEKGRQFVDQFSGFPQEQDRLTRVRVEQD------ 199
                    E + ++G+ FS+A+ IL KG++ VDQ + +P+E +RL + R   D      
Sbjct: 214 NTYANKRFNESQNNTGNLFSMATDILYKGKELVDQLTAYPEENNRLYKYREPIDNEENPF 273

Query: 200 --------------------------LPVERPKSVEPPTVEVEEGN--LLGEFQEK--IN 229
                                      P  +P  VE  +++ E+ N  L+ +F  K  IN
Sbjct: 274 LQEGSRSPASARSPSLSGSHVASASAKPSSKPSYVERNSLKYEDNNTTLIDDFDYKLTIN 333

Query: 230 LEEPKRSPTPPPQAT-----------LLDFDN-------GTPPERIK------------- 258
            +EP  +   PP  T           LLDFD        G+    +              
Sbjct: 334 SKEPSMAKNIPPSITPDTTETNNNNALLDFDGLSTVTAPGSSNISVNKKNTSSSSATSPS 393

Query: 259 ------TITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIV 312
                 TI  VPISH+E+SG+ E+K RG+E FK GDYVSA QEYEKSLN+LPQ H LRI+
Sbjct: 394 PSPASITIATVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRII 453

Query: 313 AYSNLTAALFKVGEYKRCLSDIESALEMFPKD--PNLWDEPIQDSQPIRTFKEMWPKIVT 370
           +YSN+ A   K+GEY + + D + AL +FPK    + W++ I DS P R+FK++W K++ 
Sbjct: 454 SYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIM 513

Query: 371 RRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPV 430
           R+AE++EH+ENY+ AL  YQ LIE    N KIM GKRRCQK+LNP  P  TS + +PTPV
Sbjct: 514 RQAESYEHLENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPV 573

Query: 431 PKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLA 490
             +    K   T A+V+R++ EN ++   E +K ALYD V  +I +WK  K  DIRHLL+
Sbjct: 574 SILKHKEKDTTT-ASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLS 632

Query: 491 NLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSL 550
           NLSTVLTWCDW  +S +DLVMPKKVKITY+KA+ KTHPDKIP SL+LE +MIAE+VFS L
Sbjct: 633 NLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSIL 692

Query: 551 SVAWEKFKLANDIN 564
           S+AW+KFKL N++N
Sbjct: 693 SLAWDKFKLDNNMN 706

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  399 bits (1026), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/345 (56%), Positives = 248/345 (71%), Gaps = 22/345 (6%)

Query: 241 PQATLLDFDN-------GTP---------PERIKTITPVPISHLEISGYKEYKDRGTEFF 284
           P  TLLDFD+        TP              ++  +PISH+E+SGY E+++RGT++F
Sbjct: 355 PSTTLLDFDDDSSFNASNTPFVNGNNNINNNVNSSLPVIPISHIELSGYAEFRNRGTQYF 414

Query: 285 KAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKD 344
           K GDYVS+ QEYEKSLN+LP NH LRI+AYSN+ A+  K+GEY + L +  SALEMFP D
Sbjct: 415 KNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSSSALEMFPDD 474

Query: 345 PNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMG 404
              W   IQDS P RT+K++WPK+  R+AEA EHIE+++ AL  YQ LIEK   NDKIM 
Sbjct: 475 TAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEKGFANDKIMD 534

Query: 405 GKRRCQKVLN------PTEPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNEL 458
           GKRRCQKVLN         P+ ++P +SP+PVP+ +    +   Y +VER+K+EN  ++ 
Sbjct: 535 GKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVPRKATSNSKDAVYESVERLKKENATSQE 594

Query: 459 QEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKIT 518
            E +K ALYD VF ++E+WK  K  DIRHLLANLS VLTWCDWKPV+ SDLVMPKKVKIT
Sbjct: 595 VEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLSIVLTWCDWKPVAASDLVMPKKVKIT 654

Query: 519 YMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDI 563
           YMKAVAKTHPDK+P SLELE +MIAE+VFS LSVAW+KFK+ N++
Sbjct: 655 YMKAVAKTHPDKVPESLELENKMIAENVFSVLSVAWDKFKIENNM 699

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 78/196 (39%), Gaps = 40/196 (20%)

Query: 39  INVHDDLDELFGL---KKRDETVVKNQVV---GDSFDAAFEAF------------DRPQK 80
           +++HDD D+LFG+   +    T+V  Q V    D  DAAF  F              P  
Sbjct: 57  VSIHDDFDDLFGVSLGQNGTNTIVPKQTVKTETDDIDAAFNVFQATPSQSIKPEASAPND 116

Query: 81  VEKSLEESPXXXXXXXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXX 140
           +++  EE              A+LMSL L ID+A D+Y++G+                  
Sbjct: 117 IDRDEEE---YVVDEVKDMEVARLMSLGLSIDEANDHYDKGILYENLLAKMKQNQRQKER 173

Query: 141 XXXXXXXXXXXXTP-------EEKFDS------------GSFFSLASGILEKGRQFVDQF 181
                        P        ++FD+            G  FS+A+  L KG++FVDQ 
Sbjct: 174 RKVETQPTKRNSNPPSANNRLNDRFDNTYANIRDSRTRGGDLFSMATDFLYKGKEFVDQL 233

Query: 182 SGFPQEQDRLTRVRVE 197
             +P+E +RL   R E
Sbjct: 234 IAYPEENNRLLNYRDE 249

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  385 bits (988), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/526 (42%), Positives = 303/526 (57%), Gaps = 68/526 (12%)

Query: 102 AKLMSLNLDIDQATDYYERGVXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXTPEE 156
           A+LMSL L I++AT++YE  V                                   +   
Sbjct: 148 ARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSGLSNIV 207

Query: 157 KFDSGSFFSLASGILEKGRQFVDQFSGFPQE-QDRL-----TRVRVEQ-DLP-------- 201
             DS + FS+A+    KG++ VDQ++ FP E  DRL     T  +VE  DLP        
Sbjct: 208 GTDSNNLFSMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSPNR 267

Query: 202 --VERPKSVEP-PTVEVEEGNLLGEFQEKINL--------------------EEPKRSPT 238
              E  + VE  P  +  + +LL +F+ KI++                    EE  R   
Sbjct: 268 ILFEDNEVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNE 327

Query: 239 PPPQATLLDFDNGTPP------------ERIKTITPVPISHLEISGYKEYKDRGTEFFKA 286
           P  + +LLDF  G               E   T + +PIS +E+SGY E+K +GT  FK 
Sbjct: 328 PLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKN 387

Query: 287 GDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPN 346
           GDY+++ QEYEKSLN+LP NH LRI+A SN+ A+  K+GEY + + +   ALE+FP    
Sbjct: 388 GDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKA 447

Query: 347 LWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGK 406
            W   I +S P R+F ++WPKI+ RRAE+FEH+E++++AL+ YQ LI+KN F+DKIM GK
Sbjct: 448 KWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGK 507

Query: 407 RRCQKVLNPTEPKATSPNRSPT----PVPK----VSEDTKQPKTYANVERVKQENQRNEL 458
           RRCQ  +NP   K + P +  T    P  K     +  +  P +  +   +K    + EL
Sbjct: 508 RRCQDFINPPPVKKSMPVKKKTTTTSPATKKQNLTASSSNSPISVDSTSEIK----KREL 563

Query: 459 QEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKIT 518
           + A K ALYD VF++I SWK GK DDIRHLLANLS++LTWC+WK VS  DLVMPK+VKIT
Sbjct: 564 ENA-KLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKIT 622

Query: 519 YMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           YMKAVAKTHPDKIP SL LE +MIAE++FS+LS+AW+KFKL NDIN
Sbjct: 623 YMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  385 bits (989), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 246/340 (72%), Gaps = 7/340 (2%)

Query: 230 LEEPKRSPTPPPQATLLDFDNGTPPER--IKTITPVPISHLEISGYKEYKDRGTEFFKAG 287
           + +P  +  P    TLLDFD+ T        ++  VPIS +E+ GYKE+K+RGTE FK G
Sbjct: 349 ISKPIVNVAPKANNTLLDFDSPTTAVHSPAASLPKVPISEIELLGYKEFKERGTENFKTG 408

Query: 288 DYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNL 347
           DYV+A + Y+KSLN+LP  H LRI+A SN+ A++ K GEY++ +    SALE FP D   
Sbjct: 409 DYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQKQ 468

Query: 348 WDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKR 407
           W+E IQDS+P RT+K++WPKIV +RAEAFEHIE+YE AL+ YQ +IEKN FNDK+M GKR
Sbjct: 469 WNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMSGKR 528

Query: 408 RCQKVLNPTEPKATSPNRSPTPV---PKVSEDTKQPKTYANVERVKQENQRNELQEAEKA 464
           RCQ V+NP +P  T  N S  P     K  +++ Q K Y NVE++KQ+N+     E+++ 
Sbjct: 529 RCQHVINPVKP--TKSNSSALPRQTNTKPKKESNQNKAYENVEKLKQKNKLEAEIESQRL 586

Query: 465 ALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVA 524
           ALYD+V  QI  WKA K DDIRHLL+NL  +LTW +W PV  SDLVMPKKVKITYMKAVA
Sbjct: 587 ALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMKAVA 646

Query: 525 KTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           +THPDKIPS LELEK+MIAE++FS LS AWEKFK  N++N
Sbjct: 647 RTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 73/175 (41%), Gaps = 24/175 (13%)

Query: 41  VHDDLDELFGLKKRDETVVKNQVVG--------------DSFDAAFEAF-DRPQKVEK-- 83
           +HDD+ +LFGL    + +  ++ +               D  DAA   F D PQ+  +  
Sbjct: 61  IHDDIADLFGLSSESKPINASKPINASKPINTSKPSEGIDDLDAAMNFFNDSPQESLRGS 120

Query: 84  SLEESPXXX---XXXXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXX 140
           ++  SP               AKLMSL LDID+AT +Y+ G+                  
Sbjct: 121 TVTTSPEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYETLVSKIRTSNSRITA 180

Query: 141 XXXXXXXXXXXXTPEEK--FDSGSFFSLASGILEKGRQFVDQFSGFPQEQDRLTR 193
                        P  K    +GSF    +G+ +KG+Q VDQ++ + +E DRL R
Sbjct: 181 QRNDSGRNDIRAEPMRKPRTSNGSF--TFTGLFDKGKQLVDQWTVYHEEDDRLFR 233

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  371 bits (952), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/481 (42%), Positives = 278/481 (57%), Gaps = 27/481 (5%)

Query: 102 AKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKFDSG 161
           AK+MSL   ID+A ++Y+ GV                              T   K    
Sbjct: 114 AKIMSLGFGIDKAVEFYDSGVLYDELVERRDRRHIRHTHTRHSVREV----TEVPKHTGN 169

Query: 162 SFFSLASGILEKGRQFVDQFSGFPQEQ-DRLTRVRVEQDLPVERPKSVEPPTVEVEEGNL 220
           SFFS A G+L KG+ FVD  + +P E+ DRL R R E     +     +    E E+  L
Sbjct: 170 SFFSAAVGLLNKGKDFVDHLTAYPDEEGDRLARYRQEH---ADAAHFGDFTPGEREQDLL 226

Query: 221 LGEFQEKINLEEPKRSPTP-PPQATLLDF---DNGTPPERIKT-------ITPVPISHLE 269
           + +F+ K+++ +    P    P  TLLDF   D+     R          +  VPIS +E
Sbjct: 227 IDDFESKVSITDKHNPPLAQTPDETLLDFGEDDSSKSGSRTHVNNSPSIELPIVPISTME 286

Query: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329
           +SGY E++ +GTE FK GDY +A  EYEKSLN+LP+ H LRI+A SN+     K+GEY +
Sbjct: 287 LSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTK 346

Query: 330 CLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDY 389
           CL     ALE+ P+D + W   IQ S+P RT++++W K+V R AEA EH ENY  A  +Y
Sbjct: 347 CLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNY 406

Query: 390 QSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQP------KTY 443
           Q L+     N+K+M GKRRCQKVLNP  P       +PTP P+V    + P        Y
Sbjct: 407 QLLVANGITNEKVMDGKRRCQKVLNP--PSKVERKGTPTPTPQVVTPARTPDPATSKTVY 464

Query: 444 ANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKP 503
            N ERVK+ N ++E +EA K   YD V  ++ +WK  K  DIR+LL++L+ ++TW +W  
Sbjct: 465 ENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLTEIVTWVEWNS 524

Query: 504 VSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDI 563
           VS +DLVMPK+VKITY+KA+AK HPDKIP+ L LE RMIA+ VFS L+ AWEKFKL N+I
Sbjct: 525 VSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNAWEKFKLDNNI 584

Query: 564 N 564
           N
Sbjct: 585 N 585

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  370 bits (949), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 235/589 (39%), Positives = 316/589 (53%), Gaps = 89/589 (15%)

Query: 40  NVHDDLDELFG---------LKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPX 90
           N+ DD +ELFG         L++ D+    N     S D      D  + +E        
Sbjct: 96  NIEDDFNELFGSNTMATANELQQVDQNYYGNS--DGSHDGDGVLVDEVKDME-------- 145

Query: 91  XXXXXXXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXX 150
                      A+LMSL L I++ATD+Y   V                            
Sbjct: 146 ----------IARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGS 195

Query: 151 XXTPEEKFDSGS-----FFSLASGILEKGRQFVDQFSGFPQE-QDRLTR-VRVEQ----- 198
                  F++ S      FS+A+    KG++ VDQ++ FP E  DRL+  V VE      
Sbjct: 196 SSKNASLFNNASPNNNNLFSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVEDKLDHY 255

Query: 199 DLPVER-------PKSVE----PPTVEVEEGNLLGEFQEKINL----------------- 230
           +LP+E        P+  E           + +LL +F+ KI++                 
Sbjct: 256 ELPLENDSYDGSLPQRKEDEKDLLGGNDLDDDLLTDFETKIDITKKDAKDTTPSPSPPPG 315

Query: 231 ---EEPKRSPTPPPQATLLDF--------DNGTPPERIKTITPV-PISHLEISGYKEYKD 278
              E+  R   P  +  LLDF        +N           PV PIS +E+SGY E+K 
Sbjct: 316 ILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKA 375

Query: 279 RGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESAL 338
           +GT  FK GDYV++ QEYEKSLNSLP  H LRI+A SN+ A+  K+GEY + + + ++AL
Sbjct: 376 KGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTAL 435

Query: 339 EMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNF 398
            +FP + + W++ I  S P R++ ++WPKI+ RRAE+FEH+E+++ AL+ YQ L+ +N F
Sbjct: 436 ALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFF 495

Query: 399 NDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVP---KVSEDTKQPKTYANVERVKQENQR 455
           +DKIM GKRRCQ  +NP   +  SP +  TP P   K    T  P    N  RVK++   
Sbjct: 496 DDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAPMKKPTSTPSPAPVDNASRVKEQ--- 552

Query: 456 NELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKV 515
            EL+ A K ALYD V  +I  WK GK DDIRHLLANLS +LTWC+WK VS  +LVMPKKV
Sbjct: 553 -ELENA-KLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKV 610

Query: 516 KITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           KITYMKAVAKTHPDKIP SL LE +MIAE+VF++LS AW+KFK  NDIN
Sbjct: 611 KITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  370 bits (949), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/520 (42%), Positives = 291/520 (55%), Gaps = 57/520 (10%)

Query: 102 AKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEE---KF 158
           A+LMSL L I++AT +Y   +                                 E    F
Sbjct: 148 ARLMSLGLSIEKATKFYNDDITYERYLKVLKSNQKKSKDRTARESPGDVNFERSELSNNF 207

Query: 159 DS--GSFFSLASGILEKGRQFVDQFSGFP-QEQDRLT-----RVRVEQ-DLPVERPK--- 206
            S   + FS+A+    KG++ VDQ++ FP +E DRL      R + E  D P+E      
Sbjct: 208 GSENNNLFSIATNFFNKGKELVDQWTSFPPEENDRLNNHPNLRNKSEDYDSPLENDPYNG 267

Query: 207 -SVEPPTVE---VEEGNL----LGEFQEKINLEEPKRS---PTPPPQA------------ 243
            S+E    E   + E NL    L +F+ KI + +   S   P+P P +            
Sbjct: 268 FSIEDDKSEKGLLSENNLDEDLLTDFETKIEITKRTVSDVDPSPSPSSGILIEENPLRKE 327

Query: 244 -----TLLDFDNGTPPERIKT------------ITPVPISHLEISGYKEYKDRGTEFFKA 286
                 LLDF  G   +   +             + +PIS +E+SGY E+K +G+ FFK 
Sbjct: 328 PLVENNLLDFSEGNVTKSNSSESNSLFNGNRNPNSAIPISDIELSGYNEFKAKGSNFFKN 387

Query: 287 GDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPN 346
           GDYV++ QEYEKSLNSLP NH LRI+A SN+ A+  KVGEY + + +   AL +FP    
Sbjct: 388 GDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSSMALALFPPTKA 447

Query: 347 LWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGK 406
            W   I DS P R+F ++WPKI+ RRAE+FEH+E++  AL+ YQ LI KN F++KIM GK
Sbjct: 448 NWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQELINKNFFDEKIMQGK 507

Query: 407 RRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKA-- 464
           RRCQ  +NP   K  SP +  T     +E +    + +          + + QE E A  
Sbjct: 508 RRCQNFINPPPVKKFSPVKKATSTQSPTEKSTPTSSSSTSSNSPDTTSKIKKQELENAKL 567

Query: 465 ALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVA 524
           ALYD VF++I SWK  KGDDIRHLLANLS +LTWC+WK +   DLVMPK+VKITYMKAVA
Sbjct: 568 ALYDKVFERISSWKNDKGDDIRHLLANLSGLLTWCNWKDIPMQDLVMPKRVKITYMKAVA 627

Query: 525 KTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           KTHPDKIP SL LE +MIAE+VFSSLS+AW+KFK  NDIN
Sbjct: 628 KTHPDKIPESLSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  361 bits (926), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 222/568 (39%), Positives = 307/568 (54%), Gaps = 62/568 (10%)

Query: 39  INVHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPXXXXXXXXX 98
           +N+ DD DE+FG      T    QV  DS D          +V K +E            
Sbjct: 95  VNIDDDFDEIFGSDAIAATGGLQQVDQDSHDDDDGDDALVDEV-KDME------------ 141

Query: 99  XXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKF 158
              A+LMSL L + +AT++Y   +                                   F
Sbjct: 142 --IARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKKPGLF 199

Query: 159 -----DSGSFFSLASGILEKGRQFVDQFSGFP-QEQDRLTRVRVEQDLPVERPKSVEPPT 212
                D+ +  S+A+    KG++ +DQ++ FP +E +RL      +D   +   S+E   
Sbjct: 200 NNTDSDNNNLLSIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSLEENP 259

Query: 213 VEVEEGNL----LGEFQEKINL-----EEPKRSPTPP---------------PQATLLDF 248
                 NL    L +F+ KI++     +    SP+P                   +LLDF
Sbjct: 260 CNSGGDNLDEDLLTDFEAKIDITKRASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLDF 319

Query: 249 ------------DNGTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEY 296
                       +N    E    ++ VPIS +E+SGY E+K +G   FK GDYV++ QEY
Sbjct: 320 SPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEY 379

Query: 297 EKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQ 356
           EK+LNSLP NH LRI+  SN+ A+  KVGEY + + + + AL +FP     W+  I +S 
Sbjct: 380 EKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSD 439

Query: 357 PIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPT 416
           P R+F ++WPKI+ RRAE+FEH+E+++ AL+ YQ LI +N F+DKIM GKRRCQ  ++P 
Sbjct: 440 PQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPP 499

Query: 417 EPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIES 476
             + ++P +  TP  K       P       +VK++    EL+ A K ALYD VF +I +
Sbjct: 500 LVRKSTPVKKTTPTLKKPAPDPSPAPIDIPSKVKEQ----ELENA-KLALYDKVFGKIGT 554

Query: 477 WKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLE 536
           WK GK DDIRHLL+NLS +LTWC+WK VS  DLVMPKKVKI YMKAVAKTHPDKIP SL 
Sbjct: 555 WKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLS 614

Query: 537 LEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           LE +MIAE++FS+LS+AW+KFK  NDIN
Sbjct: 615 LENKMIAENIFSTLSIAWDKFKQQNDIN 642

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  362 bits (929), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 251/373 (67%), Gaps = 26/373 (6%)

Query: 217 EGNLLGEFQEKINLEE------PKRSPTPPPQ------ATLLDFDNG--TPPERI----- 257
           EG+LL  F+E I + E      P+ +    P        TLLDF N   + P  +     
Sbjct: 320 EGDLLDSFEENIVIGESFTNIPPRITERQKPNDERIQDNTLLDFGNEDLSSPANVSISSS 379

Query: 258 --KTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYS 315
             + I  + I+ +E+SGY E+KDRGTE+FK GDYVSA+++YEKSLNSL + H LRI+A S
Sbjct: 380 GQECIPVISINQIELSGYNEFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASS 439

Query: 316 NLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEA 375
           NL A+L K G+Y   ++   SAL++FPK+  LWD  IQ+S+P +T+KE+W K+V RRAEA
Sbjct: 440 NLLASLLKTGDYTSMITISTSALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEA 499

Query: 376 FEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNP-TEPKATSPNRSPTPVPKVS 434
           FE IENY++A   YQ LIE N FN+KIM GK RCQKVLNP T  K      + T   K S
Sbjct: 500 FEFIENYQQAYDSYQLLIENNIFNEKIMAGKLRCQKVLNPETHNKPLKKLVATTAETKTS 559

Query: 435 ED----TKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLA 490
           +       Q  +  N+++++++N+R E  E EK ALYD V Q++ +W AGK DDIRHLL+
Sbjct: 560 QTKNIVNTQSTSSGNLKKIQEQNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLS 619

Query: 491 NLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSL 550
            L  ++TW  W  V++SDLVMPKKVKITY+KAVAKTHPDK+PS+L+ E RM+AE++FS L
Sbjct: 620 RLQRIITWTQWNEVASSDLVMPKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSIL 679

Query: 551 SVAWEKFKLANDI 563
           S  WEKFK+ N+I
Sbjct: 680 SKNWEKFKVDNNI 692

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 59/177 (33%), Gaps = 27/177 (15%)

Query: 37  NQINVHDDLDELFGLKKRDETVVKNQVVG------DSFDAAFEAFD------------RP 78
           N  N+ DD D+LFG  K   +V  N   G      D  D   + FD             P
Sbjct: 77  NNKNLLDDFDDLFGPSK--PSVTTNTFKGTDQGERDDLDDIMDMFDFTPSPSHCNQEVMP 134

Query: 79  QKVEKSLEESPXXXXXX--XXXXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXX 136
            K     + S               AKLMSL L ID+A   +E G+              
Sbjct: 135 SKTNAEAQSSSKNEVIVDEVKDMEIAKLMSLGLSIDEAIKSFEHGILYDTVASRQQAAQR 194

Query: 137 XXXXXXXXXXXXXXXXTPEEKFDSGSFFSLASGILEKGRQFVDQFSGFPQEQDRLTR 193
                           T     ++ S   L S I+ K +Q +D ++    E DRL R
Sbjct: 195 FSSSSNRRGTPIANSGT-----NNSSGGGLFSSIIGKSKQLIDDWTVNHDEDDRLFR 246

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  348 bits (892), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 240/385 (62%), Gaps = 28/385 (7%)

Query: 208 VEPPTVEVEEGNLLGEFQEKI-NLEEPKRSPTPPPQATLLDFD------------NGTPP 254
           +  P   V EG+LLG+F   + N  E   S      + L DFD            N    
Sbjct: 455 ISLPHTNVIEGDLLGDFGSNLKNHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATS 514

Query: 255 ERIKT-------------ITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLN 301
           + I T             I  VPIS +E+SGY E++  GTEFFK GDY SA  EY+KSLN
Sbjct: 515 KNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLN 574

Query: 302 SLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTF 361
           +LPQ H LR+++YSN+ AA  KVGEY + + D + ALE+FPK+   W + IQDS P +T+
Sbjct: 575 TLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTY 634

Query: 362 KEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPK-A 420
           KE+WPKIV R+AEA EH+E Y+ A   YQ L+ KN FNDKIM GKRRCQKVLNP  PK  
Sbjct: 635 KEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLK 694

Query: 421 TSPNRSPTPVPKVS-EDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKA 479
           +S N S     K S   T       NVER+K+  ++   +E E+  L D+V  +I+ W  
Sbjct: 695 SSANTSRISSAKQSTASTSSINVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTN 754

Query: 480 GKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEK 539
            K DDIR+LL+N+  VLTW +WK ++ SDLVMPKKVK+ YMKAVAKTHPDKI   L +E 
Sbjct: 755 NKEDDIRYLLSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIEN 814

Query: 540 RMIAEDVFSSLSVAWEKFKLANDIN 564
           +MIAE +FS LSVAWEKFK AN +N
Sbjct: 815 KMIAESIFSILSVAWEKFKTANKMN 839

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 211/554 (38%), Positives = 299/554 (53%), Gaps = 70/554 (12%)

Query: 62  QVVGDSFDAAFEAFDRPQKVEKSLEESPXXXXXXXXXXXXAKLMSLNLDIDQATDYYERG 121
           Q + D  DAAF+ F+       + + SP            A+LMSL + +++A  YYERG
Sbjct: 48  QTINDDLDAAFDVFNSATNT-PAKQGSPVVDEVKDMEI--ARLMSLGVSLERALQYYERG 104

Query: 122 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKFDSGS---------------FFSL 166
           +                                   FD+GS                FS+
Sbjct: 105 ILYDDVLRRRHEKHEAKRQAAAASRDFTKL------FDNGSSNILGSDGSDDKQQDLFSM 158

Query: 167 ASGILEKGRQFVDQ---------------FSGFPQE-QDRL---TRVRVEQ----DLPVE 203
           A+G+  KG+ F+++               F  F      RL   TR + E+    D  V 
Sbjct: 159 ATGLFNKGKSFMEERLKQRQQHQHQQDPAFRSFADHISSRLESPTRAKYERSQYTDKQVG 218

Query: 204 RPKSVEP-PTVEVEE-----GNLLGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERI 257
             +  EP P  EVEE     G+LLG F E         S + P   TLLDF+    P ++
Sbjct: 219 SERRPEPAPVDEVEEPSVIEGDLLGGFDE--------LSVSSPQHETLLDFEQAVSPPQL 270

Query: 258 KTIT---PVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAY 314
           ++ +   P+ IS +E+SG+ E+K +G E F  G+Y SA  EYEKSLN+LP  H LRI++ 
Sbjct: 271 RSSSARPPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISL 330

Query: 315 SNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAE 374
           SN+     K+GE    L +IE+AL +  +D      P   S P ++++E W KI  R+AE
Sbjct: 331 SNIITTQLKLGESSSALQNIETALRLIGEDELQLTIPA--SNPPKSYREFWGKITMRKAE 388

Query: 375 AFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSP---NRSPTPVP 431
           A EH+ENY  AL+ Y++LI+K     K+M GKRRCQKVL+P +P++  P    + P+P  
Sbjct: 389 ALEHVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPSPNV 448

Query: 432 KVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLAN 491
             +  +  PK   N+E++++ N+  E  E +K  L D V +QI+SW  GK +D+R LLA+
Sbjct: 449 LDTSSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLAD 508

Query: 492 LSTVLTWC-DWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSL 550
           L  VLTW  DWKPV+TSDLVMPKKVKITY+KA+AKTHPDK+  SL++E +M+AED+FS L
Sbjct: 509 LPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSIL 568

Query: 551 SVAWEKFKLANDIN 564
           S AWE FK  N+I+
Sbjct: 569 SKAWEAFKEENNIS 582

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  297 bits (761), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 198/569 (34%), Positives = 293/569 (51%), Gaps = 67/569 (11%)

Query: 44  DLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKV-EKSLEESPXXXXXXXXXXXXA 102
           DLDE+FG +K+  +      V D FD AF+AFD P K+ +  ++  P            A
Sbjct: 48  DLDEIFGFEKQANSA---PAVKDEFDLAFDAFDAPAKLPQNHMDPEPQPLVDEIKDMEIA 104

Query: 103 KLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKFDSGS 162
           +LMSL L   +AT YYERG+                              + E +F  GS
Sbjct: 105 RLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAPQKT--------SDEGRFTQGS 156

Query: 163 ---FFSLASGILEKGRQFVDQFSGFPQEQD-------------RL-------TRVRVEQD 199
                S+AS  L +GR F+D  S   Q Q+             R+       +R+R   D
Sbjct: 157 EPDLLSVASSWLNRGRTFLD--SKLKQIQNDNGTQSYSDYISSRMESSAHTGSRLRPTSD 214

Query: 200 LPVERPKSVE---------------PPTVEVEEGNLLGEFQEKINLEEPKRSPTPPPQAT 244
           +P    +S+                P  V      +L      I  + P   P       
Sbjct: 215 IPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLV-NIGDDVPVSGPEEASADL 273

Query: 245 LLDFDNGTPPERIKT--ITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNS 302
           L+DFD  +  + + +     + +S LE   Y+E+K++GT  F AGDY +A Q +EKS+NS
Sbjct: 274 LVDFDAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNS 333

Query: 303 LPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFK 362
           LP +H LR ++ SN+     K+GEY++ + D   AL++        D+ I  S P +TFK
Sbjct: 334 LPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAK--LDDVIPASDPPKTFK 391

Query: 363 EMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTE----- 417
           E+W KIV  +AEA+EHIE+Y++AL++YQ LI++   + K+M G+RRCQK++ P +     
Sbjct: 392 EIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRS 451

Query: 418 --PKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIE 475
             P +TSP+ S   V  V+  ++ P     +ERV+  N++ +  E +K  L+D V  ++ 
Sbjct: 452 KTPLSTSPSVSRKDVA-VAATSQVPSE--KLERVQNINKKEKELERQKFLLHDKVQDRVR 508

Query: 476 SWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSL 535
            W     DD+R LL+    ++ W DWK VST+DLVMPK+VKI Y+KAV KTHPDKI  S 
Sbjct: 509 EWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSW 568

Query: 536 ELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
            LE++M+AE+VF  LS AWE FK  N ++
Sbjct: 569 PLERKMVAENVFVILSKAWELFKEQNKLS 597

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  262 bits (669), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 209/329 (63%), Gaps = 12/329 (3%)

Query: 245 LLDFDN--GTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNS 302
           L+DFD     PP    +   VPIS +E+SGY+E+   G ++F+ GDY +A Q+Y KSLN+
Sbjct: 336 LIDFDTEEAPPPASKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNT 395

Query: 303 LPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFK 362
           LP  H LRIVAYSN+     K+GE+   L +IE A ++   D +  D  IQ + P +T+K
Sbjct: 396 LPVGHPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYK 453

Query: 363 EMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPT-EPKAT 421
           E W KI++++AE  E++E+Y+ AL  Y+ LI K  F+ KI+ GK RCQK    T EP   
Sbjct: 454 EFWNKIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATE 513

Query: 422 SPNRSPT---PVPKVSEDT---KQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIE 475
               +P     VPK +  +   ++ ++    E +K+  +  EL E +K  L+D V  +I+
Sbjct: 514 DSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKEL-EKQKFRLHDKVHSKIQ 572

Query: 476 SWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSL 535
           SW  GK  D+RHLL+ LS VLTW +W  +  +DLV+PKKVKI YMKA++K HPDK+PS+L
Sbjct: 573 SWIDGKETDLRHLLSRLSLVLTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTL 632

Query: 536 ELEKRMIAEDVFSSLSVAWEKFKLANDIN 564
           +LE +M+AED+FS L  AW  FKL NDIN
Sbjct: 633 DLESKMLAEDIFSVLGNAWNVFKLNNDIN 661

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 188/532 (35%), Positives = 273/532 (51%), Gaps = 46/532 (8%)

Query: 66  DSFDAAFEAFDRPQKVEKSLEE-----SPXXXXXXXXXXXXAKLMSLNLDIDQATDYYER 120
           D FD AFE+F+    V+    +      P            A+LMSL L  D+A  YY++
Sbjct: 102 DDFDLAFESFNSTPHVDLVQPQPDPIPEPQPLVDEVKDMEIARLMSLGLSFDKAVHYYDK 161

Query: 121 GVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEKFDSGSFFSLASGILEKGRQFVD- 179
           G+                                E +  S +F S+AS +   G++F++ 
Sbjct: 162 GIMYEELIESQKKRKQSRSNVNNDFGQQQLRKQ-ESRDSSPAFISVASNLFNMGKEFIED 220

Query: 180 --QFSGFPQEQDRLTRVRVEQDLPVER----PKSVEPPTVEVEEGN--------LLGEFQ 225
             + +  PQ  +   R +   D+P+ R    P S  P +++ +           L    Q
Sbjct: 221 KLKPTLQPQYANSSQRSQFSDDIPLRRDYTRPHS-RPHSMQFQSERTSPQPSPELPSIHQ 279

Query: 226 EKINLEEPKRSPTPPP-------------QATLLDFDNGTPPERIKTITPVP-ISHLEIS 271
             IN      S  PPP             Q TL+DF  G  P+   + +P   IS  E++
Sbjct: 280 LSIN----NASSAPPPVSVENQDTASVINQETLVDF--GAAPQ--TSASPQHRISDFELT 331

Query: 272 GYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCL 331
            + E+K+ G ++F +GDY +A  E+EKS N+LP  H LRI++ SN+ +   K+GE  + L
Sbjct: 332 SFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKAL 391

Query: 332 SDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQS 391
             ++ AL++    PN  D  I+ S P RTFK+M  KI  + AE  EH+ENYE+AL  Y +
Sbjct: 392 ESVKLALDLSDLAPNASDI-IEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYAN 450

Query: 392 LIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQ 451
           LI       K+M GKRRC+K++NP + K      S   +P  S+ +    T A V RVK+
Sbjct: 451 LISNGITEQKVMDGKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADTVA-VNRVKE 509

Query: 452 ENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVM 511
           EN++ E +E E+  L D V ++I  W     +D+R+LLANL  +L W  WK VS  DLVM
Sbjct: 510 ENKKQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVM 569

Query: 512 PKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDI 563
            KKVKI Y+KA+AKTHPDKIP+   LE  MIAE+V++ L+ AWE FK  N+I
Sbjct: 570 TKKVKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  252 bits (644), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 195/310 (62%), Gaps = 13/310 (4%)

Query: 265 ISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKV 324
           ++ LE   ++E+K++G   F+ GDY +A Q YEKSLNSLP  H LR+V++SN+     KV
Sbjct: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376

Query: 325 GEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYER 384
           GEY+  LSD  SAL++ P+     +  I +  P +T+KE W KI+  +A AFE +ENYE+
Sbjct: 377 GEYREALSDASSALKLIPQGS--MNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434

Query: 385 ALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPK--- 441
           AL+ YQ LIE    + K++  +R+CQK +   +   +   +S T +PK +  TK+P    
Sbjct: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAV-TKKPSGRP 493

Query: 442 ---TYAN----VERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLST 494
              T  N    + RV+  N++ +  EA++  L+D V   I+ W  G  D++R LLA   T
Sbjct: 494 AKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHT 553

Query: 495 VLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAW 554
           ++ W +WK VST+DLV+PKK K+ Y+KAVAKTHPDKI  S  L+++MIAE+VF  LS AW
Sbjct: 554 IVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAW 613

Query: 555 EKFKLANDIN 564
           E FK  N ++
Sbjct: 614 ETFKEKNQLS 623

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 55/142 (38%), Gaps = 14/142 (9%)

Query: 44  DLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKS------LEESPXXXXXXXX 97
           DLD  FG K  + T   +    D FD AF+  + P     +      +E  P        
Sbjct: 48  DLDAFFGSKTSNAT---SGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVK 104

Query: 98  XXXXAKLMSLNLDIDQATDYYERGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEEK 157
               A+LMSL LD D+A +YYERG+                                EE+
Sbjct: 105 DMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLR--EEE 162

Query: 158 FDSGSFFSLASGILEKGRQFVD 179
            D    FS+AS  L KGR F+D
Sbjct: 163 SD---LFSVASNWLNKGRTFLD 181

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  250 bits (639), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 161/438 (36%), Positives = 231/438 (52%), Gaps = 43/438 (9%)

Query: 160 SGSFFSLASGILEKGRQFV-DQF-----------SGFPQEQDRLTRVRVEQDLPVERPK- 206
           S    S AS +  +GR F+ DQ            S      +R +    E D  V +   
Sbjct: 221 SNRLVSAASNLFNRGRDFIEDQLATHARTSASSRSTLSDSNERFSNHTQESDYSVNQTND 280

Query: 207 -----SVEPPTVEVEEGNLLGEF------QEKINLEEPK-RSPTPPPQATLLDFDNGTPP 254
                  +P   EV+   LL  F      Q +  LE P+ ++     + +L+DF +  P 
Sbjct: 281 QAHLIHTQPTAAEVD---LLEGFADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPS 337

Query: 255 ERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAY 314
           +    +  V I+ LE+SGY ++     E +K GDY +A Q+Y KSLN+LP  H LRI+A 
Sbjct: 338 KSAAQLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIAL 397

Query: 315 SNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAE 374
           SN+     K+GE+   + +I SA+E+    P  +D  IQD+ P RT+KE W KI+ ++AE
Sbjct: 398 SNIITTQLKIGEHTESMKNINSAVELLQDVP--FDAQIQDTSPPRTYKEFWQKILAKKAE 455

Query: 375 AFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVS 434
             E  +NYE AL  YQ LI +      I+ GK RCQK  N     +   N S  P     
Sbjct: 456 VLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACN-----SQKGNVSSNPTATTQ 510

Query: 435 EDTKQPKTYA--------NVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIR 486
            D K P+            V+R+K +N   E QE E+  L+D V  +I +W AGK  D+R
Sbjct: 511 GDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLR 570

Query: 487 HLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDV 546
           HLL  L  +L W +   +  SDLVMPK+VK++Y+KAV+KTHPDK+P +LELE++M+AE V
Sbjct: 571 HLLLGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHV 630

Query: 547 FSSLSVAWEKFKLANDIN 564
           F +L+ AW  FK  N ++
Sbjct: 631 FITLTKAWGVFKEENSLS 648

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 15/20 (75%)

Query: 102 AKLMSLNLDIDQATDYYERG 121
           AKLMSL LDI  A DYY RG
Sbjct: 129 AKLMSLGLDIGAANDYYHRG 148

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 56/127 (44%), Gaps = 34/127 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KDRG EFFK  DY +A + Y         N+AL +    V YSN++A    +G+  + + 
Sbjct: 105 KDRGNEFFKKKDYDNALKYY---------NYALVVKKDPVFYSNISACYVSLGQLDKVVE 155

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           +   ALE+ P                      + K + RRA A E +ENY  A+ D   L
Sbjct: 156 NSTKALELKPD---------------------YSKALLRRASANESLENYADAMFDLSVL 194

Query: 393 IEKNNFN 399
               +FN
Sbjct: 195 SLNGDFN 201

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 40/190 (21%)

Query: 254 PERIKTITPVPIS-HLEISGYKEYKDRGTEFFKAGDYVSASQEYEKS--LNSLPQNHALR 310
           P+ I+ IT +P+    +IS   + KD+G ++FKA DY +A + Y  +  LN  P      
Sbjct: 105 PDMIQ-ITSLPLEEQKKIS--MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP------ 155

Query: 311 IVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
            + YSN++A    +G+  + +     ALE+ P                      + K + 
Sbjct: 156 -IFYSNISACYVSLGQLDKVIESSTKALELNPN---------------------YSKALL 193

Query: 371 RRAEAFEHIENYERALQDYQSLIEKNNFNDKIM------GGKRRCQKVLNPTEPKATSPN 424
           RRA A E +ENY  AL D   L    +++   +         ++  KVLN    K T  N
Sbjct: 194 RRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSN 253

Query: 425 RSPTPVPKVS 434
           +    +P  +
Sbjct: 254 KEQQLLPSTT 263

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 221 LGEFQEKIN---LEEPKRSPTPPPQATLLDFDNG--TPPERIKTITPVPISHLEISGYKE 275
           L EFQ K     LEE  R P    +    D D G     E +K +      H EI+G   
Sbjct: 24  LSEFQNKTTDEVLEELNRMPFFMTKLDDTDGDGGENQELEALKALAYEGEPH-EIAG--N 80

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++G + +KA  +  A + Y K +     + ++    Y+N  A   ++  Y+RCL+D +
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 336 SALEMFPKD 344
           +AL+  PK+
Sbjct: 141 TALQYNPKN 149

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 29/160 (18%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E KD+G E+FK  DY +A + Y+ +L  L ++     V YSN++A    + E  + +   
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL-ILKKDP----VFYSNMSACYVSLNELDKVIEMS 164

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
             ALE+ P                      + K + RRA A E +ENY  A+ D   L  
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203

Query: 395 KNNFNDKI---MGGKRRCQKVLNPTEPKATSPNRSPTPVP 431
            N+FN      M  +   ++ +   + K+ +P+++ + +P
Sbjct: 204 NNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELP 243

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 59/154 (38%), Gaps = 32/154 (20%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           Y  RG   F   DYV+A  ++ K+   L +N+   I  Y  L    ++ G+++ C +  E
Sbjct: 391 YYHRGQLNFVTQDYVNAKNDFLKA-KELDENN---IFPYIQLACLSYREGDFEDCQNQFE 446

Query: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEK 395
            A + FP                     + P+I T   E      + + A + Y+  I  
Sbjct: 447 LARKKFP---------------------VAPEIPTFLGEILADKGDLDLAAKQYEFGIRL 485

Query: 396 NNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTP 429
            N    I  G       + P   KAT+  R PTP
Sbjct: 486 ENTQKSIHVG-------IAPLIGKATALARQPTP 512

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           ++ +KD G E FK G+Y  A ++Y K ++  P N     V YSNL  A  K     RC  
Sbjct: 35  FQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTN----AVGYSNLAMAYLK----NRCPD 86

Query: 333 DIESALEM---FPKDPNL 347
           + ++A EM   + KD  L
Sbjct: 87  EAKTACEMGLSYCKDTKL 104

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 221 LGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISH----LEISGYKEY 276
           L EF++K + E  +     P   T LD  +G   E ++      +++     EI+G   +
Sbjct: 29  LSEFKDKTSDEILREMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAG--GF 86

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G E +KA  +  A + Y K LN   ++  +    ++N  A   ++  Y+RC+ D   
Sbjct: 87  KKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSK 146

Query: 337 ALEMFPKDPNLW 348
           AL + PK+   +
Sbjct: 147 ALSINPKNTKCY 158

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G +FF+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 103 KDKGNQFFRNKKYDDAIKYY---------NWALELKDDPVFYSNLSACYVSVGDLKKVVE 153

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 154 MSTKALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 393 IEKNNFND 400
               +FND
Sbjct: 193 SLNGDFND 200

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 34/123 (27%)

Query: 274 KEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKR 329
           KE K++G ++FK+ D  +A + YE         +ALR+    V YSN++A  F + +  +
Sbjct: 159 KELKNKGNQYFKSKDNENAIKYYE---------YALRLDQDPVFYSNISACYFAMNQLDK 209

Query: 330 CLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDY 389
            +     ALE+ P                      + K + RRA A+E + N + AL D+
Sbjct: 210 VIESSNKALELKPD---------------------YSKALLRRANAYEALGNNKEALYDF 248

Query: 390 QSL 392
             L
Sbjct: 249 SIL 251

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 221 LGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISH----LEISGYKEY 276
           L EF++K + E  K     P   T LD  +G   E ++      +++     EI+  + +
Sbjct: 29  LSEFKDKTSDEILKEMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIA--ENF 86

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G E +KA  +  A + Y K L    ++ ++    Y+N  A   ++  Y+RC+ D   
Sbjct: 87  KKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSK 146

Query: 337 ALEMFPKDPNLW 348
           AL + PK+   +
Sbjct: 147 ALTINPKNVKCY 158

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 263 VPISHLEISGYKE-YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAAL 321
           +P+   EI    E +K  G +   A DY  A ++Y +++ +LP N    ++ Y+N  AA 
Sbjct: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143

Query: 322 FKVGEYKRCLSDIESALEMFP 342
             V EY   + D E A+E+ P
Sbjct: 144 SSVKEYDNAIKDAEKAIEIDP 164

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G +FFK        Q+YE +L     N+AL +    V YSN++A    +G  ++ + 
Sbjct: 103 KDKGNQFFK-------EQKYEDALKYY--NYALDLKQDPVFYSNISACYVSLGNLEKVVE 153

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K + RRA A E++EN+  A+ D   L
Sbjct: 154 SSTKALELKPD---------------------YSKALLRRASANENLENFAEAMFDLSVL 192

Query: 393 IEKNNFND 400
               +FN+
Sbjct: 193 SLNGDFNE 200

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329
           +S +++ K++G   FK G Y  A   Y++ + + PQN     V YSN   AL K+GEY +
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNP----VGYSNKAMALIKLGEYTQ 56

Query: 330 CLSDIESAL 338
            +   +  L
Sbjct: 57  AIQMCQQGL 65

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 221 LGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISH----LEISGYKEY 276
           L EFQ+K   E        P   T LD  +G   E ++      +++     EI+  + +
Sbjct: 27  LAEFQDKSTDEVLTELNRMPFFMTKLDNSDGDGGENVELEALKALAYEGEPHEIA--ENF 84

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G + +K   +  A + Y K ++   Q + +    Y+N  A   ++  Y+RC++D + 
Sbjct: 85  KKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQ 144

Query: 337 ALEMFPKDPNLW 348
           AL++ PK+   +
Sbjct: 145 ALQLNPKNIKCY 156

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G ++F+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 103 KDKGNQYFRNKKYDDAIKYY---------NWALELKEDPVFYSNLSACYVSVGDLKKVVE 153

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 154 MSTKALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 393 IEKNNFND 400
               +FND
Sbjct: 193 SLNGDFND 200

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 34/127 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G ++FK  D+ +A + Y         N+AL +    V YSN++A    +G+ ++ + 
Sbjct: 109 KDKGNDYFKKQDFENALKYY---------NYALTLKQDPVFYSNISACYVSLGQLEKVVE 159

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               AL++                     K  + K + RRA A+E + NY  A+ D   L
Sbjct: 160 SSTEALKL---------------------KHDYSKALLRRASAYESLANYVDAMVDLSVL 198

Query: 393 IEKNNFN 399
               +FN
Sbjct: 199 SLNGDFN 205

>Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032W
           (REAL)
          Length = 393

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 63/144 (43%), Gaps = 32/144 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLP--------------QNHALRIVAYSNLTAALF 322
           KD GT  FK  DY +A  +Y KSLN +               Q  +L++  Y NL+  LF
Sbjct: 244 KDSGTLLFKKNDYSNAFFKYRKSLNYINEYTPEPDVDKERNYQFTSLKMKVYLNLSLVLF 303

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            V +Y   ++     LEM             D+ P +       K   RR  ++   +  
Sbjct: 304 NVEKYDDSITYATYLLEM-------------DNVPDKD----QAKAYYRRGNSYLKKKRL 346

Query: 383 ERALQDYQSLIEKNNFNDKIMGGK 406
           + ALQ+Y+ L +  N +DK++G K
Sbjct: 347 DEALQNYK-LCKDKNPDDKVIGQK 369

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G ++F+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 103 KDKGNQYFRNKKYDDAIKYY---------NWALELKEDPVFYSNLSACYVSVGDLKKVVE 153

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 154 MSTKALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 393 IEKNNFND 400
               +FND
Sbjct: 193 SLNGDFND 200

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 50/121 (41%), Gaps = 26/121 (21%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK  G   F A DY  A   + K++  S   NH L    YSN +AA     +Y++ LSD
Sbjct: 7   EYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVL----YSNRSAAYTSSKQYEQALSD 62

Query: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
            +  +++ P                      W K  TR+  A + +  YE A Q Y   +
Sbjct: 63  ADECIKINPS---------------------WAKGYTRKGAALQGLHKYEEAEQCYNETL 101

Query: 394 E 394
           +
Sbjct: 102 K 102

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 66/144 (45%), Gaps = 20/144 (13%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K  G + +KA  +  A   Y ++  +        I   +N +AA ++ G+Y+ C+  +  
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKD-----ITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           A+E              +++ +RT  ++  K   R   A+  +++ ++A++ YQ  + ++
Sbjct: 310 AVE--------------NARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSLTEH 355

Query: 397 NFNDKIMGGKRRCQKVLNPTEPKA 420
              D I+   R+ +K L   E +A
Sbjct: 356 RTPD-ILSKLRKAEKDLKQQEAEA 378

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   P +       YSN  AAL K+  +   +SD   A+E
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDD----ARGYSNRAAALAKLMSFPDAISDCNKAIE 447

Query: 340 MFPKDPNL 347
              KDP+ 
Sbjct: 448 ---KDPSF 452

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           +++YK+ G   FK G Y  A++ Y+K ++  P+N     + YSN   AL K+G Y   + 
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENP----IGYSNKAMALIKLGRYTEVVE 58

Query: 333 DIESALEMFP 342
                L   P
Sbjct: 59  LCRKGLTFTP 68

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           +  +K  G ++FK G+Y SA + YEK +   P+N     + YSN   AL K  + +  + 
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINPENP----IGYSNKAMALIKANKNQEAVR 58

Query: 333 DIESALEMFPKD 344
             +  L+   K+
Sbjct: 59  TCQDGLKRVSKN 70

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 26/123 (21%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           KD+G EFFK  DY +A + Y+ +L +L ++     V YSN++A    + +  + + +   
Sbjct: 110 KDKGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENSTK 164

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           ALE+ P                      + K + RRA A E +ENY  A+ D   L    
Sbjct: 165 ALELKPD---------------------YSKALLRRASANESLENYPDAMFDLSVLSLNG 203

Query: 397 NFN 399
           +F 
Sbjct: 204 DFG 206

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329
           ++ +++ K +G   FK G Y+ A   Y++ + + PQN     V YSN   AL K+GE+ +
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNP----VGYSNKAMALIKLGEHAQ 60

Query: 330 CLSDIESALE 339
            +   +  L+
Sbjct: 61  AIQACQQGLQ 70

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G +FF+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 103 KDKGNQFFRNKKYDDAIKYY---------NWALELKEDPVFYSNLSACYVSVGDLKKVVE 153

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K++ RRA A E +  +  A+ D   L
Sbjct: 154 MSTKALELKPD---------------------YSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 393 IEKNNFND 400
               +FND
Sbjct: 193 SLNGDFND 200

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 26/116 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           KD+G EFFKA D+  A + Y  ++ SL ++     V YSN +AA   +  +++ + D  +
Sbjct: 108 KDKGNEFFKAKDFEKAIEYYTLAI-SLKEDP----VFYSNRSAAYVSINNFEKVVEDTTA 162

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           AL++ P     W                      RRA A+E++  +  A+ D  ++
Sbjct: 163 ALKLKPDYSKCW---------------------LRRASAYENLGQFSDAMFDLSAV 197

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 8/123 (6%)

Query: 221 LGEFQEKIN---LEEPKRSPTPPPQATLLDFDNGTPP--ERIKTITPVPISHLEISGYKE 275
           L EF++K      EE  R P    Q    D + G     E +K +      H EI+G   
Sbjct: 20  LSEFKDKSADEIFEELNRMPFFMTQLDETDGEGGVNDNLEALKALAYEGEPH-EIAG--N 76

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K+RG EF+K   Y  A + Y K ++    +  +    Y+N  A   ++  +++C+ D +
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 336 SAL 338
            AL
Sbjct: 137 KAL 139

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           ++EYK  G  +FK G+Y+ A + Y+K +   P+N     + YSN   +L K+ +Y   L 
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENP----IGYSNSAMSLIKLTKYTEALE 58

Query: 333 DIESAL 338
              + L
Sbjct: 59  SCGTGL 64

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 269 EISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYK 328
           EI+G   +K++G + +K   +  A + Y K+++    +  +    Y+N  A   ++  Y+
Sbjct: 72  EIAG--NFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYR 129

Query: 329 RCLSDIESALEMFPKD 344
           RC++D + AL + PK+
Sbjct: 130 RCINDCKMALSLNPKN 145

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 221 LGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISH----LEISGYKEY 276
           L EF++K + E  K     P   T LD  +G   E ++      +++     EI+  + +
Sbjct: 29  LSEFKDKTSDEILKEMNRMPFFMTKLDETDGVGGENVELEALKALAYEGEPHEIA--ENF 86

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G E +KA  +  A + Y K +    ++ ++    ++N  A   ++  Y+RC+ D   
Sbjct: 87  KKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSK 146

Query: 337 ALEMFPKDPNLW 348
           AL + PK+   +
Sbjct: 147 ALTINPKNIKCY 158

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 34/127 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G EFFK   +  A + Y         N AL +    V YSN +A    +G+ ++ + 
Sbjct: 106 KDKGNEFFKEKKFDDAIKYY---------NLALELKKDPVFYSNRSACYVSMGQLEKVVE 156

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           D  +AL++                     K  + K + RRA A E + NY  A+ D  +L
Sbjct: 157 DTTAALKL---------------------KSDYSKCLLRRASANESLGNYADAMFDLSAL 195

Query: 393 IEKNNFN 399
               +FN
Sbjct: 196 SLYGDFN 202

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329
           ++ +++ K+ G   FK G Y  A   Y++ + + PQN     V YSN   AL K+ EY  
Sbjct: 5   VTQFEKEKELGNALFKQGLYREAVDSYDQLITAQPQNP----VGYSNKAMALIKLAEYTH 60

Query: 330 CLSDIESAL 338
            +   +  L
Sbjct: 61  AIQTCQEGL 69

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           + +G + +  G+Y +A   Y+ +  + P N     V  +N++ AL K+  ++  LS  + 
Sbjct: 12  RSKGNDLYSKGEYETAVLYYKNASLAEPSNP----VHLANMSMALLKLERWEDALSACDR 67

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQ 387
           ALE+  K P   D+ +Q  Q        W     R+  A EH+   ER ++
Sbjct: 68  ALEIMKKGPVTDDKILQKVQ--------W-----RKKLAHEHLAGTERDIK 105

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 6/128 (4%)

Query: 221 LGEFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISH----LEISGYKEY 276
           L EFQ+K   E  +     P   T LD  +G   E +K      +++     EI+  + +
Sbjct: 26  LTEFQDKTTDEVMEELNRMPFFMTQLDNTDGEGGENLKLEALKALAYEGEPHEIA--ENF 83

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K++G + ++A  Y  A + Y K +     + A+    + N  A   ++  ++RC++D + 
Sbjct: 84  KNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKE 143

Query: 337 ALEMFPKD 344
           AL   PK+
Sbjct: 144 ALRYNPKN 151

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 8/127 (6%)

Query: 221 LGEFQEKIN---LEEPKRSPTPPPQATLLDFDNG--TPPERIKTITPVPISHLEISGYKE 275
           L EFQ K     LEE  R P    +    D D G     E +K +      H E++  + 
Sbjct: 24  LSEFQNKNTDQVLEELNRMPFFMRKLDDTDGDGGENVGLEALKALAYDGEPH-EVA--EN 80

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++G E +K   Y  A + Y K +     ++ +    +SN  A   ++  Y+RC++D  
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 336 SALEMFP 342
            AL+  P
Sbjct: 141 QALQFNP 147

>Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032W
           (REAL)
          Length = 394

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 34/157 (21%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSL--------------PQNHALRIVAYSNLTAALF 322
           K+ GT  FK  DY +A  +Y KSLN +               Q   L++  + NL+  LF
Sbjct: 245 KESGTLLFKKKDYSNALFKYRKSLNYINEYMPEPDVDKERNDQFICLKMKVFLNLSLVLF 304

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            + +Y   ++     LEM             D+ P +       K   RR  ++   +  
Sbjct: 305 NLEKYDDSITYATYLLEM-------------DNVPDKD----QAKAYYRRGNSYFRKKRL 347

Query: 383 ERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPK 419
           + ALQ+Y+   EKN  ND I+  ++R + V+N  E K
Sbjct: 348 DEALQNYEFCKEKNP-NDTII--EQRIEYVVNLIEEK 381

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 26/123 (21%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           KD+G E FK      A + Y+ +L           V Y+N++A    + ++++ L +   
Sbjct: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP-----VFYANISACYVSLNDFEKVLENCNK 164

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           ALE+ P                      + K++ RRA  +E++EN+  A+ D   L   N
Sbjct: 165 ALELKPD---------------------YSKVLLRRANTYENMENFADAMFDLSVLSLNN 203

Query: 397 NFN 399
           +F+
Sbjct: 204 DFS 206

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F  GD+ SA + Y + +   P++       YSN  AAL K+  +   +SD   A+E
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPED----ARGYSNRAAALSKLMSFPDAISDCNKAIE 447

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 448 ---KDPNF 452

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 59/131 (45%), Gaps = 4/131 (3%)

Query: 221 LGEFQEKIN---LEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISHLEISGYKEYK 277
           L EFQ+K     LEE  R P    Q    D D G   E ++ +  +          + +K
Sbjct: 24  LSEFQDKNADEILEELNRQPFFMTQLDETDGDKGANLE-LEALKALAYDGEPHEVAENFK 82

Query: 278 DRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESA 337
           ++  + +KA  +  A + Y+K +     +  +    ++NL A   ++  ++RC++  + A
Sbjct: 83  NQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKA 142

Query: 338 LEMFPKDPNLW 348
           L+  PK+   +
Sbjct: 143 LQFNPKNMKCY 153

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F  GD+ +A + Y + +   P +       YSN  AAL K+  +   ++D  +A+E
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSD----ARGYSNRAAALSKLMSFPEAITDCNTAIE 451

Query: 340 MFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
              KDPN     I+ +      K+  P I T
Sbjct: 452 ---KDPNFIRAYIRKATAQIAIKDFVPAIET 479

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 274 KEYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           +EYKD+G   F A +Y  A +++ K++  S   NH L    YSN +A      ++ + L 
Sbjct: 6   QEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVL----YSNRSACYTSKKQFVKGLE 61

Query: 333 DIESALEMFP 342
           D    +++ P
Sbjct: 62  DANECVKINP 71

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E + +G +FF  G +  A + Y + +   P +      AYSN  AAL K+  +   +SD 
Sbjct: 394 EARIQGKDFFNKGQWPDAVKAYTEMIARAPDD----ARAYSNRAAALSKLMSFPEAISDC 449

Query: 335 ESALEMFPKDPNL 347
           E ALE   KDPN 
Sbjct: 450 EKALE---KDPNF 459

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 55/134 (41%), Gaps = 28/134 (20%)

Query: 237 PTPPPQATLLDFDNGTPPERIKTITPVPI-------------SHLEISGYK--------- 274
           P  PPQ  L +F + TP E ++ +  +P               +LE+   K         
Sbjct: 20  PALPPQ--LSEFKDKTPDEVLEELNRMPFFMTKLDESNGEGGDNLELEALKALAYEGEPH 77

Query: 275 ----EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRC 330
                +K++G + F    +  A   Y K +    +N  +    ++N  A   ++  Y+ C
Sbjct: 78  EVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSC 137

Query: 331 LSDIESALEMFPKD 344
           ++D + AL + PK+
Sbjct: 138 INDCKHALTLNPKN 151

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 35.8 bits (81), Expect = 0.047,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           ++  K+ G E +K G Y  A   Y++ + + PQN     V +SN   AL K+GE+ + + 
Sbjct: 4   FERDKEEGNELYKQGLYRDAIGCYDRLIAAQPQNP----VGHSNKAMALIKLGEHAQAIE 59

Query: 333 DIESALEM 340
             +  L++
Sbjct: 60  ACQQGLQL 67

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 35/70 (50%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++G + +K   +  A   Y K +     +  +  +   N  A   ++  Y+RC++D  
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 336 SALEMFPKDP 345
            AL++ PK+P
Sbjct: 140 EALKLNPKNP 149

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 34/127 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G   FK   +  A + Y         NHA+++    V +SN++A    +G+  + + 
Sbjct: 97  KDKGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVVE 147

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               ALE+ P                      + K + RRA A+E++  Y+ A+ D   L
Sbjct: 148 SSTRALELKPD---------------------YSKALLRRASAYENMGRYQDAMFDISVL 186

Query: 393 IEKNNFN 399
               +FN
Sbjct: 187 SLNGDFN 193

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 53/133 (39%), Gaps = 34/133 (25%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRC 330
           E K RG  +FK  DY +A   Y+          AL++    V YSN+ A    +   K  
Sbjct: 88  ELKKRGNAYFKVKDYENAINYYK---------FALQLKNDPVFYSNMAACYISLEHNKEA 138

Query: 331 LSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQ 390
           +     ALE+ P                      + K++ +RA  +E+I  +  AL D  
Sbjct: 139 IEACSKALELNPD---------------------YSKVLLKRAAVYENIGKFADALLDLT 177

Query: 391 SLIEKNNFNDKIM 403
           ++    ++ND  +
Sbjct: 178 AVSLNGDYNDATI 190

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 99/254 (38%), Gaps = 43/254 (16%)

Query: 221 LGEFQEKIN---LEEPKRSPTPPPQATLLDFDNGTPPE--RIKTITPVPISHLEISGYKE 275
           L EF++K     LEE  R P    +    D D G+  E   +K +      H EI+  + 
Sbjct: 24  LSEFKDKSTDEVLEELNRMPFFMTKLDDTDGDGGSNMELEALKALAYEGEPH-EIA--EN 80

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++G + +K   +  A + Y K +        +    Y+N  A   ++  ++ C+SD +
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEK 395
           +AL   PK+                      K   R  +AF  I  +E A +  +     
Sbjct: 141 TALTYNPKN---------------------IKCYFRMGKAFTAINKFESARESIE----- 174

Query: 396 NNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPK-------TYANVER 448
             F  KI    +  + +LN  + K     +      K  +D +  K       T  NV+ 
Sbjct: 175 --FGQKIDNDNKSFENLLNIIKNKEEEIRKYEEKKLKAQQDRENKKIMLQDALTLRNVKS 232

Query: 449 VKQENQRNELQEAE 462
           +K  +  N ++EA+
Sbjct: 233 IKTNSPANMMEEAK 246

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 7/105 (6%)

Query: 266 SHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVG 325
           S+++    +E + +G EFF  GD+ SA   Y + +   P++       YSN  A L K+ 
Sbjct: 394 SYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPED----ARGYSNRAAVLAKLM 449

Query: 326 EYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
            +   + D + A+    KDPN     I+ +      +E  P + T
Sbjct: 450 SFPDAIKDCDVAIS---KDPNFVRAYIRKASAQIAVREFAPAMET 491

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 26/123 (21%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           KD+G   FKA  +  A + Y  ++  L +N     + YSNL+A    + + +  +     
Sbjct: 115 KDKGNSLFKADKFEEAIKYYNWAI-ELKENP----IFYSNLSACYVSLNKLEEIIKYCNK 169

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           ALE+ P                      + K++ RRA A E +ENY  A+ D   L    
Sbjct: 170 ALELKPD---------------------YSKVLLRRANANEKLENYADAMFDLSVLSLNG 208

Query: 397 NFN 399
           ++N
Sbjct: 209 DYN 211

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 30/143 (20%)

Query: 230 LEEPKR------SPTPPPQATLLDFDNGTPPERIKTITPVPI---------SHLEISGYK 274
           +E+PKR       P  PPQ  L +F N T  E ++ +  +P          S++E+   K
Sbjct: 1   MEKPKRYVPGPNDPLLPPQ--LSEFQNKTTDEVLEELNKMPFFMNKLDPDESNVELEALK 58

Query: 275 -------------EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAAL 321
                         +K++G + +K   +  A   Y K+L+      ++    Y NL A  
Sbjct: 59  AMAYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACE 118

Query: 322 FKVGEYKRCLSDIESALEMFPKD 344
            ++  Y+ C++    AL++  K+
Sbjct: 119 LEIKNYRSCINYCREALKLNAKN 141

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   PQ+       YSN  AAL K+  +   ++D + A+E
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQD----ARGYSNRAAALAKLMSFPEAIADCDRAIE 444

Query: 340 MFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
              KDPN     I+ +      KE    + T
Sbjct: 445 ---KDPNFIRAYIRKASAQIAVKEFAAAVET 472

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 60/151 (39%), Gaps = 29/151 (19%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQ-NHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F A DY  A++ + K+++   Q NH L    YSN +A    + ++   L D
Sbjct: 6   EYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVL----YSNRSACYTSLKKFAEGLKD 61

Query: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
            E  +++ P                      W K   R   A   + N E A + YQ  +
Sbjct: 62  AEECVKINPG---------------------WSKGYNRVGAAQFGLNNLEDAEKSYQKAL 100

Query: 394 EKNNFNDKIMGGKRRCQKVLNPTEPKATSPN 424
           E ++ N      K    +VL   E +   P+
Sbjct: 101 ELDSANK---AAKEGLDQVLKTRESRQQMPD 128

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.4 bits (80), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 272 GYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCL 331
            ++E K  G   FK GDY +A++ Y+  +   P N     + YSN   +L K   + + +
Sbjct: 2   SFEENKTEGNRLFKLGDYTAANKFYDLCIMEEPTNP----IGYSNKAMSLIKQEHFDQAI 57

Query: 332 SDIESALEMFPKDP 345
               + L ++  DP
Sbjct: 58  RTCNTGL-LYSSDP 70

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 31/140 (22%)

Query: 237 PTPPPQATLLDFDNGTPPERIKTITPVPI-------------SHLEISGYK--------- 274
           P+ PPQ  L +F + T  E +K +  +P               +LE+   K         
Sbjct: 16  PSLPPQ--LSEFKDKTTDEVLKELNRMPFFMTKLDDTDGQGGENLELEALKALAYEGEPH 73

Query: 275 ----EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI--VAYSNLTAALFKVGEYK 328
                +K++G + +KA  +  A   Y K +  +  N  ++I    ++N  A   ++  ++
Sbjct: 74  EIAENFKNQGNDLYKAKRFKDARDVYLKGI-QIENNKDVKIKESLFANKAACELELKNFR 132

Query: 329 RCLSDIESALEMFPKDPNLW 348
           RC++D ++AL++ PK+   +
Sbjct: 133 RCINDCKNALQLNPKNVKCY 152

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 34/128 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G E FK   +  A + Y         ++AL++    + YSN++A    + +Y++ + 
Sbjct: 114 KDKGNELFKTSKFEDAIKYY---------HYALKLKDDPIYYSNISACYASLLQYEKVIE 164

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
               AL++ P                      + K++ RRA A+E + N+  A+ D  + 
Sbjct: 165 YATKALKLRP---------------------TFSKVLMRRALAYEAMGNFGDAMFDISAC 203

Query: 393 IEKNNFND 400
               + ND
Sbjct: 204 SLNGDMND 211

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 37/73 (50%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K +G E +KA  +  A + Y K +    ++ ++    ++N  A   ++  Y++C+ D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 336 SALEMFPKDPNLW 348
            AL + PK+   +
Sbjct: 146 KALTINPKNIKCY 158

>YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}
           CPR7Peptidyl-prolyl cis-trans isomerase (cyclophilin),
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues; binds to Hsp82p and
           contributes to chaperone activity
          Length = 393

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 52/134 (38%), Gaps = 31/134 (23%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLP--------------QNHALRIVAYSNLTAALF 322
           K+ GT  FK  DY +A  +Y KSLN +               Q   L++  Y NL+  LF
Sbjct: 244 KESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSLVLF 303

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            +  Y   +      LEM             D+ P R       K   RR  ++   +  
Sbjct: 304 NLERYDDAIMYATYLLEM-------------DNVPNRD----QAKAYYRRGNSYLKKKRL 346

Query: 383 ERALQDYQSLIEKN 396
           + ALQDY    EKN
Sbjct: 347 DEALQDYIFCKEKN 360

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 34/127 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G EFFK   Y  A Q Y         + A+ +    V YSN +A    +G+ ++ + 
Sbjct: 99  KDKGNEFFKNKKYDEAIQYY---------SWAIEVKEDPVFYSNRSACYVSLGQQEKVVE 149

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           D  +AL++ P                      + K + RRA A E + N+  A+ D  ++
Sbjct: 150 DTTAALKLKPD---------------------YSKCLLRRASANESLGNFADAMFDLSAV 188

Query: 393 IEKNNFN 399
               +F+
Sbjct: 189 SLYGDFS 195

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 54/139 (38%), Gaps = 26/139 (18%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           E+K +G   F A DY  AS+ + K++  S   NH L    YSN +A    + ++   L+D
Sbjct: 5   EFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVL----YSNRSACFTSLKKFNEALND 60

Query: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
               +++ P                      W K   R   A+  +   + A Q Y+  +
Sbjct: 61  ANECVKINP---------------------AWSKGYNRVGAAYFGLGKLDEAEQGYKKAL 99

Query: 394 EKNNFNDKIMGGKRRCQKV 412
           E +  N     G  + QK 
Sbjct: 100 EIDTSNKAAQDGLEQVQKA 118

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E + +G E+F  GD+ +A + Y +     P++       YSN  AAL K+  +   + D 
Sbjct: 403 EARLQGKEYFTKGDWPNAVKAYTEMTKRAPED----ARGYSNRAAALAKLMSFPEAIKDC 458

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
           + A+    KDPN     I+ +      +E    I T
Sbjct: 459 DMAIS---KDPNFIRAYIRKATAQIAVREFASAIET 491

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 65/135 (48%), Gaps = 20/135 (14%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K  G +F+KA  +  A + Y K+ + L ++    +   +N +AA ++ G+Y++ +  +  
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWD-LHKD----VTYLNNRSAAEYEKGDYEQAIKTLTE 325

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           A+E                + +R   ++  K   R   A+  +E++++A++ YQ  + ++
Sbjct: 326 AVEQ--------------GREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSLTEH 371

Query: 397 NFNDKIMGGKRRCQK 411
              D I+   R C+K
Sbjct: 372 RTPD-ILTKLRNCEK 385

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 35/64 (54%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++G + ++A  Y  A + Y + ++    +  +    +SN  A   ++  Y+RC++D +
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 336 SALE 339
            AL+
Sbjct: 141 RALQ 144

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 27/139 (19%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           YKD G +F K  D+  A++ Y K++ + P     + + YSN   A  K+  +   L+D  
Sbjct: 12  YKDEGNKFLKQQDFQRANELYTKAIETDPT----QSIFYSNRALANLKLDNFMNALNDCT 67

Query: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEK 395
           +A+E+             +S  ++ +         RR  A   + N++ A  D+ +++ K
Sbjct: 68  NAIEL-------------NSSNLKAYH--------RRGLANIGLLNFKSARNDF-NIVLK 105

Query: 396 NNFNDKIM-GGKRRCQKVL 413
              ND I   G   C+KV+
Sbjct: 106 YKPNDIIAKNGFDTCEKVI 124

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           ++E K +G   FK G Y  A   Y + ++  P N     + YSN   AL K   +   ++
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDPSNP----IGYSNKAMALLKADRFDEAIT 58

Query: 333 DIESALEMFPK-DP 345
             E  L++  K DP
Sbjct: 59  TCEKGLQLISKEDP 72

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 32/141 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSL--------------PQNHALRIVAYSNLTAALF 322
           K+ GT  FK  DY +A  +Y KSLN +               Q   L++  Y NL+ ALF
Sbjct: 244 KESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLNLSLALF 303

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            +  Y   ++     LEM             D+ P +       K   RR  ++   +  
Sbjct: 304 NLERYDSAITYATYLLEM-------------DNVPNKD----RAKAYYRRGNSYLRKKRL 346

Query: 383 ERALQDYQSLIEKNNFNDKIM 403
           + AL+DY+ L ++ N +DK++
Sbjct: 347 DEALRDYR-LCKEMNPDDKVI 366

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 25/120 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           EYKD+G +F K  D++ A++ Y K++    +    + + +SN   A  K   ++  L+D 
Sbjct: 14  EYKDQGNDFVKKQDFIKAAELYTKAI----ELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
           + ALE+             DS+ I+ +         RR  ++  +  +++A  D +++++
Sbjct: 70  DKALEL-------------DSKNIKAYH--------RRGLSYVGLLEFKKARTDLKTVLK 108

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G  FFK  DY +A   Y+K++ + P N     + YSN    L K+ ++   +     
Sbjct: 8   KAKGNVFFKKCDYETAVLYYQKAITADPSNP----IGYSNNAMGLIKLEKWSEAVDACNK 63

Query: 337 ALEMF 341
            L+M 
Sbjct: 64  GLKMI 68

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 21/110 (19%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K +G E +K   Y +A   YE+ +     N  +  + + N  A   ++  Y+ C++D +
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERA 385
            AL                     +F  +  K   R A+AF  IE Y+ +
Sbjct: 137 KAL---------------------SFNPLNVKCYFRMAKAFSAIEKYDES 165

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G ++F  GD+ +A + Y + +   P++       YSN  AAL K+  +   + D   A+E
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPED----ARGYSNRAAALSKLMSFPEAIEDCNKAIE 452

Query: 340 MFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
              KDPN     I+ +      KE    I T
Sbjct: 453 ---KDPNFIRAYIRKATAQIAVKEFAAAIET 480

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F A DY  A   + K++  S   NH    V YSN +A    + ++   L+D
Sbjct: 6   EYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH----VFYSNRSACYASLKKFPEALND 61

Query: 334 IESALEMFP 342
            E  +++ P
Sbjct: 62  AEECVKINP 70

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F  GD+ SA + Y + +   P  H  R   YSN  AAL K+  +   + D + A+E
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAP--HDAR--GYSNRAAALSKLMSFPDAIKDCDKAIE 454

Query: 340 MFP 342
           + P
Sbjct: 455 IDP 457

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + K+ G ++ K   Y  A + Y K++    +  + + + +SN   A  K+  ++ CL D 
Sbjct: 15  DLKNEGNKYIKEKKYTKAVEYYTKAI----ELDSTQSIFFSNRALAQLKLDNFQSCLDDC 70

Query: 335 ESALEMFPKD 344
            SALE+ PK+
Sbjct: 71  NSALELDPKN 80

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 7/132 (5%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E+K++G  F K  ++  A++ Y K++    +    + + +SN   A  K+  ++  L+D 
Sbjct: 14  EFKNQGNVFIKGKNFSKAAELYSKAI----ELDGTQSIYFSNRAFAHLKLDNFQTALNDC 69

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKI-VTRRAEAFEHIENYERALQDYQSLI 393
             A+E+ PK+   +         +  F +    + +  RA+  E +    RAL   + +I
Sbjct: 70  NKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVAT--RALDVCERVI 127

Query: 394 EKNNFNDKIMGG 405
            K  F   I GG
Sbjct: 128 RKEKFEKAISGG 139

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 26/128 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQ-NHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F + D+  A + + K++   P  NH L    YSN +AA     +++  L+D
Sbjct: 7   EYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVL----YSNRSAAYTSAKQFQEALND 62

Query: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
               +++ P                      W K   R   A   + N E A ++Y+  +
Sbjct: 63  ATECVKINP---------------------TWSKGYNRLGAAEFGLGNLEEAEKNYKEAL 101

Query: 394 EKNNFNDK 401
           + +N N+K
Sbjct: 102 KLDNNNNK 109

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F  GD+ +A + Y + +   P++       YSN  AAL K+  +   + D ++A++
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPED----ARGYSNRAAALSKLMSFPEAIKDCDNAIK 451

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 452 ---KDPNF 456

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 51/127 (40%), Gaps = 30/127 (23%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNH-------------ALRIVAYSNLTAALFK 323
           KD GT  FKA  +  A  +YEKS + L Q                LRI  + N+     K
Sbjct: 222 KDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIK 281

Query: 324 VGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYE 383
            G+Y++ L+                 E + D+      K    K + RR  A+ H+++ E
Sbjct: 282 TGDYQKALTSTT--------------EVVHDAAADDKSK---AKALYRRGLAYYHLKDPE 324

Query: 384 RALQDYQ 390
            A+ D +
Sbjct: 325 MAITDLE 331

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   P++       YSN  AAL K+  +   + D E A+E
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIKDCEKAIE 452

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 453 ---KDPNF 457

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E + +G EFF  GD+ +A + Y + +   PQ+       +SN  AAL K+  +   + D 
Sbjct: 382 EARLQGKEFFTKGDWPNAVKAYTEMVKRAPQD----ARGFSNRAAALAKLMSFPEAIEDC 437

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370
             A+ +   DPN     I+ +      KE    I T
Sbjct: 438 NKAVSI---DPNFVRAYIRKATAQIAVKEFAAAIET 470

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           E+K +G   F A DYV A   + K++  S   NH L    YSN +A      +++  L D
Sbjct: 5   EFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVL----YSNRSACYASNKKFEEALKD 60

Query: 334 IESALEMFP 342
            E  +++ P
Sbjct: 61  AEECVKISP 69

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 36/174 (20%)

Query: 268 LEISGYKEY----KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFK 323
           L +S  +EY    KD+G  FF + ++  A + Y+ ++   P +     V YSN++A    
Sbjct: 116 LPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSACYIS 171

Query: 324 VGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYE 383
            G+  + +     ALE+ P                        K + RRA A E + N+ 
Sbjct: 172 TGDLNKVVEYTTKALEIKPD---------------------HSKALLRRASANESLGNFT 210

Query: 384 RALQDYQSLIEKNNFNDKIM------GGKRRCQKVLNPTEPKATSPNRSPTPVP 431
            A+ D   L    +F+   +         ++  KVLN    K  S +R    +P
Sbjct: 211 DAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSK-NSGDRGSEILP 263

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEY---KRCLS 332
           Y  RG  +F   DYV+A  +++K+ +  P N    I  Y  L   L+K G++   ++  +
Sbjct: 414 YYHRGQMYFILQDYVNAKMDFQKAQSLNPGN----IYPYIQLACLLYKQGKFSESEKLFN 469

Query: 333 DIESALEMFPKDPNLWDEPIQD 354
           + +      P+ P  + E + D
Sbjct: 470 ETKLKFPTLPEVPTFFAEILTD 491

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 25/125 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + KD+G  FF A  +  A + Y+ ++   P +     V YSN++A     G+  + +   
Sbjct: 133 QLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVVEYT 188

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 189 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 227

Query: 395 KNNFN 399
             +F+
Sbjct: 228 NGDFD 232

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 14/78 (17%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQN--------------HALRIVAYSNLTAALF 322
           K+ GT+  K  D+ +A  +Y KSLN + +               + L+   Y N+T ALF
Sbjct: 235 KESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVLKQKLYLNMTLALF 294

Query: 323 KVGEYKRCLSDIESALEM 340
            +G Y   +S     LEM
Sbjct: 295 NMGSYDSAISYTNYVLEM 312

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.53,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 4/67 (5%)

Query: 273 YKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLS 332
           + + K  G  FF+ GDY  A+  Y++ +   P N     + YSN   +L K G +   + 
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNP----IGYSNKAMSLIKQGNHGLAVE 58

Query: 333 DIESALE 339
             +  L+
Sbjct: 59  TCQEGLK 65

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 263 VPISHLEISGYKE-YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAAL 321
           +P+   EI    E +K  G +     D+  A ++Y +++  LP N     + Y+N  AA 
Sbjct: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAH 145

Query: 322 FKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIEN 381
             + E++  + D ESA+++ P                      + K  +R A A   +  
Sbjct: 146 SSLKEFEEAIKDAESAIKIDPS---------------------YSKGYSRLAFAKYGLGK 184

Query: 382 YERALQDYQSLIE 394
           +E AL+ Y+ +++
Sbjct: 185 HEEALESYKKVLD 197

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E + +G E+F  GD+ +A + Y + +   P++       YSN  AAL K+  +   + D 
Sbjct: 395 EARLQGKEYFTKGDWPNAVKSYTEMIKRAPED----ARGYSNRAAALSKLMSFPEAIKDC 450

Query: 335 ESALEMFPKDPNL 347
             A+    KDPN 
Sbjct: 451 NVAIS---KDPNF 460

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 52/139 (37%), Gaps = 26/139 (18%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F A D+  A + + K++  S   NH L    YSN +A      ++ + L D
Sbjct: 5   EYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVL----YSNRSACYTSTKQFNKALED 60

Query: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
            +  + + P                      W K   R   A   + + + A Q Y+  +
Sbjct: 61  AKQCVNINP---------------------AWSKGYNRVGAAHFGLGDLDEAEQGYKKAL 99

Query: 394 EKNNFNDKIMGGKRRCQKV 412
           E ++ N     G  +  K 
Sbjct: 100 ELDSANKAAQDGLEQVHKT 118

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 35/67 (52%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K++  + +K   +  A + Y K +    ++ ++    ++N  A   ++  Y+ C++D +
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 336 SALEMFP 342
            A+E+ P
Sbjct: 148 KAMEINP 154

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 25/125 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + K+RG  FF A ++  A + Y+ ++   P       V YSN++A     G+ ++ +   
Sbjct: 129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP----VFYSNISACYISTGDLEKVIEFT 184

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 185 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 223

Query: 395 KNNFN 399
             +F+
Sbjct: 224 NGDFD 228

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEY---KRCLS 332
           Y  RG  +F   DYV+A  +++K+ N  P+N    I  Y  L   L+K G++   +   +
Sbjct: 411 YYHRGQMYFILQDYVNAKADFQKAQNLYPEN----IYPYIQLACLLYKQGKFTESEALFN 466

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRT 360
           + +      P+ P  + E + D     T
Sbjct: 467 ETKLKFPTLPEVPAFFAEILTDKGDFST 494

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 25/125 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + K++G  FF   ++  A + Y+ ++   P +     V YSN++A     G+  + L   
Sbjct: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP----VFYSNISACYISTGDLNKVLEYT 181

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 182 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 220

Query: 395 KNNFN 399
             +F+
Sbjct: 221 NGDFD 225

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   P++       YSN  AAL K+  +   ++D   A+E
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADCNKAIE 458

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 459 ---KDPNF 463

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   P++       YSN  AAL K+  +   ++D   A+E
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADCNKAIE 458

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 459 ---KDPNF 463

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G +     DY SA ++Y +++  LP N     V Y+N  AA   + +Y   ++D ESA++
Sbjct: 100 GNKAMATKDYESAIKKYSEAIEVLPTNA----VYYANRAAAYSSLKKYDDAVNDAESAIK 155

Query: 340 MFP 342
           + P
Sbjct: 156 VNP 158

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 266 SHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVG 325
           S+++    +E + +G E+F   D+  A + Y + +   P +       YSN  AAL K+ 
Sbjct: 382 SYMDPEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPND----ARGYSNRAAALSKLM 437

Query: 326 EYKRCLSDIESALEMFPKDPNL 347
            +   + D + A+E   KDPN 
Sbjct: 438 SFADAIRDCDKAIE---KDPNF 456

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 51/123 (41%), Gaps = 26/123 (21%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           KD+G EFFK   +  A + Y     SL        V YSN +A    +G+ ++ + D  +
Sbjct: 100 KDKGNEFFKNKQFEDALKYY-----SLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTA 154

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396
           AL++ P                      + K + RRA A E +  +  A+ D  ++    
Sbjct: 155 ALKLKPD---------------------YSKCLLRRASANESLGKFADAMFDLSAVSLYG 193

Query: 397 NFN 399
           +FN
Sbjct: 194 DFN 196

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 55/134 (41%), Gaps = 32/134 (23%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G + F+  DY  A++ + KSL  L +++  R     +L     KVG  KRCL D      
Sbjct: 13  GIQCFQGEDYKGAAELFSKSLQ-LARSYTDR-----SLEGIREKVGLPKRCLHD------ 60

Query: 340 MFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFN 399
                            P R +   +  ++  RA  FE +   +RAL D   +I  + +N
Sbjct: 61  -----------------PSRVYHPRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYN 103

Query: 400 DKIMGGKRRCQKVL 413
            K   G  R  KVL
Sbjct: 104 LK---GYIRRGKVL 114

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           +K+ G  + K  +Y+ A + Y +++   P     + + +SN   A  K+  ++ C++D +
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAIELDPT----QSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 336 SALEMFPKD 344
            AL + PK+
Sbjct: 71  VALRLDPKN 79

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G E+F   D+ +A + Y + +   P++       YSN  AAL K+  +   ++D   A+E
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPED----ARGYSNRAAALAKLMSFPEAIADCNKAIE 455

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 456 ---KDPNF 460

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 272 GYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEY 327
            ++E+K +G   +K  ++  A   Y+K++   P N     V YSN   AL K+  Y
Sbjct: 3   SFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNP----VGYSNCAMALIKLNNY 54

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 34/129 (26%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G E FK   Y  A + Y         + ALR+    V YSN +A    + + ++ + 
Sbjct: 102 KDKGNECFKEKKYEEAIKYY---------SCALRLKKDPVFYSNRSACWVPLNKLEKVVE 152

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           D  +ALE+ P                      + K + RRA A E + N+  A+ D  ++
Sbjct: 153 DTTAALELKPD---------------------YSKCLLRRATANESLGNFADAMLDLSAV 191

Query: 393 IEKNNFNDK 401
                +N +
Sbjct: 192 SLYGGYNSQ 200

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 269 EISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYK 328
           +I+   ++K++G E+ K  DY SA + Y K++ +L    +   + +SN   A  K   + 
Sbjct: 8   DIATALDFKNKGNEYIKKSDYDSAIEFYSKAI-ALDSTQS---IYFSNRALAHLKQDNFY 63

Query: 329 RCLSDIESALEMFPKD 344
             + D ++AL++ PK+
Sbjct: 64  SAVVDCDNALKLDPKN 79

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G ++F  GD+ +A + Y + +   P++       YSN  A L K+  +   + D   A+E
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPED----ARGYSNRAAVLSKLMSFPEAIDDCNKAIE 459

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 460 ---KDPNF 464

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQ-NHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F A DY  A   + K+++   Q NH L    YSN +A    + ++   L D
Sbjct: 7   EYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVL----YSNRSACYTSLKKFVNALKD 62

Query: 334 IESALEMFP 342
            E  +++ P
Sbjct: 63  AEECVKINP 71

>TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.456
           YJR032W
          Length = 397

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 56/134 (41%), Gaps = 31/134 (23%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLN---------SLPQNHALRIVA-----YSNLTAALF 322
           K+ GT  FK  D+ +A  +Y KSL           + +++ L+ V      Y NL+ ALF
Sbjct: 245 KESGTLIFKKKDFKNAVFKYIKSLRYVNEYVPDEDVDKDNNLKFVTLKMKLYLNLSLALF 304

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            +  Y   +      LEM         E + D    + +         RR  ++   +N 
Sbjct: 305 NMQNYDGAIEYATYLLEM---------ENVPDVDQAKAY--------YRRGNSYLAKKNM 347

Query: 383 ERALQDYQSLIEKN 396
           E+ALQ+Y+    KN
Sbjct: 348 EKALQNYELCKHKN 361

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 32/141 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNS----LPQNHA----------LRIVAYSNLTAALF 322
           K+ GT  +K  D+ +A  +Y KSL      +P+             L+   Y NL+  L+
Sbjct: 243 KESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEESVDKANRINFINLKSKLYLNLSLVLY 302

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            +  Y   +      LEM         E I D+           K + RR  ++     +
Sbjct: 303 YLQNYDESIKYATYLLEM---------ENIPDADQ--------AKALYRRGNSYSAKRKW 345

Query: 383 ERALQDYQSLIEKNNFNDKIM 403
           E AL+DY+S  EKN+  DK++
Sbjct: 346 EEALKDYKSCQEKND-QDKVV 365

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K++G   FK  D+ +A + Y  +L SL ++     V YSN++A    +  Y++ +     
Sbjct: 99  KEKGNALFKKKDFENAIKYYTFAL-SLKEDP----VYYSNISACYSSLLNYEKVIEMATK 153

Query: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQD 388
           AL + P                      + K++ RRA A+E + N+  A+ D
Sbjct: 154 ALALRPD---------------------YSKVLVRRANAYEKLGNFGDAMFD 184

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 5/131 (3%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E K+ G  F K   ++ A ++Y ++++      + + + +SN   A FKV  ++  L+D 
Sbjct: 14  ERKNEGNVFIKEKHFLKAIEKYTQAIDL----DSTQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394
           + AL++ PK+   +         +  FK+   K +T   +A  +     +AL      I 
Sbjct: 70  DEALKLDPKNIKAYHRRALSCMALLEFKKA-KKDLTVLLKAKPNDPAGTKALATCDRFIR 128

Query: 395 KNNFNDKIMGG 405
           +  F   I GG
Sbjct: 129 EERFRKAIGGG 139

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335
           Y  +G E+     + +A   Y K+L S PQ++     A+  L     K+G+Y+ CL   E
Sbjct: 446 YTLQGHEYSSNDAFDTAMTCYRKALGSNPQHYN----AHYGLGMCCLKLGQYEECLLHFE 501

Query: 336 SALEMFP 342
            A  + P
Sbjct: 502 KARSINP 508

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336
           K +G  FFK GDY +A   YEK+      N     + +SN+  AL K+  ++  ++  + 
Sbjct: 45  KVKGNTFFKNGDYETAILYYEKACALDSSNP----IYFSNMATALIKLERWQEAVNACDK 100

Query: 337 AL 338
            L
Sbjct: 101 GL 102

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 51/128 (39%), Gaps = 28/128 (21%)

Query: 237 PTPPPQATLLDFDNGTPPERIKTITPVPI-------------SHLEISGYK--------- 274
           P  PPQ T  +F + T  E +K +  +P               ++E+   K         
Sbjct: 19  PQLPPQLT--EFHDKTTDEVLKELNKMPFFMTKLDNADVENGGNVELEALKALAYEGEPH 76

Query: 275 ----EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRC 330
                +K++G + +K   Y  A   Y K +    ++ ++    Y N  A   ++  ++ C
Sbjct: 77  EVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSC 136

Query: 331 LSDIESAL 338
           ++D + AL
Sbjct: 137 INDCKKAL 144

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E K+ G  F K   ++ A ++Y ++++      A + + +SN   A FKV  ++  L+D 
Sbjct: 14  ERKNEGNVFVKEKHFLKAIEKYTEAIDL----DATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKE 363
           + A+++ PK+   +         +  FK+
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKK 98

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G ++F   D+ +A + Y + +   P++       YSN  AAL K+  +   ++D   A+E
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADCNKAIE 458

Query: 340 MFPKDPNL 347
              KDPN 
Sbjct: 459 ---KDPNF 463

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLN-SLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333
           EYK +G   F A DY  A + + K++  S   NH L    YSN +A    + ++   L+D
Sbjct: 7   EYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVL----YSNRSACYASLKKFSDALND 62

Query: 334 IESALEMFP 342
            +  + + P
Sbjct: 63  AKECININP 71

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 53/119 (44%), Gaps = 25/119 (21%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           EYKD+G +F  + DY  A + Y K++    +    + + +SN   A  K+  ++  L D 
Sbjct: 11  EYKDQGNKFVASKDYGQAIEAYTKAI----ELDGCQSIFFSNRALANLKLDRFQSALEDS 66

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393
             A+E+             DS  ++ +         RR  A+  ++++  A +D + ++
Sbjct: 67  SKAIEL-------------DSSNVKGYH--------RRGMAYAGLQDFISAKRDLEVVL 104

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 29/140 (20%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G     A DY +A Q+Y  ++  LP +     V Y+N  AA   + +Y++ + D E A +
Sbjct: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152

Query: 340 MFPKDPNLWDEPIQDSQPIRTFKEM-WPKIVTRRAEAFEHIENYERALQDYQSLIEKNNF 398
           +             DS   + F  + + K    R E  E +E Y+R L      IE +N 
Sbjct: 153 V-------------DSSYSKGFSRLGYAKYALGRHE--EALEAYKRVLD-----IEGDNA 192

Query: 399 NDKIM----GGKRRCQKVLN 414
            + +       KR+ ++ +N
Sbjct: 193 TEAMRRDYESAKRKVEESIN 212

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E + +G E+F   D+ +A + Y + +   P++       YSN  AAL K+  +   + D 
Sbjct: 390 EARLQGKEYFTNADWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPDAIKDC 445

Query: 335 ESALEMFPKDPNL 347
           + A++   KDPN 
Sbjct: 446 DMAIQ---KDPNF 455

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 59/144 (40%), Gaps = 32/144 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSL---------NSLPQNHALRIV-----AYSNLTAALF 322
           KD G+  FK  DY ++  +Y K+L           + + H L  +      Y N+  ALF
Sbjct: 238 KDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLALF 297

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            + +Y   +      LE+         + + D    + +  +   +  ++         Y
Sbjct: 298 NLKDYDESMKYGHYLLEL---------DSVDDKDKAKAYYRIGNSLFAKK--------RY 340

Query: 383 ERALQDYQSLIEKNNFNDKIMGGK 406
           + AL++Y+ L   +N +D ++G K
Sbjct: 341 DEALKNYR-LCRDHNPDDNVIGQK 363

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + K +G +   + D+ +A ++Y +++  LP N     V Y+N  AA   + +Y+  + D 
Sbjct: 99  DLKLQGNKAMASKDFETAIKKYTEAIEVLPSNA----VYYANRAAAYSSLKKYEESVQDA 154

Query: 335 ESALEMFP 342
           ESA+++ P
Sbjct: 155 ESAIKVNP 162

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 65/145 (44%), Gaps = 29/145 (20%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E K +G +     +Y  A ++Y ++++ LP N     + Y+N  AA   + EY   + D 
Sbjct: 104 ELKIQGNKAMANKEYELAIKKYTEAIDVLPTN----AIYYANRAAAHSSLKEYDEAIKDA 159

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEM-WPKIVTRRAEAFEHIENYERALQDYQSLI 393
           ESA+ +   DP+ +          R +  + + K    + E  E +E Y++ L      I
Sbjct: 160 ESAISV---DPSYF----------RGYSRLGFAKYAQGKPE--EALEAYKKVLD-----I 199

Query: 394 EKNNFNDKIM----GGKRRCQKVLN 414
           E +N  D +       K+R ++ LN
Sbjct: 200 EGDNATDAMKRDYESAKKRVEQSLN 224

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 32/141 (22%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQN--------------HALRIVAYSNLTAALF 322
           K+ GT+ FK  D+  A  +Y K+L  + +                 L++  Y N++  LF
Sbjct: 283 KESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNISLVLF 342

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            + +Y   ++     LEM  K P L D+                K   RR   +      
Sbjct: 343 NLKKYDSAITHATYLLEM-EKVPTL-DK---------------AKAYYRRGNCYLAKNRL 385

Query: 383 ERALQDYQSLIEKNNFNDKIM 403
           E AL+DY++  E NN +DK++
Sbjct: 386 EEALKDYKNCKE-NNPDDKVI 405

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E K+ G +F K   Y  A++ Y K++   P+N  L    YSN      K+  ++  L D 
Sbjct: 15  ELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTIL----YSNRAFTNLKLDNFQSSLDDA 70

Query: 335 ESALEM 340
           + A+E+
Sbjct: 71  KRAIEL 76

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 8/101 (7%)

Query: 243 ATLLDFDNGTPP---ERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKS 299
           A LL    G P    E +K   P   + L+ S  +  K  G +     DY  A ++Y ++
Sbjct: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELK-SKAESLKLEGNKAMAGKDYELAIKKYSEA 119

Query: 300 LNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEM 340
           ++ +P N     V Y+N  AA   +  Y   + D ESA+++
Sbjct: 120 ISVVPTNA----VYYANRAAAHSSLKNYDEAIKDAESAVKV 156

>Suva_2.589 Chr2 (1046223..1046930) [708 bp, 235 aa] {ON} YDR412W
           (REAL)
          Length = 235

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 153 TPEEKFDSGSFFSLASGILEKGRQFVDQFSGFPQEQDRLTRVRVEQDLPVERPKSVEPPT 212
           T E  FD  S     +G  ++  Q   +   F +EQDRL R+   Q +  ER + +E   
Sbjct: 26  TDEVTFDKDSRLDYLTGFHKRKVQRQKKAQEFNKEQDRLRRIEERQKVRQERKEIMEEQ- 84

Query: 213 VEVEEGNLLGEFQEKINLE 231
                   L  F+E +NLE
Sbjct: 85  --------LKTFKESMNLE 95

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           E K+ G  F K   ++ A ++Y ++++      + + + +SN   A FKV  ++  L+D 
Sbjct: 14  ERKNEGNVFVKEKHFLKAIEKYTEAIDL----DSTQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKE 363
           + A+++ PK+   +         +  FK+
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKK 98

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           +YK+ G E+ KA DY  A + Y +++ +       + + +SN   A  K+  ++  L D 
Sbjct: 40  DYKNEGNEWVKAKDYARAVEAYTRAIEA----DGTQSIFFSNRALANLKLDRFQSALEDS 95

Query: 335 ESALEM 340
             A+E+
Sbjct: 96  ARAIEL 101

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           + K +G +     DY  A  +Y +++  LP N     + Y+N  AA   + EY + + D 
Sbjct: 104 DLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAHSSLKEYDQAVKDA 159

Query: 335 ESALEMFP 342
           ESA+ + P
Sbjct: 160 ESAISIDP 167

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 58/144 (40%), Gaps = 35/144 (24%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNS----LPQNH----------ALRIVAYSNLTAALF 322
           K+ GT  FK  DY +A  +Y+KSL      +P+             L++  Y N++   F
Sbjct: 242 KESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNISLVYF 301

Query: 323 KVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENY 382
            + +   C++     L+M         E + D    + +         RR  A+   +  
Sbjct: 302 NLKDNDNCITYTTYLLDM---------ENVPDLDQAKAY--------YRRGNAYFAKKRL 344

Query: 383 ERALQDYQSLIEKN----NFNDKI 402
           E AL DY++   KN      NDKI
Sbjct: 345 EEALNDYKNCQLKNPSDKVINDKI 368

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 34/120 (28%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332
           KD+G E FK        Q YE+++     + AL++    V YSN +A    + + ++ + 
Sbjct: 99  KDKGNECFK-------DQRYEEAIKFY--DCALKLKEDPVFYSNRSACYVPLNKLEKVVE 149

Query: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392
           D  +AL++ P                      + K + RRA A E + NY  A+ D  ++
Sbjct: 150 DTTAALKLKPD---------------------YSKCLLRRATANESLGNYADAMLDLSAV 188

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 7/132 (5%)

Query: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334
           EYK+ G    K  DY  A ++Y+K++  L    +   V +SN      K+  ++    D 
Sbjct: 11  EYKNEGNACVKVQDYAKAIEKYDKAI-ELDDTQS---VYFSNRALCHLKLDNFQCASQDC 66

Query: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKI-VTRRAEAFEHIENYERALQDYQSLI 393
           + AL + PK+   +         +  FK+    + V  +A+  +     +RAL   + +I
Sbjct: 67  DKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDAAA--KRALDICEKVI 124

Query: 394 EKNNFNDKIMGG 405
            +  F   I GG
Sbjct: 125 REERFRKAIGGG 136

>KLTH0H12276g Chr8 (1044900..1049720) [4821 bp, 1606 aa] {ON} similar
            to uniprot|P25558 Saccharomyces cerevisiae YCL014W BUD3
            Protein involved in bud-site selection and required for
            axial budding pattern localizes with septins to bud neck
            in mitosis and may constitute an axial landmark for next
            round of budding
          Length = 1606

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 25/150 (16%)

Query: 419  KATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQ--------RNELQEAEKAALYDTV 470
            K  + +++ T  PK+ + T+  +  AN   V  EN+        ++   E +K A+ + +
Sbjct: 1075 KLVNEDQNSTTTPKILKTTQDKQKAANCNIVTSENEEPDFSPTKKDIFPEIQKLAIKNVL 1134

Query: 471  FQQIESWKAGKGDDIRHLLANLSTVLTWCD----WKPVSTSDLVMPKKVKITYMKAVAKT 526
            F +  S+        R L  ++ TVL   D    WK +S+   V  K+V  +  K   +T
Sbjct: 1135 FDRSPSF--------RELFDSMRTVLDESDERSNWKILSSDPSV--KEVAFSESKKTNET 1184

Query: 527  HPDKIPSSLELEKRMIAEDVFSSLSVAWEK 556
            H  K   SL    R +A+  FSS S A E+
Sbjct: 1185 HAFK---SLVPSNRPVADLKFSSSSEAQEE 1211

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 24/140 (17%)

Query: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQN------HALRIVAYSNLTAALFKVGEYKRC 330
           K+ GT  FK  D+ +A  +Y+KSL  + +            + Y+NL   L+        
Sbjct: 244 KESGTLLFKKKDFQNAFFKYKKSLRYITEYIPDMEMDKENNIKYTNLKIKLY-------- 295

Query: 331 LSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEM----WPKIVTRRAEAFEHIENYERAL 386
              +   L MF  D   ++E IQ +  I   + +      K   R    +   +  E AL
Sbjct: 296 ---LNMCLMMF--DMQKYEEAIQYATYIIEMENVPKLDVAKAYYRSGNCYLAKKRLEDAL 350

Query: 387 QDYQSLIEKNNFNDKIMGGK 406
           +DY +L ++NN NDK++  K
Sbjct: 351 KDY-NLCKENNPNDKVVDQK 369

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339
           G + F A D+  A ++Y +++  +P N     V Y N  AA     +++  + D ESA+ 
Sbjct: 103 GNKAFAAKDFEGAVKKYTEAIELMPNN----AVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 340 MFP 342
           + P
Sbjct: 159 INP 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,876,287
Number of extensions: 2564237
Number of successful extensions: 8711
Number of sequences better than 10.0: 216
Number of HSP's gapped: 8864
Number of HSP's successfully gapped: 269
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)