Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E027405.353ON58583018e-38
Kpol_1051.65.353ON58582853e-35
KLTH0H14894g5.353ON59582844e-35
Kwal_34.159765.353ON59582844e-35
SAKL0G08800g5.353ON59562836e-35
Ecym_81795.353ON58582774e-34
NCAS0H016305.353ON58582766e-34
TPHA0D020805.353ON59582767e-34
YHR072W-A (NOP10)5.353ON58582723e-33
ZYRO0D10208g5.353ON64562723e-33
Smik_8.1495.353ON58582705e-33
Suva_15.2635.353ON58582706e-33
TBLA0H019605.353ON58582706e-33
CAGL0J10802g5.353ON57562698e-33
KAFR0C018405.353ON58582671e-32
Skud_8.1325.353ON58582653e-32
AGR354W5.353ON69562612e-31
KLLA0C16753g5.353ON57572593e-31
KNAG0C054905.353ON56562472e-29
Suva_16.4453.443ON249629680.11
Smik_16.3603.443ON249029670.14
KAFR0J029503.578ON119234601.5
TDEL0F009908.134ON78922556.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E02740
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   120   8e-38
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   114   3e-35
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   114   4e-35
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   114   4e-35
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   113   6e-35
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   111   4e-34
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   110   6e-34
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   110   7e-34
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   109   3e-33
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   109   3e-33
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   108   5e-33
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   108   6e-33
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   108   6e-33
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   108   8e-33
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   107   1e-32
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   106   3e-32
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   105   2e-31
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   104   3e-31
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   100   2e-29
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    31   0.11 
Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR11...    30   0.14 
KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192...    28   1.5  
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    26   6.8  

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  120 bits (301), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  114 bits (285), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDK+SRQRVTLKKR+ LLPT+
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  114 bits (284), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTLKKTTE+GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P +
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  114 bits (284), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTLKKTTE GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P +
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  113 bits (283), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 55/56 (98%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLGPDGKR+YTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKR+N+LP
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLP 56

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  111 bits (277), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLM+TLGPDGKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+N+LPT+
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (276), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLG DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRY LLPT+
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLM+TLGPDGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR++LLP +
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQ 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  109 bits (272), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  109 bits (272), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLGPDGKR YTL+K TEEGEITKSAHPARFSPDDKYSRQRVTLK+RY LLP
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLP 56

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  108 bits (270), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  108 bits (270), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (270), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 53/58 (91%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTL  DGKRVYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP +
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKRVYTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  107 bits (267), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 53/58 (91%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTL  DGKRVYTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKRY LLP +
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  106 bits (265), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58
          MHLMYTLGPDGKR+YTL K TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score =  105 bits (261), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLGPDGKRVYTL+K T  GEITKSAHPARFSPDDKYSRQRVTLK+R+++LP
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  104 bits (259), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 51/57 (89%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPT 57
          MHLMYTL   GKR+YTLKK TE+ EITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score = 99.8 bits (247), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%)

Query: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK T +GEITKSAHPARFSPDDKYSRQRVTLKKR+ +LP
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
            (REAL)
          Length = 2496

 Score = 30.8 bits (68), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 10   DGKRVYTLKKTTEEGEITKSAHPARFSPD 38
            DG  ++TL    E+G+I+K+    RF PD
Sbjct: 1291 DGNVIWTLGLLFEQGDISKAGDEERFLPD 1319

>Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR117W
            (REAL)
          Length = 2490

 Score = 30.4 bits (67), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 10   DGKRVYTLKKTTEEGEITKSAHPARFSPD 38
            DGK ++TL    E+G+I K+    RF P+
Sbjct: 1291 DGKVIWTLGLIFEQGDICKAGDEERFLPN 1319

>KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192
           aa] {ON} Anc_3.578 YGL251C
          Length = 1192

 Score = 27.7 bits (60), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 27  TKSAHPARFSPDD---KYSRQRVTLKKRYNLLPT 57
           T+ +H  +F  DD     S++R+T+KK++ L PT
Sbjct: 78  TQISHDVQFKNDDFINNNSKRRLTIKKKHELTPT 111

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 25.8 bits (55), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 8   GPDGKRVYTLKKTTEEGEITKS 29
           G DG R +T++K  E+G++ KS
Sbjct: 733 GSDGPRRFTIEKAGEQGQLPKS 754

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,404,778
Number of extensions: 194919
Number of successful extensions: 385
Number of sequences better than 10.0: 25
Number of HSP's gapped: 385
Number of HSP's successfully gapped: 25
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)