Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019905.426ON1460146077580.0
NDAI0C016205.426ON1460146069020.0
ZYRO0F09856g5.426ON1458146068900.0
NCAS0H020405.426ON1460146068710.0
Smik_15.2945.426ON1460146068600.0
Skud_15.2795.426ON1460146068560.0
YOR116C (RPO31)5.426ON1460146068490.0
Suva_8.1695.426ON1460146068440.0
Kpol_1016.95.426ON1460146067910.0
KAFR0D050305.426ON1462146267910.0
SAKL0G02354g5.426ON1458146067870.0
CAGL0L11660g5.426ON1459145967180.0
TBLA0A037205.426ON1458146066590.0
KLTH0F16236g5.426ON1460146266520.0
KNAG0B042405.426ON1455146066020.0
AER252C5.426ON1459146165530.0
KLLA0E21253g5.426ON1457146065530.0
Ecym_55255.426ON1459146065080.0
TPHA0H017605.426ON1459145264900.0
Kwal_55.214595.426ON1148114552130.0
KAFR0B010607.314ON1685151218950.0
Ecym_80657.314ON1743150218970.0
ZYRO0F05918g7.314ON1744150618960.0
Smik_4.957.314ON1719150418790.0
KLTH0H02046g7.314ON1740151318780.0
YDL140C (RPO21)7.314ON1733150118760.0
Kwal_56.244897.314ON1728151518760.0
KLLA0F05071g7.314ON1720152118730.0
Suva_4.1047.314ON1733150618710.0
ADR086C7.314ON1745150718690.0
Skud_4.1147.314ON1726150618640.0
TPHA0A030707.314ON1719151018610.0
SAKL0F10472g7.314ON1730151018600.0
CAGL0I03828g7.314ON1715150218550.0
NCAS0A139007.314ON1716151218540.0
KNAG0C039707.314ON1721150718540.0
TBLA0F021707.314ON1726150818540.0
NDAI0A021307.314ON1729151018530.0
Kpol_162.1singletonON1311116316360.0
Kwal_55.21464singletonOFF32031214070.0
TDEL0C023207.314ON172793114551e-173
Kwal_26.69797.51ON165498411621e-133
CAGL0E05500g7.51ON1643100211421e-130
TPHA0H028007.51ON1648110011421e-130
ZYRO0D04532g7.51ON166798711381e-129
KLTH0D01628g7.51ON165498811341e-129
KLLA0F23243g7.51ON165399511281e-128
TDEL0H040007.51ON166598111271e-128
KAFR0K005407.51ON166299611221e-127
Skud_15.5067.51ON1665100511181e-127
NCAS0F007307.51ON167498411161e-126
YOR341W (RPA190)7.51ON166498611151e-126
KNAG0D049707.51ON167197011141e-126
NDAI0H012007.51ON166997611061e-125
Smik_15.5197.51ON166598611041e-125
TBLA0E019307.51ON165998111001e-124
Suva_8.3917.51ON166598310971e-124
SAKL0B10736g7.51ON165097810781e-121
ADR374C7.51ON164098010671e-120
Kpol_1040.37.51ON16567389541e-105
Kpol_1019.277.314ON3641152063e-16
Suva_1.327.55ON40672830.49
KLLA0D13068g5.359ON87779820.74
TPHA0H014405.359ON875128801.3
YAL034C (FUN19)7.55ON41372745.9
Skud_1.277.55ON40962746.4
TDEL0E043605.193ON659155746.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01990
         (1460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2992   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2663   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2658   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2651   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2647   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2645   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2642   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2640   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2620   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2620   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2618   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2592   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2569   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2566   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2547   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2528   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2528   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2511   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2504   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2012   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   734   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   735   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   734   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   728   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   728   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   727   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   727   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   726   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   725   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   724   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   722   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   721   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   721   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   719   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   718   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   718   0.0  
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   718   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   718   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   634   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   546   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   565   e-173
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   452   e-133
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   444   e-130
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   444   e-130
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   442   e-129
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   441   e-129
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   439   e-128
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   438   e-128
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   436   e-127
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   435   e-127
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   434   e-126
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   434   e-126
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   433   e-126
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   430   e-125
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   429   e-125
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   428   e-124
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   427   e-124
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   419   e-121
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   415   e-120
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   372   e-105
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    84   3e-16
Suva_1.32 Chr1 complement(57262..58482) [1221 bp, 406 aa] {ON} Y...    37   0.49 
KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]...    36   0.74 
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    35   1.3  
YAL034C Chr1 complement(80710..81951) [1242 bp, 413 aa] {ON}  FU...    33   5.9  
Skud_1.27 Chr1 complement(56318..57547) [1230 bp, 409 aa] {ON} Y...    33   6.4  
TDEL0E04360 Chr5 complement(809654..811633) [1980 bp, 659 aa] {O...    33   6.7  

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2992 bits (7758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1446/1460 (99%), Positives = 1446/1460 (99%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
            CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            LRPKPTLFESLSKETAIKAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2663 bits (6902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1272/1460 (87%), Positives = 1359/1460 (93%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS  PKRISGLEFSALSAADIVAQSEVEIS+RDLFDLE GR P+ GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLEC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICK CSA+LL D DR
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPGVDNLRRMGIL KVLDQCKKQRRCLQCGALN              LKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            D FRW GKKS PEKDKWVGDW EVLSH+PELER+VKRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG++S+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNRQKLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPNVHPGANYLLK +EDARRNLRYGDRVKLAKNL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +LTQLLSMM D NLQFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQ+FSLLIKPNK SPVVINLDAKNKV+IPPK+K+ P+EMS+NDGYVIIRGS+IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCAR+LGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDPMEMEGNA+PVNF RSW+HA N+TF+  + GL PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E T+ IL PL +RLIRYDN+G++VP E     EY+DQ DAER+FY SL+ +M  KA++L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            SVRK RGM  ++DEP  E K ++ DE VPE IR+SVDQL +IT D V++FL+IA+ KYR+
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGRIEKTLLSDVA+YIQDVY+DNLSF+QVRIDLNTI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVA+TRAPKLKI  SDV I+ KDKIAINVFPEGYKAKSIST+AKEP EN VF+RM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR+LP IVVKGLP+I+RAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNHIL
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV +VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ ++ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PKPTLFE+L+   +IK N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2658 bits (6890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1270/1460 (86%), Positives = 1372/1460 (93%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVV S  PK+ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAP+ GGALDPKMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSS+EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CS++LL+D D+
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            +HFLSELRRPGVDNLRRMGIL KVLDQCKKQRRCLQCGALN              LKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRWAGKKSVPEK+KW+GDWD VL+H+PELERYVKRCMDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQL+VAMYINSDSVNPA++ G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN +PGANYLLKKDEDARRNLR+GDRVKLAKNLR+GD+VERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSDG LQFDIP P I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
            CYLWTGKQ+FSLLI+PNKKSPVV+NLDAKNKV+IPPKSKSLP+EMSQNDG+V+IRGS+IL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCARY+GNRGFSIGISDVTPA
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            ++LK+KKE+MVE AYAKCDELID ++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNAQPVNF R+W+HA NVTFNN +RGL PYQI 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            + T++IL PL NRL+RYDN+G  + KE    IEYIDQNDAER FY SL+ F+  KA+LLA
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
              R  + MKEL+DEP  E +++D DE+VPE+IRHSVDQ+ RIT   VREFL++AI KYRR
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVN++DERAARVVKGRIEKTLLSDVAFYIQDVY+DNLS++QVR+DL+TIDKLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVA+TRAPKLKIQASDV I+ KDKIAINVFP+G KAKSIST AKEP EN+VF+RM
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LPGIVVKGL DISRAVIN+RDD KRELLVEGYGLRDVMSTDGVVGHKT TNHIL
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV+SVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTM+IGTGAFKV+KGT++ E+ 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PKPTLFESL  ET++K N
Sbjct: 1439 LKPKPTLFESLVNETSVKVN 1458

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2651 bits (6871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1267/1460 (86%), Positives = 1359/1460 (93%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS  PKRISGLEFSALSAADIVAQSE+E+S+RDLFDLE GR P+ GGALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLEC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CK CSA+LL+D D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPGVDNLRRMGIL KVLDQCKKQRRCLQCGALN              LKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKDKWVGDW EVLSH+PELER++KRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+QKLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPNVHPGANYLLKK+EDARRNLRYGDR+KLAKNL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +LTQLLSMMS+G L+FDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             Y+WTGKQVFSLLI+PNK+SPVVINLDAKNKVF+PPK K  P+EMS+NDGYV+IRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AYAKCDELID ++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDPMEMEGNA+PVNF RSW+HA N+TF+N E+GL PY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E+T++IL PL  RLIRYDNVG+LVPK+ +   EY+DQ DAER+FY SL+ +++ KA++LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             VRK RGM E+  EPG E + +D DE + E+I+HSVDQL +IT  SV+ FL+IA+ KYR+
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGRIEKTLLSD+A+YIQDVY+DNLSF+QVR+DL TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAIT+APKLKIQ SDV IL KDKIAINV+P+GYKAKSIST AKEP  N VF+RM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR LP IVVKG  DISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNHIL
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV +VLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PKPTLFE LS     K N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2647 bits (6860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1261/1460 (86%), Positives = 1358/1460 (93%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+A GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSA+LL + D+
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            RHFL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++EDARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLLSMMSDG  QFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLIKPN  SPVVINLDAKNKVF+PPKSKSLP+EMSQNDG+VIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AY+KCDELI  +NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNN + GL PY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            + T++IL PL  RL+RYDN G LV +E     EY+DQ DAER+FY SLK ++  KA  LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            ++RK RGM ELL+ P  E + +D D+ VP+N++ SV QL RI+  SVR+FL+IA+ KYR+
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLSF+QVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAITRA KLKIQASDV I+ KD+IAINVFPEGYKA+SISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LP +VVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L PKP LFESLS E A+KAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2645 bits (6856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1260/1460 (86%), Positives = 1354/1460 (92%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+A GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSAVLL + D+
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            RHFL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++EDARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLLSMMSDG  QFD+P PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLIKPN  SPVVINLDAKNKVF+PPKSKSLPSEMSQNDG+VIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI  +NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNN + GL PY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            +  ++IL PL  RL+RYDN G LV +E     EY+DQ DAER+FY SL+ ++  KA  LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            ++RK RGM E L+ P  E + ID DE VP+N+R SV QL RI+  SVR+FL+IA+ KYR+
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLSF+QVRIDL+TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIA+AITRA KLKIQASDV I+ KD+IAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LP +VVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L PKP LFESLS E A+KAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2642 bits (6849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1261/1460 (86%), Positives = 1354/1460 (92%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+A GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSA+LL + D+
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++EDARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLLSMMSDG   FDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLIKPN  SPVVINLDAKNKVF+PPKSKSLP+EMSQNDG+VIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI  +NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNN ++GL PY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E  ++IL PL  RL+RYDN G LV +E     EY+DQ DAER+FY SL+ ++ GKA  LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            ++RK RGM  LL+ P  E + ID DE VP+N++ SV QL RI+  SVR+FL+IA+ KYR+
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVAFY+QDVY+DNLSF+QVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAITRA KLKIQASDV I+ KD+IAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LP +VVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L PK  LFESLS E A+KAN
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2640 bits (6844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1259/1460 (86%), Positives = 1354/1460 (92%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPRA GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSLECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSA+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLKK+EDARRNLRYGDR+KLAK+L++GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLL MMSDG  QFD+P PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLIKP+ KSPVVINLDAKNKVF+PPKSKSLPSEMSQNDG+V+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI S+NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TF+N + GL PY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E  +KIL PL +RL+RYDN G LV  E     E++DQ DAER+FY SL+ ++  KA  LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            ++RK RGM EL++ P  E + +D DE VP N+R SV QL RI+  SV++FL+IA+ KYR+
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLSF+QVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAITRA KLKIQA DVTI+ KDKIAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LP +VVKGL DISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKVIKGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L PKP LFESLS E A+KAN
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2620 bits (6791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1241/1460 (85%), Positives = 1349/1460 (92%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVVS TPK+ISGLEFSALSA+DIVAQSEVE+STRDLFDLENGRAP+ GGALDPKMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSS+ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCS++LL+D DR
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNL+RM I+ K+LDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKD+WVGDW++VL++NPELER+ KR MDDLNPLKTLNLFKQ++PEDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQLSVAMYINSDSVNP+MMPGASSGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR+KLQ L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPNVHPGANY+LK +E+ARRNLRYGDR+K+AK LRVGD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DR + TQLLSMMSD NLQFDIP P I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
              LWTGKQ+FSLLIKPNK SPVVINLDAKNKVFIPPKSKSLP+EMSQNDG+V+IRGS+IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            + LK+KKE++VE AYAKCDELID + KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA N+TF+N+ +GL PY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
             +T+ ILAP   RLIRYDN+G LV     A  E++DQ D+ERNFY SL+ +M+ KA +LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            S+RK +G+KEL  EPG EFK +D DE      R +V++LC+IT  +V +FL+IA+SKYRR
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDND+RAARVVKGRIEKTLLSDVA+Y+QDVY+DNLSF++V+IDL+TIDKLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVA+TRAPKLKIQ +DV I+ KDKI I+V+PEG KAKSISTS KEP ENDVF+RM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR+LP IVV GLPDI+RAVIN+RDD KRELLVEGYGLR+VM TDGV+G KT TNH+L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVFSVLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTGAFK++K T++   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PK TLFE+L  E A+K N
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2620 bits (6791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1244/1462 (85%), Positives = 1357/1462 (92%), Gaps = 2/1462 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVV+S  PK+ISG+EFSALSA+DIVAQSEVEIS+RDLFDLE  R  +  GALDP+MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSSL C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNCS+VLL D D+
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RHFLSELRRPG-VDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKII 179
            + +L ELR  G +DNL++MGIL KV+DQCKKQRRCL CGALN              LKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDC 239
            HDTFRW GKKS PEKD W+GDW+EVLSH+PELER+VKRC DDLNPLKTLNLFKQ++PEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKG 359
            K+GLEKGISINNMMEHWDYLQL+VAMYIN+DSVNPAM+PGASSGGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR+KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  LINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPS 479
            ++NGPN+HPGANYLLKK+E+ARRNLRYGDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDR + TQLLSMMSDGNLQFDIP PAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PCYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
            P YLWTGKQ+FSLLIKPN KSPVVINLDAKNKV+IPPKSKSLP+EMS+NDG+VIIRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
            ADDLK KKE++VE AYAKCD+LIDSYNKGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQI 959
            YDNTVRTSSNGIVQFTYGGDGLDPMEMEG+AQPVNF RSW+HA N+TFNN ERGL PYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  EEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019
             ++T+++L PL  RL+RYDN+G  V KE    +EY DQ DAER+FY +L+S+++ K++ L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079
            A VRK RG+ ELL EPG E +++  DE   +  R SVDQLC+IT  +V +FL+IA+SKYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGR+EKT+LSDVA+YIQDVY+DNLSF+Q+RIDLNTI+KLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259
            LTIEDIAVA+T+APKLKIQASDV+I   DK+ +NVFPEG K+KSISTSAK+P ENDVF+R
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319
            MQQLRR+LP IVVKGLP+I+RAVIN+RDD KRELLVEGYGLR+VM TDGV+G KT TNH+
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379
            LEV SVLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439
            RDSVLQLASFEKTTDHLFDAAFYMK+D VEGVSECIILGQTMSIGTG+FKV+KGTD+  +
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1440 DLRPKPTLFESLSKETA-IKAN 1460
            DL+PKPTLFESLS  ++ IK N
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2618 bits (6787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1243/1460 (85%), Positives = 1342/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV   PK+I GLEFSALSA+DIVAQSEVEISTRDLFDLENGR P+ GGALD KMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  EC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CKNC+++LL D D+
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPGVDNLRRMG L K+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEK+KWVGDW +VL HNPELERY+KRCMDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPN+HPGANYLLKK++DARRNLRYGDR+KLAKNL+ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +LTQLLSMMSDGN+QFD+P PA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLI+PNKKSPV+IN+DAKNKVF+PPK K LP+EMS NDG+V+IRGSEIL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLK+KKED VE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW+HA N+TF + + GL PYQI 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E T+ IL PL  +L+R+DN+G  + KE +  IEYIDQ+DAERNFY SL+ +M  KA  LA
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             +RK +G+K LLDEP PE K ++ DE  PE I  +V+QLC+I+ + V  FL IAISKY R
Sbjct: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVND DERAARVVKGRIEKT+LSDV +YIQDVY+DNLSF+Q ++DL TI+KLQLEL
Sbjct: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIAVAITRA KLKI  +DV+I+ ++KI INVFPEGYKAKSISTSAKEP EN VF+RM
Sbjct: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR+LPGIVVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM+TDGV+G KT TNHIL
Sbjct: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            E+F+VLGIEAAR SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT + E+D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PK TLFESL  + A+K +
Sbjct: 1439 LKPKHTLFESLCNDVALKTH 1458

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2592 bits (6718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1238/1459 (84%), Positives = 1348/1459 (92%), Gaps = 3/1459 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVV+  TPKRISGLEFSALS ADIVAQSE+EIS+RDLFDLEN R+P+ GGALDP+MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            S+SS+ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICK CSA+LL + D+
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            RHFLSELRRPGVDNLRRM +L KVLDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKDKW+GDW EVLSHNPELERYVKR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++NK+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +G+EKGISINNMMEHWDYLQ++VAMYINSDS+NPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKK+E+ARRNLRYGDR KLA NL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+ SLTQLLSMMSDG+LQFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
            CYLWTGKQVFSLLIKPNK SPV INLDAKNKV+IPPK K  P+EMSQNDG+VI+RGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKED+VE AYAKCDELID YNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNNT+RGL PY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            +  D IL PL  RLIRYD +G+ V  E D L +Y+DQ+D+ER FY SL+ FM  KA+ LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNID-FDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079
             +RK RG+ +L+ +   E +  D  +E +   ++HS+ QL RIT D+V++FL+IAISKY 
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGRIEKTLLSDV +YIQDVY++N++++QV++DLNTIDKLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259
            LTIEDIA+AITRAPKLKIQ SDVT+L KDKIAINV PEG+ +K+ STS KEP ENDVF+R
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319
            MQ LRR+LP I+VKGL DI+RAVIN+RDD KRELLVEGYGLRDVM TDGV+G KTATNH+
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379
            LE+F+VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+K TD+ E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1440 DLRPKPTLFESLSKETAIK 1458
            +L+PK TLFESL+   A K
Sbjct: 1439 ELKPKRTLFESLTSNVANK 1457

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2569 bits (6659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1230/1460 (84%), Positives = 1327/1460 (90%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVV S  PK+ISGLEFSALSAADIVAQSEV I+TRDL+DLE+GRAP+  GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS+LEC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK+C+AVLL D D+
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R+FLSELRRPG+DNL+RMGIL K+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKK  PEKD WVGDW EVLSHNPELER+VKR MDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS++KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQLSVAMYINSDSVNP +MPGAS+G  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYN++KLQ L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLKKDE+ARRNLRYGD+VKLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR + TQLLSMM DGNLQFDIP PAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
            CYLWTGKQ+FSLLIKPN  SPVVIN+DAKNKVF PPK KSLPSEMS NDG+V+IRGS+IL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            D LK  KE++VE AYAKCDELI  YN+GKLETQPGCNEEQTLEAKI G+LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP +MEGNAQPVNF RSW+HA+N+ F+N ++ ++PYQI 
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E T+ IL PL  +LIRYDN+GK+V  E     E++DQ DAERNFY SL+ +M  KA  LA
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             VRK RGMKELL  PG EFK +D DE  P++IRHSV+Q+CRIT ++VREFLKIAI+KYRR
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRR 1079

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGRIEKTLLSDVA+YIQD Y+DN S+++V+IDL TI+KLQLEL
Sbjct: 1140 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            T+ DIA AI RAPKLKIQ  DV      KI I+V PE   +K IS SAKEP EN+VF+RM
Sbjct: 1200 TMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRM 1258

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR+LP IVVKGLPDI+RAVIN+RD+ KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1259 QHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1318

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV SVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+K T +    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGT 1438

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+PK TLFESL KET IK N
Sbjct: 1439 LKPKRTLFESLCKETNIKIN 1458

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2566 bits (6652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1224/1462 (83%), Positives = 1332/1462 (91%), Gaps = 4/1462 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQS+VEISTRDLFDLENGR P++GGALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK C+A+LL + D+
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
              FLSELRRPG+DNLRRMGIL KV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKDKWVGDW  VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+QKLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPN HPGANYLLKKDE+ARRNLRYGDR+KLA+NL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF R    QLLSMMSDGNLQFDIP P+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             Y+WTGKQVFSLLI+PNK+SPVVINLDAKNKV+IPPK KSLP+EMS NDGYV+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE MVE AYAKCD LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW HA NVTFN+ ++ L PYQI 
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  EETDKILAPLMNRLIRYDNVG-KLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019
            ++T+ +L PL  +L+RYDN+G +L P  +D  +EYIDQ+DAERNFY SL+ +M  KA  L
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDR-VEYIDQDDAERNFYKSLRDYMYEKASHL 1018

Query: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079
            A++R  +G+KE LDEP  E + +D DE  P +   SVDQLC+I+   V +FL+IAI KY 
Sbjct: 1019 ANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078

Query: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGRIEKTLLSDVAFYIQDVY+DN+SF+QV++DL TI+KLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198

Query: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259
            LT+EDIAVAITRA KLKI ASDV+I+ KDK+ INV+PE  K KSISTSAKEP EN++F+R
Sbjct: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258

Query: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319
            MQ LRR+LPGIVVKGLPDI+RAVIN++DD  RELLVEGYGLR+VM+TDGV+G KT TNHI
Sbjct: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318

Query: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379
            LEVFSVLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEILGITRFGLSKM
Sbjct: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTGAFKV+KGTD+ E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438

Query: 1440 DLRPKPTLFESLSKE-TAIKAN 1460
            DL PKPTLFESL    TA+K N
Sbjct: 1439 DLAPKPTLFESLCDSVTALKVN 1460

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2547 bits (6602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1216/1460 (83%), Positives = 1324/1460 (90%), Gaps = 5/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV  T K+ISG+EFSAL+AADIVAQSEVEI+TRDLFDLE GR  + GGALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+CSAVLL D DR
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLR+M IL KV+DQCKKQRRCL+CG LN              LKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKK VPEKD+W+G+W+E+L+H+PELER+VKRC DDLNPLKTL LFKQLK EDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+S+ +SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GL KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PGASSGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN++KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLKK+E+ARRNLRYGD++KLAKNL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD GSLTQLLSMMSD  LQFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLI+PNKKSPVVINLDAKNKV+IPPK KS P+EMS NDG+VIIRGSEIL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCARYLGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKE+MV FAYAKCDELID +  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            D+TVRTS+NGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HA N+TFN  E GL PY+I 
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
             ETD +L PL  +LIRYDN+G +VPKE      Y D++DAER FY SL+ +M+ KA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             +R  RG+ E+    G     +     V   ++ SVDQ+ +IT  +V  FL IA+ KY R
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVN+ DERAARVVKGRIEKTLLSD+AFYIQDVY+ N+S++++R+DL TI+KLQLEL
Sbjct: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            T+EDIAVA++RAPKLKIQ +D+ IL KDKI +NV+PEG KAKSISTSAKEP EN+VF++M
Sbjct: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRRSLP +VVKGLPDISRAVIN+RDD KRELLVEGYGLR+VM TDGV+G KT TNH+L
Sbjct: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV SVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMS+GTG+FKV+K  D+ E+D
Sbjct: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+ +PTLFESL+ ETAIKAN
Sbjct: 1436 LKVRPTLFESLASETAIKAN 1455

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2528 bits (6553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/1461 (82%), Positives = 1317/1461 (90%), Gaps = 3/1461 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV   PKRISGLEFSALSA+DIVAQSEVEI TRDLFDLE+GRAP+ GGALD +MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  EC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNC+ +LL++ D+
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FLSELRRPG+DNLRRM  L KVLDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKDKW+GDW++VL H+PELERY+KR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQ++VAMYINSDSVNPA+MPG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NG NVHPGANYLLKK+E+ARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +  Q+LSMMSDGNLQFDIP PAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQ+FSLLIKPNKKSPV+INLDAKNKV+I PK+K+ P+EMS NDGYV+IRGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK  KE+MVE AYAKCDELID Y +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP+ MEGNA+PVNF RSW+HA N+T+N+ ++G+ PYQI 
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  EETDKILAPLMNRLIRYDNVGK-LVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019
            EET+ IL PL  +L RYDNVG  L P  ++  + YIDQ+DAER FY SL+++M  KA  L
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEEL-YIDQHDAEREFYQSLRTYMSEKARKL 1018

Query: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079
            A + K RG+KEL   P  E + +D D   PE    SV+QLC+I+   VR FL IAISKYR
Sbjct: 1019 ADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR 1078

Query: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199
            IINA LVND+DERAARVVKGR+EKTLLSDV FYIQDVY+DN+SF+QV++DL TI+KLQLE
Sbjct: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLE 1198

Query: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259
            LT+EDIA+AIT APKLKI   DV+I+ ++KI INV  +  KAKSIST A EPHENDVFF+
Sbjct: 1199 LTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFK 1258

Query: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319
            MQ LRR+LPGIVVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM+TDGVVG+KT TNH 
Sbjct: 1259 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318

Query: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379
            LEV+ VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTM+IGTG+FKV+KGT++   
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPD 1438

Query: 1440 DLRPKPTLFESLSKETAIKAN 1460
            DL+PKPTLFE+L     +K N
Sbjct: 1439 DLKPKPTLFENLCSLNTLKVN 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2528 bits (6553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1460 (82%), Positives = 1317/1460 (90%), Gaps = 3/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKE V+   PK+I G+ FSALSAADIV+QSEVEISTRDLFDL+NGR+ + GGALDP+MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C A+LL + D+
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNLRRM IL K+LDQCKKQRRC +CG LN              LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEK++W+GDW +VL +NPELERYVKRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS++KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNP+M+PG+S  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQQL+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGP VHPGANYLLKK+EDARRNLRYGDRVKLAK L+ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR  LTQLLSMMSD NLQFDIP P+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             YLWTGKQVFSLLIKP++KSPVVINLDAKNKV++PP  K  P+EMSQNDG+V+IRGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLK+KKE MVE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW HA N+T N+   GL PYQI 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
             ET+ IL PL N+L RYDN+G+ + KE +   EYIDQ DAER+FY SL+ FM  KA  LA
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
            S+R +RG+KEL+DEP  E +  ++DE+VP +I  +++QLC+I+   V++FL IAISKY R
Sbjct: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDV+FY+QD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            T+EDI VAI +APKLKI  +D++I+ KDKI I V  +G   KSIST+ KEP  N+VF+RM
Sbjct: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            QQLRR+LP IVVKG  DISRAVIN+RDD KRELLVEGYGLRDVM+TDGV+G KT TNHIL
Sbjct: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EV+ VLGIEAAR+ II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGL+KMR
Sbjct: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FKV+K T + E D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L PKPTLFE+L  +T +KAN
Sbjct: 1439 LTPKPTLFETLC-DTVVKAN 1457

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2511 bits (6508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1460 (81%), Positives = 1315/1460 (90%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV   PK+I GL FSALSA+DIVAQSEVEI TRDLFDLENGRAP+ GGALD KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  EC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ ICKNC+A+LL + ++
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNLRRM  L KVLDQCKKQRRCL CGALN              LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEK+KW+GDW++VL HNPELERY+KR MD+LNPLKTLNLFKQ++ +DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQ++VAMYINSDSVNPA+MPG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYN+ KLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPNVHPGANY+LKK+EDARRNLRYGDR+KLAKN+++GDVVERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSFFDR + TQLLSMM+D N+QFD+P PAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
            CYLWTGKQVFSLLI+PNKKSPV+INLDAKNKV++PPK+KS P+EMS NDGYVIIRGSEIL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
             GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE+MVE AYAKCDELID + +G+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNTVRTSSNG+VQFTYGGDGLDP+ MEGNAQPVNF RSW+HA N+TFNN E GL PYQI 
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            E ++ IL PL  +L+R DNVG  +  +  +  EYIDQNDAER+FY SL+++M  KA  LA
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             +RK +G+K LL+EP  E K +D D        +S++QLC+I+ + V  FL IAISKY +
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHK 1079

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200
            INA+LVNDNDERAARVVKGRIEKTLLSDV FYIQDVY+DN+SF+QV++DL+TI+KLQLEL
Sbjct: 1140 INALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
            TIEDIA+AI+RAPKLKI   DV+I+ K+KI I+V  +  K KSIST   EP+ENDVF+RM
Sbjct: 1200 TIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRM 1259

Query: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320
            Q LRR+LP IVVKGLPDISRAVIN+ +D KRELLVEGYGLRDVM+TDGV+G+KT TNH L
Sbjct: 1260 QHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380
            EVF VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1320 EVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV++GT++   +
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDE 1439

Query: 1441 LRPKPTLFESLSKETAIKAN 1460
            L+P PTLFE+L   TA+K +
Sbjct: 1440 LKPNPTLFENLCNNTALKVS 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2504 bits (6490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1189/1452 (81%), Positives = 1325/1452 (91%), Gaps = 4/1452 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVV+S TPKRISGLEFSALS +DI+AQSEVEISTRDLFDLENGRAP  GGALDPKMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS+LEC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQILQG+CK+CSA+LL+D D+
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            RHFL ELR+P +DNL+RM IL K+LDQCKKQRRCL+CG LN              LKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKK+VPEKDKW+GDW++VL++NPELE+++KRC DDLNPLKTLNLFKQ+K EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+  SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMMEHWDYLQLSVAMYINSDSVN  +MPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPG-SNGGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK +E+ARRNLRYG+R KLAK LR+GD+VERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +LTQLLSMMSD NL+FDIP PAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PCYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
            P  LWTGKQ+FSLLIKPNK+SPVVINLDAKNKV+IPP++KS PSEMS NDGYVIIRGSEI
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQE+ANAMNRMAKLCARYLGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
             ++LK KKED+VE AY KCDELI  YNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQI 959
            YDNT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF R+W+HA N+TF+   +GL PYQI
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  EEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019
             ++T+ IL PL N L+RY+NVGK + K+     EY+DQ DA+R+FY S++ +M  KAE L
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079
            A +RK R +KEL+ EP  E ++IDFDE++P N+R  VD+LC+I+  +V++FL+IAISKY 
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYH 1079

Query: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1139

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199
            II AVLVND+D RAARVVKGRIEKTLLSDVA+YI+DVY+DN +F++++IDL+TI+KLQLE
Sbjct: 1140 IIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLE 1199

Query: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259
            LTIEDIA+AI++APKLKI +S++ I+  DKIAI+VF E   +KSISTS KE  EN VF++
Sbjct: 1200 LTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYK 1257

Query: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319
            MQ LRR+LP +VVKGL DISRAVIN++DD+K ELLVEGYGLRDVM TDGV+G KT+TNHI
Sbjct: 1258 MQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHI 1317

Query: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379
            LE+F+VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1377

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439
            RDSVLQLASFEKTTDHLFDAAFYMK+D V+GVSECIILGQTMSIGTG+F V+K T +  +
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPE 1437

Query: 1440 DLRPKPTLFESL 1451
             ++PK TLFESL
Sbjct: 1438 QVKPKRTLFESL 1449

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2012 bits (5213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1145 (82%), Positives = 1036/1145 (90%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            MKEVVV   PKRI GLEFSALSA+DIV QS+VEISTRDLFDLENGR P++GGALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+A+LL + D+
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIH 180
            R FLSELRRPG+DNLRRMGIL KV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
            DTFRW GKKS PEKDKWVGDW  VLSHNPELERYVK+CMDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQQL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
            INGPN HPGANYLLKKDE+ARRNLRYGDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ R    QLLSMMSDGN+QFDIP PAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
             Y+WTGKQVFSLLI+PNKKS VVINLDAKNKV+IPPK K LP+EMS NDG+V+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE MVE AYAKCD+LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW+HA N+TFN++++ L PYQI 
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020
            ++T+ IL PL  +L+RYDN+G+ +        E+IDQ+DAERNFY SL+ ++  KA  LA
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080
             +R  +G+K+ LDEP PE +++D DE  P  +  SVDQLC+I+   V +FL+IAI KY +
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVL 1145
            INAVL
Sbjct: 1140 INAVL 1144

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1512 (34%), Positives = 775/1512 (51%), Gaps = 162/1512 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  ++   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR--RHFL 124
            C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+   R  L
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVL 126

Query: 125  SELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFR 184
             +++ P     +R    + V   CK +  C                      ++I     
Sbjct: 127  -KIKDPK----KR---FNAVWSLCKTKMIC-----------ETDVPSENDPTQLISRGGC 167

Query: 185  WAGKKSVPEKD--KWVGDW--DEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
               + +V  KD  K VG W  D+  S   E E+ V      L   + LN+FK + PED  
Sbjct: 168  GNAQPTV-RKDGLKLVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDST 220

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG D   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  KLGFD--EEFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +    G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFD--IPAPAIM 598
            +++P+S +P +   QD + G  +++ KD+F +   +  +L  + D    +D  IP PAI+
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAIL 566

Query: 599  KPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRG 656
            KP  LWTGKQ+ S  I      P  I+L    +    + PK          ++G +II G
Sbjct: 567  KPKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG 610

Query: 657  SEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISD 716
             +I+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGD 668

Query: 717  VTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 776
                 +  K+  + +  A  K +E+        L  + G    ++ E  +   L++ R++
Sbjct: 669  TIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTER 952
               YD T R S   I+QF YG DG+D   +E   Q ++ +   + AF   +       E 
Sbjct: 849  MVHYDGTTRNSLGNIIQFIYGEDGIDASHIE--KQSLDTIGGSDAAFEKRYRIDLLKVEN 906

Query: 953  GLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL-----------------IEYI 995
             L P  +E  ++ I   L  +++  +   +LV  E  A                  I  I
Sbjct: 907  SLDPSLLESGSE-ITGDLKLQVLLDEEYRQLV--EDRAFLRKVFTDGESNWPLPVNIRRI 963

Query: 996  DQNDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDED 1047
             QN A++ F         L+++  ++G  EL   +   RG  E++ +   +   +     
Sbjct: 964  IQN-AQQTFRIDHSKPSDLTIRDIIKGVRELQEKLLVLRGKNEIVQQAQQDAITLFCCLV 1022

Query: 1048 VPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLK 1107
                    V Q  R+T +S    +    S++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1023 RSRLATRRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTT 1142

Query: 1166 LSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPK--LKIQASDVT 1223
            L  V     ++Y D      V  D   I +L   L  E++  ++ +     L+++     
Sbjct: 1143 LKSVTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAA 1201

Query: 1224 ILDKD----------------------------KIAIN---VFPEGYKAKSISTSAKEPH 1252
            + DKD                            K+ I    V P+G  A+   T A+E H
Sbjct: 1202 MNDKDLTMGQVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAE---TEAEEDH 1258

Query: 1253 ENDVFFRMQQLRRS-LPGIVVKGLPDISRAVINVRDDT------------KRELLVEGYG 1299
                   ++++  + L  I ++G+ +I R V+   D              +  L  +G  
Sbjct: 1259 ------MLKKIENTMLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVN 1312

Query: 1300 LRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLG 1359
            L +VM+  GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LAEVMTIPGVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLV 1372

Query: 1360 DVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQ 1419
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ
Sbjct: 1373 DVMTCQGGLTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQ 1432

Query: 1420 TMSIGTGAFKVI 1431
               IGTGAF V+
Sbjct: 1433 MAPIGTGAFGVM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1502 (34%), Positives = 765/1502 (50%), Gaps = 141/1502 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + I  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    + +
Sbjct: 8    SAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNYK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LLD+++      E
Sbjct: 67   CQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEYN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D  RR    + V   CK +   + C                        + 
Sbjct: 121  LMRQAIKIKDPKRR---FNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGCGNAQPSI 174

Query: 184  RWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCELLG 243
            R  G   V     W  D +   S  PE     KR    L+  + LN+FK + PED   LG
Sbjct: 175  RKDGLSLV---GTWKKDKNSEDSDQPE-----KRI---LSAEEILNVFKHITPEDSLRLG 223

Query: 244  IDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKSGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224  FNED--FARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRLE 280

Query: 304  EKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGR 363
              G   + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR
Sbjct: 281  INGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGR 335

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLING 423
             RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ NG
Sbjct: 336  IRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNG 395

Query: 424  PNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLHRL 483
            PN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH++
Sbjct: 396  PNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKM 453

Query: 484  SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 543
            S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 454  SMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVS 513

Query: 544  PKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPCYL 603
            P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP P I+KP  L
Sbjct: 514  PQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKPTILKPKPL 571

Query: 604  WTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGV 663
            W+GKQ+ S+ I PN    + +    +   ++ PK          ++G +II G +I+ GV
Sbjct: 572  WSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGMLIIDG-QIIFGV 616

Query: 664  MDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPADDL 723
            +DK  +G      + + + R+ GPQ  A     + K+   +L + GFSIGI D    +  
Sbjct: 617  VDKKTVGSSSG-GLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIADEKT 675

Query: 724  KKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIN 783
             ++  + +  A  +  E+        L  + G    ++ E  +   L++ R++ G     
Sbjct: 676  MREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRSAEL 735

Query: 784  ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQ 843
             L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736  NLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPE 795

Query: 844  SKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 903
            SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T
Sbjct: 796  SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGT 855

Query: 904  VRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLFPYQI 959
             R S   I+QF YG DG+D   +E   Q ++ +   + AF   +     N E GL P  +
Sbjct: 856  TRNSLGNIIQFVYGEDGMDASHIE--KQSIDTIPGSDLAFEKRYRIDLLNPEYGLDPSLL 913

Query: 960  EEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQ--------------NDAERNFY 1005
            E  T+ I+  L  + +  +   +LV   +     ++D                +A++ F 
Sbjct: 914  ESATE-IMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRRIIQNAQQTFR 972

Query: 1006 --------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVD 1057
                    L++K  + G  +L  ++   RG   +L E       +             V 
Sbjct: 973  IDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLVRSRLATRRVL 1032

Query: 1058 QLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1117
               R+T  + +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 TEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1118 NVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLLSDVAFYIQD 1175
             VT GVPR+KEI+N +K + TP +   L  D   D+  A++++  IE T L  V    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTTLKSVTVSSEI 1152

Query: 1176 VYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVF 1235
             Y  + S   +  D   I   QL  ++ D     +    LK Q+  +  L+ D+ A+N  
Sbjct: 1153 YYDPDPSSTVIEEDEEII---QLHFSLMDEETENS----LKHQSPWLLRLELDRAAMN-- 1203

Query: 1236 PEGYKAKSISTSAKEPHENDVF------------FRMQQLR------------------- 1264
             +      +    KE  +ND+F             R + +R                   
Sbjct: 1204 DKDLTMGQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHMLKK 1263

Query: 1265 ---RSLPGIVVKGLPDISRAVI-----NVRDDTKRE-------LLVEGYGLRDVMSTDGV 1309
                 L  I ++G+ DI+R V+      V ++T          L  +G  L +VM+  GV
Sbjct: 1264 IENTMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGV 1323

Query: 1310 VGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEIL 1369
               +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++
Sbjct: 1324 DPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLM 1383

Query: 1370 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFK 1429
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF 
Sbjct: 1384 SVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFD 1443

Query: 1430 VI 1431
            V+
Sbjct: 1444 VM 1445

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1506 (34%), Positives = 766/1506 (50%), Gaps = 150/1506 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  +I A S  +I   +  D    RA + GG  DP++G    SL+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
              R  +   D+ +R    + V   CK +   + C                        T 
Sbjct: 121  QMRQAIKIKDSKKR---FNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPTI 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G K V   +KDK  GD       N E E+ V      LN  + LN+FK + PED   
Sbjct: 175  RRDGLKLVGSWKKDKNSGD-------NEEPEQRV------LNMEEILNIFKHISPEDSWK 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222  LGFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279  LEHNGAPHHTIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F + G +  +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
             LWTGKQ+ S+ I      P  I+L    +    + PK          ++G ++I G +I
Sbjct: 570  PLWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D   
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIA 671

Query: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
                 ++  + +  A  K +++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGQTMRQITEAIAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFV----RSWNHAFNVTFNNTERGLF 955
            YD T R S   I+QF YG DG+D   +E   Q V  +    R++   + +   N +  L 
Sbjct: 852  YDGTTRNSLGNIIQFIYGEDGMDAAHIE--KQAVETIGGSDRNFERRYRIDLLNPDYSLD 909

Query: 956  PYQIEEETDKILAPLMNRLIRYDNVGKLVPKEK-------DALIEY--------IDQNDA 1000
            P  +E  ++ I+  L  + +  +   +LV   K       D  + +        I QN A
Sbjct: 910  PSLLESGSE-IIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQN-A 967

Query: 1001 ERNFYL--------SLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENI 1052
            ++ F +        +++  + G  EL   +   RG   ++ E   +   +          
Sbjct: 968  QQTFRIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLA 1027

Query: 1053 RHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1112
               V Q  R+T  +    L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 SRRVIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP + A L  D   D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVT 1147

Query: 1171 FYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKDKI 1230
               +  Y  +     +  D   I   QL  ++ D     +    L  Q+  +  L+ D+ 
Sbjct: 1148 VASEIYYDPDPRSTAIPEDEEII---QLHFSLLDDETEKS----LAQQSPWLLRLELDRA 1200

Query: 1231 AINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR-------------- 1264
            A+N   +      +    KE  +ND+F             R + +R              
Sbjct: 1201 AMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEEDH 1258

Query: 1265 -------RSLPGIVVKGLPDISRAVINVRDDT------------KRELLVEGYGLRDVMS 1305
                     L  I ++G+ +I R V+   D              +  L  +G  L +VM+
Sbjct: 1259 MLKKIENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMT 1318

Query: 1306 TDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYK 1365
              GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1366 GEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGT 1425
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1426 GAFKVI 1431
            GAF V+
Sbjct: 1439 GAFDVM 1444

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1504 (34%), Positives = 767/1504 (50%), Gaps = 146/1504 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D+ +R    + +   CK +   + C                        T 
Sbjct: 121  LMRQALAIKDSKKR---FAAIWTLCKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTV 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G K V   +KD+  GD +E     PEL          L+  + LN+FK +  +D   
Sbjct: 175  RKDGLKLVGSWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTS 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222  LGFNEV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++   D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILS 661
             LW+GKQ+ S+ I PN    + +    +    + PK          ++G +II G +I+ 
Sbjct: 570  PLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 614

Query: 662  GVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPAD 721
            GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D     
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 722  DLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 781
               ++  + +  A  K  ++        L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 782  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 841
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 842  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 901
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 902  NTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLFPY 957
            NT R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     NTE  L P 
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDAAHIE--KQSLDTIGGSDAAFEKRYRIDLLNTEHILDPS 911

Query: 958  QIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQ--------------NDAERN 1003
             +E  ++ IL  L  +++  +   +LV   K     ++D                +A++ 
Sbjct: 912  LLESGSE-ILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQT 970

Query: 1004 FY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHS 1055
            F+        L++K  + G  +L  S+   RG  E++     +   +             
Sbjct: 971  FHIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRR 1030

Query: 1056 VDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V Q  R+T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1116 SMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRIEKTLLSDVAFYI 1173
            S  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIAS 1150

Query: 1174 QDVYQ------------------------------DNLSFMQVRIDLNTIDKLQLELTIE 1203
            +  Y                               D  S   +R++L+       +LT+ 
Sbjct: 1151 EIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1204 DIAVAITRAPK---LKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260
             +   I +  K     I + D    + +K+ I       K+    T A+E H       +
Sbjct: 1211 QVGERIKQTFKNDLFVIWSED----NDEKLIIRCRVVRPKSLDAETEAEEDH------ML 1260

Query: 1261 QQLRRS-LPGIVVKGLPDISRAVINVRD------------DTKRELLVEGYGLRDVMSTD 1307
            +++  + L  I ++G+ +I R V+   D            + +  L  +G  L +VM+  
Sbjct: 1261 KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP 1320

Query: 1308 GVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE 1367
            G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1321 GIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG 1380

Query: 1368 ILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGA 1427
            +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGA
Sbjct: 1381 LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA 1440

Query: 1428 FKVI 1431
            F V+
Sbjct: 1441 FDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1513 (34%), Positives = 768/1513 (50%), Gaps = 150/1513 (9%)

Query: 1    MKEVVVSATPKR-ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMG 59
            M E   S+ P R +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHD 119
                + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + +C +C  +LLD+H 
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  RRHFLSELRRPGV---DNLRRMGILSKVLDQCKKQRRC-LQCGALNXXXXXXXXXXXXXX 175
                 SEL R  +   D  RR    + V   CK +  C  +  + N              
Sbjct: 119  -----SELMRQAIKIKDPKRR---FNAVWSLCKAKMVCETEVPSDNDPAQYVSRGGCGNT 170

Query: 176  LKIIH-DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQL 234
               +  D     G     +KDK   D D+        ER V      ++  + LN+FK +
Sbjct: 171  QPSVRKDGLSLVGTW---KKDKGADDADQP-------ERRV------ISADEVLNVFKHI 214

Query: 235  KPEDCELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
             PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+ 
Sbjct: 215  SPEDSVRLGFNED--FARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILK 271

Query: 295  TSSLIKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFC 354
             +  ++     G   + + E    LQ  VA Y+++D    A  P A    G+  PI+   
Sbjct: 272  ANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIR 326

Query: 355  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQ 414
             RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNID 386

Query: 415  KLQQLLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLF 474
            +L QL+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLF 444

Query: 475  NRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 534
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 535  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPA 594
              V   +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP 
Sbjct: 505  CAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPT 562

Query: 595  PAIMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYV 652
            P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +
Sbjct: 563  PIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK----------DNGML 606

Query: 653  IIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSI 712
            II G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSI
Sbjct: 607  IIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSI 664

Query: 713  GISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSK 772
            GI D    +   ++  + +  A  K +E+        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNE 724

Query: 773  VREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN---- 948
            LED+   YD T R S   ++QF YG DG+D   +E   Q ++ + S + AF   F     
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERRFRIDLL 902

Query: 949  NTERGLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYID--QN-------- 998
            N    L P  +E  ++ I+  L  + +  +   +LV   +     ++D  QN        
Sbjct: 903  NPRHALDPSLLESGSE-IIGDLKLQALLDEEFKQLVEDREFLRKIFVDGEQNWPLPVNIR 961

Query: 999  ----DAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDE 1046
                +A++ F         L+++  + G  EL   +   RG  ++L E       +    
Sbjct: 962  RIIQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQQNAVTLFCCL 1021

Query: 1047 DVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTL 1106
                     V Q  R+   +    L    S++ R+ V PG  VG + AQSIGEP TQMTL
Sbjct: 1022 LRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRIEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D+  D+  A++++  IE T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHT 1141

Query: 1165 LLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTI 1224
             L  +     ++Y D      V  +   I +L   L  E+   +      L  Q+  +  
Sbjct: 1142 TLKSITV-ASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQS------LDYQSPWLLR 1194

Query: 1225 LDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQ---------------------- 1262
            L+ D+ A+N   +      +    KE  +ND+F    +                      
Sbjct: 1195 LELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAE 1252

Query: 1263 --------LRR----SLPGIVVKGLPDISRAVINVRDDT------------KRELLVEGY 1298
                    L+R     L  I ++G+ DI+R V+   D              +  L  +G 
Sbjct: 1253 AEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGV 1312

Query: 1299 GLRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLL 1358
             L +VM   GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL
Sbjct: 1313 NLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALL 1372

Query: 1359 GDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILG 1418
             DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LG
Sbjct: 1373 VDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLG 1432

Query: 1419 QTMSIGTGAFKVI 1431
            Q   IGTGAF V+
Sbjct: 1433 QVAPIGTGAFDVM 1445

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1501 (34%), Positives = 766/1501 (51%), Gaps = 140/1501 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D+ +R    + +   CK +   + C                        T 
Sbjct: 121  LMRQALAIKDSKKR---FAAIWTLCKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTI 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G K V   +KD+  GD DE     PEL          L+  + LN+FK +  +D   
Sbjct: 175  RKDGLKLVGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTS 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222  LGFNEV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++   D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILS 661
             LW+GKQ+ S+ I PN    + +    +    + PK          ++G +II G +I+ 
Sbjct: 570  PLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 614

Query: 662  GVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPAD 721
            GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D     
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 722  DLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 781
               ++  + +  A  K  ++        L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 782  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 841
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 842  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 901
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 902  NTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFN----VTFNNTERGLFPY 957
            NT R S   ++QF YG DG+D   +E   Q ++ +   + AF     V   NT+  L P 
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDAAHIE--KQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPS 911

Query: 958  QIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQ--------------NDAERN 1003
             +E  ++ IL  L  +++  +   +LV   K     ++D                +A++ 
Sbjct: 912  LLESGSE-ILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQT 970

Query: 1004 FY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHS 1055
            F+        L++K  + G  +L  ++   RG  E++     +   +             
Sbjct: 971  FHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRR 1030

Query: 1056 VDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V Q  R+T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1116 SMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRIEKTLLSDVAFYI 1173
            S  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTI-A 1149

Query: 1174 QDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPK--LKIQASDVTILDKD--- 1228
             ++Y D      V  +   I +L   L  E+   +  +     L+++     + DKD   
Sbjct: 1150 SEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1229 -------------------------KIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQL 1263
                                     K+ I       K+    T A+E H       ++++
Sbjct: 1210 GQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDH------MLKKI 1263

Query: 1264 RRS-LPGIVVKGLPDISRAVINVRD------------DTKRELLVEGYGLRDVMSTDGVV 1310
              + L  I ++G+ +I R V+   D            + +  L  +G  L +VM+  G+ 
Sbjct: 1264 ENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGID 1323

Query: 1311 GHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILG 1370
              +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  
Sbjct: 1324 PTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTS 1383

Query: 1371 ITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKV 1430
            +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V
Sbjct: 1384 VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDV 1443

Query: 1431 I 1431
            +
Sbjct: 1444 M 1444

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1515 (34%), Positives = 767/1515 (50%), Gaps = 154/1515 (10%)

Query: 1    MKEVVVSATPKR-ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMG 59
            M E   S+ P R +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHD 119
                + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + +C +C  +LLD+H 
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  RRHFLSELRRPGV---DNLRRMGILSKVLDQCKKQRRC-LQCGALNXXXXXXXXXXXXXX 175
                 SEL +  +   D  RR    + V   CK +  C  +  + N              
Sbjct: 119  -----SELMKQAIKIKDPKRR---FNAVWSLCKVKMVCETEVPSDNDPSQYVSRGGCGNT 170

Query: 176  LKIIH-DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQL 234
               +  D     G     +KDK   D D+        ER +      ++  + LN+FK +
Sbjct: 171  QPSVRKDGLSLVG---TWKKDKGADDADQP-------ERRI------ISADEVLNVFKHI 214

Query: 235  KPEDCELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
             PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+ 
Sbjct: 215  SPEDSVRLGFNED--FARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILK 271

Query: 295  TSSLIKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFC 354
             +  ++     G   + + E    LQ  VA Y+++D    A  P A    G+  PI+   
Sbjct: 272  ANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIR 326

Query: 355  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQ 414
             RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNID 386

Query: 415  KLQQLLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLF 474
            +L QL+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLF 444

Query: 475  NRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 534
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 535  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPA 594
              V   +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP 
Sbjct: 505  CAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDGV--IPT 562

Query: 595  PAIMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYV 652
            P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +
Sbjct: 563  PIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK----------DNGML 606

Query: 653  IIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSI 712
            II G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSI
Sbjct: 607  IIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFSI 664

Query: 713  GISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSK 772
            GI D    +   ++  D +  A  K +E+        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNE 724

Query: 773  VREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN---- 948
            LED+   YD T R S   ++QF YG DG+D   +E   Q ++ +   + AF   F     
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQAIDTIACSDAAFERRFKIDLL 902

Query: 949  NTERGLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------I 992
            N +  L P  +E  ++ I    +  L+  D   K + +++  L                I
Sbjct: 903  NPKHALDPSLLESGSEIIGDLKLQALL--DEEFKQLSEDRQFLRKIFVDGEQNWPLPVNI 960

Query: 993  EYIDQNDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDF 1044
              I QN A++ F         LS++  + G  EL   +   RG  ++L E       +  
Sbjct: 961  RRIIQN-AQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQEAQVNAVTLFC 1019

Query: 1045 DEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQM 1104
                       V Q  R+   +    L    +++ R+ V PG  VG + AQSIGEP TQM
Sbjct: 1020 CLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1105 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRIE 1162
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  ++  D+  A++++  IE
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAIE 1139

Query: 1163 KTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDV 1222
             T L  +     ++Y D      V  D   I +L   L  E+   +      L  Q+  +
Sbjct: 1140 HTTLKSITV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQS------LDYQSPWL 1192

Query: 1223 TILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQ-------------------- 1262
              L+ D+ A+N   +      +    KE  +ND+F    +                    
Sbjct: 1193 LRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLD 1250

Query: 1263 ----------LRR----SLPGIVVKGLPDISRAVINVRDDT------------KRELLVE 1296
                      L+R     L  I ++G+ DI+R V+   D              +  L  +
Sbjct: 1251 AEAEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETD 1310

Query: 1297 GYGLRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQ 1356
            G  L +VM   GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ 
Sbjct: 1311 GVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMA 1370

Query: 1357 LLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECII 1416
            LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++
Sbjct: 1371 LLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVL 1430

Query: 1417 LGQTMSIGTGAFKVI 1431
            LGQ   IGTGAF V+
Sbjct: 1431 LGQVAPIGTGAFDVM 1445

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1521 (34%), Positives = 768/1521 (50%), Gaps = 179/1521 (11%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + I  ++F   S  ++   S  +I   +  D E+    + GG  DP++G    + +
Sbjct: 8    SAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +A C GHFGHI+LA PVFH+G+     ++ + +C +C  +LLD+++      E
Sbjct: 67   CQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
              R  +   D  RR    + V   CK +   + C                     I  + 
Sbjct: 121  QMRQAIKIKDPKRR---FNAVWTLCKAK---MVCETEVPSPDDPTVFLSRGGCGHIQPSI 174

Query: 184  RWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCELLG 243
            R  G   V     W  D +   S  PE     KR    ++  + LN+FK + PED   LG
Sbjct: 175  RKDGLSLV---GTWKKDKNADDSDQPE-----KRI---ISAEEILNVFKHISPEDGWRLG 223

Query: 244  IDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKSGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224  FNED--FSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQKLE 280

Query: 304  EKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGR 363
              G   + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+GR
Sbjct: 281  INGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGR 335

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLING 423
             RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ NG
Sbjct: 336  IRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNG 395

Query: 424  PNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLHRL 483
            PN HPGA Y++++  D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH++
Sbjct: 396  PNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKM 453

Query: 484  SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 543
            S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 454  SMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 513

Query: 544  PKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPCYL 603
            P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP  L
Sbjct: 514  PQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWD--GIIPTPAILKPVPL 571

Query: 604  WTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGV 663
            W+GKQV S+ I PN    + +        F+ PK          ++G +II G +I+ GV
Sbjct: 572  WSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGMLIIDG-KIIFGV 616

Query: 664  MDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPADDL 723
            +DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D    +  
Sbjct: 617  VDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTIADEKT 675

Query: 724  KKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIN 783
             ++  + +  A  K +++        L  + G    ++ E  +   L++ R++ G     
Sbjct: 676  MREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEV 735

Query: 784  ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQ 843
             L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736  NLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPE 795

Query: 844  SKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 903
            SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T
Sbjct: 796  SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGT 855

Query: 904  VRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLFPYQI 959
             R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     N E  L P  +
Sbjct: 856  TRNSLGNVIQFIYGEDGMDAAHIE--KQSIDTIPGSDSAFERRYRIDLLNEEYALDPSLL 913

Query: 960  EEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYL--SLKSFMRGKAE 1017
            E  ++ I+     +L+  D   +LV   +     ++   D E N+ L  ++K  ++   +
Sbjct: 914  ESGSE-IIGDSKLQLLLNDEYKQLVDDRQILRRVFV---DGEHNWPLPVNIKRIIQNSQQ 969

Query: 1018 LLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITG--DSVREFLKIAI 1075
                          +D+  P    I   EDV   +R   ++L  + G  D ++E  + AI
Sbjct: 970  TFR-----------IDQTKPTDLTI---EDVISGVRKLQEKLLVVRGKSDILKEAQQNAI 1015

Query: 1076 S-----------------KYR------------------RARVEPGTAVGAIGAQSIGEP 1100
            +                 +YR                  R+ V PG  VG + AQSIGEP
Sbjct: 1016 TLFCCLLRSRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEP 1075

Query: 1101 GTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVK 1158
             TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A+ ++
Sbjct: 1076 ATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIR 1135

Query: 1159 GRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAIT-RAPK-LK 1216
              IE T L  V     ++Y D      V  D   I +L   L  E+   ++  ++P  L+
Sbjct: 1136 SAIEHTTLKSVTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLR 1194

Query: 1217 IQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR 1264
            ++     + DKD               +    KE  +ND+F             R + +R
Sbjct: 1195 LELDRAAMTDKD----------LTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIR 1244

Query: 1265 ----------------------RSLPGIVVKGLPDISRAVINVRDDT------------K 1290
                                    L  I ++G+ DI+R V+   D              +
Sbjct: 1245 DPKTLDADVEAEEDHMLKKIENSMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPE 1304

Query: 1291 RELLVEGYGLRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSV 1350
              L  +G  L +VM+  GV G +  TN  +++ +VLGIEA RA++  E+   +++ G  V
Sbjct: 1305 WVLETDGVNLSEVMTVSGVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYV 1364

Query: 1351 DPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEG 1410
            + RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   G
Sbjct: 1365 NYRHMALLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRG 1424

Query: 1411 VSECIILGQTMSIGTGAFKVI 1431
            VSE +ILGQ   IGTGAF V+
Sbjct: 1425 VSENVILGQMAPIGTGAFDVM 1445

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1506 (34%), Positives = 768/1506 (50%), Gaps = 150/1506 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D  +R G +  +   CK +   + C                        T 
Sbjct: 121  LMRQALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTV 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G K V   +KD+  GD DE     PEL          L+  + LN+FK +  +D   
Sbjct: 175  RKDGLKLVGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISAKDSSS 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222  LGFNEV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++   D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILS 661
             LW+GKQV S+ I PN    + +    +    + PK          ++G +II G +I+ 
Sbjct: 570  PLWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVF 614

Query: 662  GVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPAD 721
            GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D     
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 722  DLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 781
               ++  + +  A  K  ++        L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 782  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 841
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYS 793

Query: 842  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 901
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 902  NTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLFPY 957
            NT R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     N +  L P 
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDASHIE--KQSLDTIGGSDAAFEKRYRIDLLNPDHILDPS 911

Query: 958  QIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------IEYIDQNDAE 1001
             +E  ++ IL  L  +++  +   +LV K++  L                I  I QN A+
Sbjct: 912  LLESGSE-ILGDLKLQVLLDEEYKQLV-KDRSFLRHIFVDGEANWPLPVNIRRIIQN-AQ 968

Query: 1002 RNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIR 1053
            + F+        L++K  + G  +L  ++   RG  E++     +   +           
Sbjct: 969  QTFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRLAS 1028

Query: 1054 HSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1113
              V Q  ++T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1114 VASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRIEKTLLSDVAF 1171
            VAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTI 1148

Query: 1172 YIQDVYQ------------------------------DNLSFMQVRIDLNTIDKLQLELT 1201
              +  Y                               D  S   +R++L+       +LT
Sbjct: 1149 ASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1202 IEDIAVAITRAPK---LKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFF 1258
            +  +   I +  K     I + D    + +K+ I       K+    T A+E H      
Sbjct: 1209 MGQVGERIKQTFKNDLFVIWSED----NDEKLIIRCRVVRPKSLDAETEAEEDH------ 1258

Query: 1259 RMQQLRRS-LPGIVVKGLPDISRAVINVRD------------DTKRELLVEGYGLRDVMS 1305
             ++++  + L  I ++G+ +I R V+   D            + +  L  +G  L +VM+
Sbjct: 1259 MLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMT 1318

Query: 1306 TDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYK 1365
              G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1366 GEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGT 1425
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1426 GAFKVI 1431
            GAF V+
Sbjct: 1439 GAFDVM 1444

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1507 (34%), Positives = 763/1507 (50%), Gaps = 151/1507 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + I  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    + +
Sbjct: 8    SAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNFK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LLD+++      E
Sbjct: 67   CQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEYN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D  RR    + V   CK +   + C                        + 
Sbjct: 121  LMRQAIKIKDPKRR---FNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGCGNAQPSI 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G   V   +KDK   D D+     PE     KR    ++  + LN+FK + PED   
Sbjct: 175  RKDGLSLVGTWKKDKNAEDADQ-----PE-----KRI---ISAEEILNVFKHISPEDSWR 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFNED--FSRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQR 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLKGK+
Sbjct: 279  LEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP P I+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPTILKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
             LW+GKQ+ S+ I      P  I+L    +   ++ PK          ++G +II G +I
Sbjct: 570  PLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK----------DNGMLIIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI D   
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIA 671

Query: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
             +   ++  D +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
                 L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLF 955
            YD T R S   I+QF YG DG+D   +E   Q ++ +   + AF   +     N    L 
Sbjct: 852  YDGTTRNSLGNIIQFVYGEDGMDAAHIE--KQSIDTIPGSDLAFEKRYRIDLLNPNYALD 909

Query: 956  PYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------IEYIDQN- 998
            P  +E  T+ +    +  L+  D   K + +++  L                I  I QN 
Sbjct: 910  PNLLESGTEIVGDLKLQNLL--DEEYKQLVQDRHFLRKIFMDGEHNWPLPVNIRRIIQNA 967

Query: 999  ------DAERNFYLSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENI 1052
                  D+ +   LS++  ++G   L   +   RG  ++L E       +          
Sbjct: 968  QQTFRIDSTKPTDLSIQDVVQGVRGLQERLLVLRGKSQILQEAQENAITLFCCLLRSRLA 1027

Query: 1053 RHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1112
               V    R+T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP +   L      D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVP 1147

Query: 1171 FYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKDKI 1230
               +  Y  + S   +  D   I +L   L  E+   +      LK Q+  +  L+ D++
Sbjct: 1148 VASEIYYDPDPSSTVIEEDEEII-QLHFSLMDEETEAS------LKHQSPWLLRLELDRV 1200

Query: 1231 AINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR-------------- 1264
            A+    +      +    KE  +ND+F             R + +R              
Sbjct: 1201 AMT--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEED 1258

Query: 1265 --------RSLPGIVVKGLPDISRAVINVRDDT------------KRELLVEGYGLRDVM 1304
                      L  I ++G+ DI+R V+   D              +  L  +G  L +VM
Sbjct: 1259 HMLKKIENTMLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVM 1318

Query: 1305 STDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTY 1364
            S  GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1319 SVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTS 1378

Query: 1365 KGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIG 1424
            +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IG
Sbjct: 1379 QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIG 1438

Query: 1425 TGAFKVI 1431
            TG+F V+
Sbjct: 1439 TGSFDVM 1445

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1506 (34%), Positives = 764/1506 (50%), Gaps = 150/1506 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
            L R  +   D+ +R    + +   CK +   + C                        T 
Sbjct: 121  LMRQALAIKDSKKR---FAAIWTLCKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTV 174

Query: 184  RWAGKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
            R  G K V   +KD+  GD DE     PEL          L+  + LN+FK +  ED   
Sbjct: 175  RKDGLKLVGSWKKDRASGDADE-----PELRV--------LSTEEILNIFKHISVEDFTS 221

Query: 242  LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222  LGFNEV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
                G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++   D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
            ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 602  YLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
             LW+GKQV S  I      P  I+L    +    + PK          ++G +II G +I
Sbjct: 570  PLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D   
Sbjct: 613  VFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
                 ++  + +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLF 955
            YDNT R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     N E  L 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDAAHIE--KQSLDTIGGSDKAFEKRYRIDLLNPEHILD 909

Query: 956  PYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQ--------------NDAE 1001
            P  +E  ++ IL  L  +++  +   +LV   K     ++D                +A+
Sbjct: 910  PSLLESGSE-ILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIRRIIQNAQ 968

Query: 1002 RNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIR 1053
            + F+        L++K  + G  +L  ++   RG  E++     +   +           
Sbjct: 969  QTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLFRSRLAT 1028

Query: 1054 HSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1113
              + Q  R+T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1114 VASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRIEKTLLSDVAF 1171
            VAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTI 1148

Query: 1172 YIQDVYQ------------------------------DNLSFMQVRIDLNTIDKLQLELT 1201
              +  Y                               D  S   +R++L+       +LT
Sbjct: 1149 ASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1202 IEDIAVAITRAPK---LKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFF 1258
            +  +   I +  K     I + D    + +K+ I       K+    T A+E H      
Sbjct: 1209 MGQVGERIKQTFKNDLFVIWSED----NDEKLIIRCRVVRPKSLDAETEAEEDH------ 1258

Query: 1259 RMQQLRRS-LPGIVVKGLPDISRAVINVRD------------DTKRELLVEGYGLRDVMS 1305
             ++++  + L  I ++G+ +I R V+   D            + +  L  +G  L +VM+
Sbjct: 1259 MLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMT 1318

Query: 1306 TDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYK 1365
              G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1366 GEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGT 1425
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1426 GAFKVI 1431
            GAF V+
Sbjct: 1439 GAFDVM 1444

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1510 (34%), Positives = 781/1510 (51%), Gaps = 158/1510 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ + S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR--RHFL 124
            C TC   +  C GHFGHI LA PVFH+G+     ++ + IC +C  +LLD+++   R  +
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVM 126

Query: 125  SELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFR 184
            S       D+ +R    + +   CK +  C                      ++I    R
Sbjct: 127  SI-----KDSKKR---FNAIWTLCKTKTVC-----------ETDVPSEDDPTQLIS---R 164

Query: 185  WAGKKSVP--EKD--KWVGDW--DEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPED 238
                 + P   KD  K VG W  D+  +   E E+ V      LN  + LN+FK +   D
Sbjct: 165  GGCGNAQPTIRKDGLKLVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHD 218

Query: 239  CELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  SNTLGFNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLK 358
            +++    G   + + E    LQ  +A Y+++D    A  P A    G+  P++    RLK
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHIATYMDNDI---AGQPQALQKSGR--PVKSIRARLK 330

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQ 418
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 419  LLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQP 478
            L+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQP 448

Query: 479  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 538
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVP 508

Query: 539  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFD--IPAPA 596
              +++P+S +P +   QD + G   ++ +D F +   L  +L  + D    +D  IP PA
Sbjct: 509  LQIVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGIIPTPA 564

Query: 597  IMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVII 654
            I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +II
Sbjct: 565  IIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLII 608

Query: 655  RGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGI 714
             G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI
Sbjct: 609  DG-QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGI 666

Query: 715  SDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVR 774
             D        K+  + +  A  K +E+        L  + G    ++ E  +   L++ R
Sbjct: 667  GDTIADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTF------- 947
            D+   YD+T R S   ++QF YG DG+D   +E   Q ++ +   + AF   +       
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE--KQSIDTIGGSDAAFEKRYRIDLMSP 904

Query: 948  -NNTERGLFPYQIEEETDKILAPLMN----------RLIRYDNVGKLVPKEKDALIEYID 996
             +  +  L    +E   D  L  +++          R +R   +           I  I 
Sbjct: 905  NHALDPSLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRII 964

Query: 997  QNDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDV 1048
            QN A++ F         L++   +R  A L  ++   RG  ++++E   +   + F   V
Sbjct: 965  QN-AQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEEAQNDAITL-FCCLV 1022

Query: 1049 PENIR-HSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLK 1107
               +    V Q  R+T  + +  L    S++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1023 RSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  +   D+  A++++  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTT 1142

Query: 1166 LSDVA-----FYIQD-----------VYQDNLSFMQVRIDLNTIDK----LQLEL---TI 1202
            L  V      +Y  D           + Q + S M    + N  ++    L+LEL    +
Sbjct: 1143 LKSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAM 1202

Query: 1203 EDIAVAITRAPKLKIQAS---DVTIL----DKDKIAINVFPEGYKAKSISTSAKEPHEND 1255
             D  + + +  + KI+ +   D++++    + DK+ I       K+    T A+E H   
Sbjct: 1203 NDKDLTMVQVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEAEEDH--- 1258

Query: 1256 VFFRMQQLRRS-LPGIVVKGLPDISRAVINVRDDTKRE-------------LLVEGYGLR 1301
                ++++  + L  I ++G+ DI R V+ ++ D K               L  +G  L 
Sbjct: 1259 ---MLKKIENTMLESITLRGVEDIERVVM-MKYDRKMPSETGEYQKVPEWVLETDGVNLM 1314

Query: 1302 DVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDV 1361
            +VM+  GV G +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1362 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTM 1421
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1422 SIGTGAFKVI 1431
             IGTGAF V+
Sbjct: 1435 PIGTGAFDVM 1444

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1510 (33%), Positives = 768/1510 (50%), Gaps = 157/1510 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + I  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    + +
Sbjct: 8    SAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNYK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LLD+H+ +   + 
Sbjct: 67   CQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAI 126

Query: 127  LRRPGVDNLRRMGILSKVLDQCKKQ--------RRCLQCGALNXXXXXXXXXXXXXXLKI 178
              +        +  LSKV   C+ +        +   + G  N                I
Sbjct: 127  KIKDPKRRFNAVWTLSKVKMICETEVPSEDDPTKYISRGGCGNTQP------------SI 174

Query: 179  IHDTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPED 238
              D     G     +KDK   D D+     PE     KR    ++  + LN+FK + PED
Sbjct: 175  RKDGLSLVG---TWKKDKNADDADQ-----PE-----KRI---ISAEEVLNVFKHICPED 218

Query: 239  CELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  
Sbjct: 219  SWRLGFNED--FARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANIN 275

Query: 299  IKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLK 358
            ++     G   + + E    LQ  VA Y+++D    A  P A    G+  PI+    RLK
Sbjct: 276  VQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRARLK 330

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQ 418
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 419  LLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQP 478
            L+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQP 448

Query: 479  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 538
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 539  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIM 598
              +++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP P I+
Sbjct: 509  LQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTIL 566

Query: 599  KPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRG 656
            KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +I+ G
Sbjct: 567  KPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIVDG 610

Query: 657  SEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISD 716
             +I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI D
Sbjct: 611  -QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGD 668

Query: 717  VTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 776
                    ++  + +  A  K + +        L  + G    ++ E  +   L++ R++
Sbjct: 669  TIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDK 728

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFV----RSWNHAFNVTFNNTER 952
               YD T R S   I+QF YG DG+D   +E   Q ++ +    R++   + +   N + 
Sbjct: 849  MVHYDGTTRNSLGNIIQFIYGEDGMDAAHIE--KQSIDTIAGSDRAFERRYRIDLLNPDN 906

Query: 953  GLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYID--QN------------ 998
             L P  +E  ++ ++  L  +    +   +LV   +     ++D  QN            
Sbjct: 907  ALDPSLLESGSE-MMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQ 965

Query: 999  DAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPE 1050
            +A++ F         L++   + G  +L   +   RG  E+L E       +        
Sbjct: 966  NAQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQEAQTNAVTLFCCLLRSR 1025

Query: 1051 NIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFH 1110
                 V +  ++T  + +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFH
Sbjct: 1026 LASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1111 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRIEKTLLSD 1168
            FAGVAS  VT GVPR+KEI+N +K + TP +   L ++   D+  A++++  IE T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKS 1145

Query: 1169 VAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKD 1228
            V     ++Y D      V  D   I +L   L  E+   ++        Q+  +  L+ D
Sbjct: 1146 VTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDH------QSPWLLRLELD 1198

Query: 1229 KIAINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR------------ 1264
            + A+N   +      +    KE  +ND+F             R + +R            
Sbjct: 1199 RAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAE 1256

Query: 1265 ----------RSLPGIVVKGLPDISRAVINVRDDTKRE-------------LLVEGYGLR 1301
                        L  I ++G+ DI+R V+ ++ D K               L  +G  L 
Sbjct: 1257 EDHMLKKIENTMLESITLRGVEDITRVVM-MKYDRKTPSATGEYQKVPEWVLETDGVNLA 1315

Query: 1302 DVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDV 1361
            +VMS  GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1316 EVMSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV 1375

Query: 1362 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTM 1421
            MT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1376 MTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMA 1435

Query: 1422 SIGTGAFKVI 1431
             IGTGAF V+
Sbjct: 1436 PIGTGAFDVM 1445

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1502 (34%), Positives = 761/1502 (50%), Gaps = 142/1502 (9%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  +I A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------E 120

Query: 127  LRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFRWA 186
              R  +         + V   CK +   + C                        T R  
Sbjct: 121  QMRQAIQIKDPKKRFNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTIRKD 177

Query: 187  GKKSVP--EKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCELLGI 244
            G K V   +KDK  GD DE     PE     +R    L+  + LN+FK + PED   LG 
Sbjct: 178  GLKLVGSWKKDKSTGDADE-----PE-----QRV---LSTEEILNIFKHISPEDSYRLGF 224

Query: 245  DSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKSGLE 304
            +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++   
Sbjct: 225  NE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEH 281

Query: 305  KGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRF 364
             G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+GR 
Sbjct: 282  NGAPHHAVEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEGRI 336

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLINGP 424
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL+ NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGP 396

Query: 425  NVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLHRLS 484
            N HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 485  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 544
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 545  KSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPCYLW 604
            +S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP  LW
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGV--IPTPAIIKPKPLW 572

Query: 605  TGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSG 662
            +GKQ+ S+ I      P  I+L    +    + PK          ++G ++I G EI+ G
Sbjct: 573  SGKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-EIIFG 615

Query: 663  VMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPADD 722
            V+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D      
Sbjct: 616  VVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQ 674

Query: 723  LKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 782
              ++  + +  A  K + +        L  + G    ++ E  +   L++ R+  G +  
Sbjct: 675  TMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAE 734

Query: 783  NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 842
              L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735  MNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSP 794

Query: 843  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 902
            +SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795  ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 903  TVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NTERGLFPYQ 958
            T R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     NT   L P  
Sbjct: 855  TTRNSLGNVIQFIYGEDGMDAGHIE--KQSLDTMGGSDQAFERRYRIDLLNTSNSLEPSL 912

Query: 959  IEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------IEYIDQNDAER 1002
            +E  ++ I+  L  ++   +   +LV K++  L                I  I QN A++
Sbjct: 913  LESGSE-IIGDLKVQMALDEEYKQLV-KDRRFLRTIFSDGESSWPLPVNIRRIIQN-AQQ 969

Query: 1003 NFYLS-LKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDV-------PENIRH 1054
             F +   K       E++ SVR  +    +L       K    D                
Sbjct: 970  TFRIDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKAQDDAVTLFCCLLRSRLATR 1029

Query: 1055 SVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGV 1114
             V Q  R+T ++    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1115 ASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLLSDVAFY 1172
            AS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  IE T L  V   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTV- 1148

Query: 1173 IQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPK--LKIQASDVTILDKD-- 1228
              ++Y D      V  + + I +L   L  ++    + +     L+++     + DKD  
Sbjct: 1149 ASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1229 --------------------------KIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQ 1262
                                      K+ I       KA    T A+E H       +++
Sbjct: 1209 MGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDH------MLKK 1262

Query: 1263 LRRS-LPGIVVKGLPDISRAVI-----NVRDDTKRE-------LLVEGYGLRDVMSTDGV 1309
            +  + L  I ++G+  I R V+      V ++T          L  +G  L +VM+  GV
Sbjct: 1263 IENTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGV 1322

Query: 1310 VGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEIL 1369
               +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLT 1382

Query: 1370 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFK 1429
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF 
Sbjct: 1383 SVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFD 1442

Query: 1430 VI 1431
            V+
Sbjct: 1443 VM 1444

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1512 (33%), Positives = 771/1512 (50%), Gaps = 150/1512 (9%)

Query: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60
            + E   SA  + +  ++F   S  ++   S  +I   +  D    RA + GG  DP++G 
Sbjct: 2    VSEQYSSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGS 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120
               +L+C TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+H+ 
Sbjct: 61   IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE 120

Query: 121  RHFLSELRRPGV--DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKI 178
                 ++R+     D+ +R    + V   CK +  C                       +
Sbjct: 121  -----QMRQAMAIKDSKKR---FNAVWTLCKTKMIC-----------ETDVPSDDDPTTL 161

Query: 179  IHDTFRWAGKKSVPEKD--KWVGDW--DEVLSHNPELERYVKRCMDDLNPLKTLNLFKQL 234
            I        + S+  KD  K VG W  ++  S   E E+ V      L+  + LN+FK +
Sbjct: 162  ISRGGCGNAQPSI-RKDGLKLVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHI 214

Query: 235  KPEDCELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
             PED   +G   S +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+ 
Sbjct: 215  SPEDSTRMGF--SEEFARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILK 271

Query: 295  TSSLIKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFC 354
             +  +++    G   + + E    LQ  VA Y+++D    A  P A    G+  P++   
Sbjct: 272  ANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIR 326

Query: 355  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQ 414
             RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNID 386

Query: 415  KLQQLLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLF 474
            +L QL+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLF 444

Query: 475  NRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 534
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 535  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPA 594
              V   +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP 
Sbjct: 505  CAVPLQIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPDWDGV--IPT 562

Query: 595  PAIMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYV 652
            PA++KP  LWTGKQV S  I      P  I+L    +    + PK          ++G +
Sbjct: 563  PAVLKPKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGML 606

Query: 653  IIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSI 712
            +I G +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS 
Sbjct: 607  VIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFST 664

Query: 713  GISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSK 772
            GI D        K+  + +  A  K +++        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADGQTIKEITETIAEAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN---- 948
            LED+   YD T R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIE--KQTLDTIGGSDVAFERRYRIDLL 902

Query: 949  NTERGLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQ----------- 997
            N E  L P  +E  ++ I   L  + +  +   +LV   +     ++D            
Sbjct: 903  NPEHSLDPTLLESGSE-IAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIR 961

Query: 998  ---NDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDE 1046
                +A++ F         L+++  + G  EL   +   RG  E++++   +   +    
Sbjct: 962  RIIQNAQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLFCCL 1021

Query: 1047 DVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTL 1106
                     + Q  ++T  + +  L    S++ R+ V PG  VG + AQSIGEP TQMTL
Sbjct: 1022 VRSRLATRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN--DNDERAARVVKGRIEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +   +D+  A+ ++  IE T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHT 1141

Query: 1165 LLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTI 1224
             L  +     ++Y D      V  + + I +L   L  ++   ++ R      Q+  +  
Sbjct: 1142 TLKSITV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDR------QSPWLLR 1194

Query: 1225 LDKDKIAINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR-------- 1264
            L+ D+ A+N   +      +    KE  +ND+F             R + +R        
Sbjct: 1195 LELDRAAMN--DKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET 1252

Query: 1265 -------------RSLPGIVVKGLPDISRAVINVRD----------DTKRELLVE--GYG 1299
                           L  I ++G+ +I R V+   D          +   E ++E  G  
Sbjct: 1253 EAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVN 1312

Query: 1300 LRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLG 1359
            L +VM+  G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LSEVMTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLV 1372

Query: 1360 DVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQ 1419
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ
Sbjct: 1373 DVMTTQGGLTSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQ 1432

Query: 1420 TMSIGTGAFKVI 1431
               IGTGAF V+
Sbjct: 1433 MAPIGTGAFDVM 1444

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1507 (34%), Positives = 777/1507 (51%), Gaps = 153/1507 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR--RHFL 124
            C TC   ++ C GHFGHI LA PVFHVG+     ++ + +C +C  +LLD+++   R  +
Sbjct: 67   CQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVM 126

Query: 125  SELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFR 184
            + ++ P     +R      +   CK +  C                      K++    R
Sbjct: 127  A-IKDPK----KRFNATWAL---CKTKMVC-----------ETDVPSENDPTKLVS---R 164

Query: 185  WAGKKSVP--EKD--KWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240
                 + P   KD  K VG W        E E   +R    L+  + LN+FK +  ED  
Sbjct: 165  GGCGNTQPTVRKDGLKLVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFI 219

Query: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 220  RLGFNE--EFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 276

Query: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360
            +    G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK
Sbjct: 277  TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGK 331

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL+
Sbjct: 332  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 391

Query: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++++ D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSL
Sbjct: 392  RNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSL 449

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 450  HKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 509

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600
            +++P+S +P +   QD + G  +++ +D+F +   +  +L  + D +    IP PAI+KP
Sbjct: 510  IVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IPTPAILKP 567

Query: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660
              LWTGKQ+ S+ I PN    + +    +    + PK          ++G +II G +I+
Sbjct: 568  KPLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QII 612

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720
             GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D    
Sbjct: 613  FGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIAD 671

Query: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
                K+  + +  A  K +E+        L  + G    ++ E  +   L++ R++ G +
Sbjct: 672  GATIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 731

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
                L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 732  AEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDY 791

Query: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 792  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 851

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFN----VTFNNTERGLFP 956
            DNT R S   ++QF YG DG+D   +E   Q ++ +   + AF     +   N +  L P
Sbjct: 852  DNTTRNSLGNVIQFIYGEDGIDASYIE--KQSLDTIGGSDAAFEKKYRIDLMNVQNSLDP 909

Query: 957  YQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------IEYIDQNDA 1000
              +E  ++ I   L  + +  +   +LV K++  L                I  I QN A
Sbjct: 910  TLLESGSE-ITGDLKLQTLLDEEYKQLV-KDRAFLRNVFVDGESNWPLPVNIRRIIQN-A 966

Query: 1001 ERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVPENI 1052
            ++ F         L+++  +    EL + +   RG  E+++    +   +          
Sbjct: 967  QQTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEIIERAQTDAVTLFCCLVRSRLA 1026

Query: 1053 RHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1112
               V +  R+T ++    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1027 TRRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1086

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A++++  IE T L  V 
Sbjct: 1087 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVT 1146

Query: 1171 FYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKDKI 1230
                ++Y D      V  +   I +L   L  +++  ++ +      Q+  +  L+ D+ 
Sbjct: 1147 V-ASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQ------QSPWLLRLELDRA 1199

Query: 1231 AINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR-------------- 1264
            A+N   +      +    KE  +ND+F             R + +R              
Sbjct: 1200 AMN--DKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEEDH 1257

Query: 1265 -------RSLPGIVVKGLPDISRAVINVRDDTK-----------RELLVE--GYGLRDVM 1304
                     L  I ++G+ +I R V+ ++ D K            E ++E  G  L +VM
Sbjct: 1258 MLKKIENTMLENITLRGVENIERVVM-MKYDRKVPNESGEYQKVPEWVLESDGVNLAEVM 1316

Query: 1305 STDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTY 1364
               GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1317 QVPGVDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTT 1376

Query: 1365 KGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIG 1424
            +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IG
Sbjct: 1377 QGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIG 1436

Query: 1425 TGAFKVI 1431
            TGAF V+
Sbjct: 1437 TGAFDVM 1443

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
            YDL140C
          Length = 1726

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1508 (33%), Positives = 769/1508 (50%), Gaps = 154/1508 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + I  ++F   S  +I A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PVFH+G+     ++ + IC +C  +LLD+H+ +  + +
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQ--MRQ 124

Query: 127  LRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFRWA 186
            + +   D+ +R    + +   CK +  C                     +   HD  +  
Sbjct: 125  ILKIK-DSKKR---FNAIWSLCKTKMIC------------------DTDVPSEHDPTQLV 162

Query: 187  GK------KSVPEKD--KWVGDW--DEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKP 236
             +      +    KD  K VG W  ++  S   E E+ +      L+  + LN+FK + P
Sbjct: 163  SRGGCGNAQPTVRKDGLKLVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISP 216

Query: 237  EDCELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
            ED   +G +   +  RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSIAMGFNE--EFSRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKAN 273

Query: 297  SLIKSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQR 356
              +++    G   + + E    LQ  VA Y+++D    A  P A    G+  P++    R
Sbjct: 274  ISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QQLLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNR 476
              L+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNR
Sbjct: 389  THLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPA 596
            V   +++ +S +P +   QD + G   ++ +D+F +   +  LL  + D +    IP PA
Sbjct: 507  VPLQIVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPTPA 564

Query: 597  IMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVII 654
            I+KP  LW+GKQ+ S+ I      P  I+L    +   F+ PK          ++G +II
Sbjct: 565  ILKPKPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLII 608

Query: 655  RGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGI 714
             G +I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI
Sbjct: 609  DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGI 666

Query: 715  SDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVR 774
             D     +  ++    +  A  K +E+        L  + G    ++ E  +   L++ R
Sbjct: 667  GDTIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFN----NT 950
            D+   YD+T R S   ++QF YG DG+D   +E   Q ++ +   + AF   +     NT
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE--KQSIDTIGGSDAAFEKRYRIDLLNT 904

Query: 951  ERGLFPYQIEEETD--------KILAPLMNRLIRYDNVGKLVPKEKD------ALIEYID 996
            E  L P  +E   +         +L     +L++     + V  + +        I+ I 
Sbjct: 905  ENSLNPSLLESGAEISGNLKLQNLLDVEYKQLVKDRTFLRTVFVDGEPNWPLPVNIKRIV 964

Query: 997  QNDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDV 1048
            QN A++ F         L++   + G  +L   +   R   E++ +   +   +      
Sbjct: 965  QN-AQQTFKVDHSKPSDLTIPDIVHGVQDLQEKLLVLRDKSEIMQKAQSDATTLFCCLIR 1023

Query: 1049 PENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKT 1108
                   V Q  ++   S +  L    +++ R+ V PG  VG + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRVLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL--VNDNDERAARVVKGRIEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP + A L      D+  A++++  IE T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTL 1143

Query: 1167 SDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPK--LKIQASDVTI 1224
              V     ++Y D      V  +   I +L   L  E+   ++ +     L+++     +
Sbjct: 1144 KSVTV-ASEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAM 1202

Query: 1225 LDKD----------------------------KIAINVFPEGYKAKSISTSAKEPHENDV 1256
             DKD                            K+ I       KA    T A+E H    
Sbjct: 1203 NDKDLTMGQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDH---- 1258

Query: 1257 FFRMQQLRRS-LPGIVVKGLPDISRAVINVRD----------DTKRELLVE--GYGLRDV 1303
               ++++  + L  I ++G+ +I R V+   D          +   E ++E  G  L +V
Sbjct: 1259 --MLKKIENTMLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEV 1316

Query: 1304 MSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMT 1363
            M+  GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGVDASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1364 YKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSI 1423
              G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   I
Sbjct: 1377 TNGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPI 1436

Query: 1424 GTGAFKVI 1431
            GTG+F V+
Sbjct: 1437 GTGSFDVM 1444

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1510 (33%), Positives = 772/1510 (51%), Gaps = 158/1510 (10%)

Query: 7    SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
            SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8    SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67   CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
            C TC   +  C GHFGHI LA PV HVG+     ++ + +C +C  +LLD+H+      E
Sbjct: 67   CQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------E 120

Query: 127  LRRPGV---DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTF 183
              R  +   D+ +R    + V + CK +  C                      ++I    
Sbjct: 121  QMRQAIAIKDSKKR---FNAVWNLCKTKMIC-----------DTDVPSDDDPTQLISRGG 166

Query: 184  RWAGKKSVPEKD--KWVGDWDEVLSHNP--ELERYVKRCMDDLNPLKTLNLFKQLKPEDC 239
                + +V  KD  K VG W +  + N   E E+ V      L+  + LN+FK + PED 
Sbjct: 167  CGNAQPTV-RKDGLKLVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDS 219

Query: 240  ELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
              LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 220  TRLGFNE--EFARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISL 276

Query: 300  KSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKG 359
            ++    G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKG
Sbjct: 277  ETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 420  LINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPS 479
            + NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMK 599
             +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+K
Sbjct: 510  QIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIK 567

Query: 600  PCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGS 657
            P  LW+GKQV S+ I      P  I+L    +    + PK          ++G +++ G 
Sbjct: 568  PKPLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVDG- 610

Query: 658  EILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDV 717
            +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D 
Sbjct: 611  QIIFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDT 669

Query: 718  TPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEV 777
                   K+  + +  A  K +++        L  + G    ++ E  +   L++ R++ 
Sbjct: 670  IADGSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKA 729

Query: 778  GDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPK 837
            G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K
Sbjct: 730  GRLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSK 789

Query: 838  NSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLS 897
            +  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+ 
Sbjct: 790  DDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIM 849

Query: 898  CQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFN----VTFNNTERG 953
              YD T R S   ++QF YG DG+D   +E   Q ++ +   + AF     +   N +  
Sbjct: 850  VHYDGTARNSLGNVIQFIYGEDGMDAAHIE--KQSLDTIGGSDAAFEKRYRIDLMNPKNA 907

Query: 954  LFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDAL----------------IEYIDQ 997
            L P  +E  ++      +  L+  D   K + K++  L                I  I Q
Sbjct: 908  LDPSLLESGSEITGDVKLQSLL--DEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQ 965

Query: 998  NDAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEPGPEFKNIDFDEDVP 1049
            N A++ F         L+++  + G  +L   +   RG  E++ +   +   + F   V 
Sbjct: 966  N-AQQTFRIDHSKPSDLTIRDIIFGLKDLEERLLVLRGKSEIIQKAQDDAITL-FCCLVR 1023

Query: 1050 ENIR-HSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKT 1108
              +    + Q  R+T  +    L    +++ R+ V PG  VG + AQSIGEP TQMTL T
Sbjct: 1024 SRLSTRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRIEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A+ ++  IE T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTL 1143

Query: 1167 SDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILD 1226
              +     ++Y D      V  + + I +L   L  ++   ++ R      Q+  +  L+
Sbjct: 1144 KSITV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDR------QSPWLLRLE 1196

Query: 1227 KDKIAINVFPEGYKAKSISTSAKEPHENDVF------------FRMQQLR---------- 1264
             D+ A+N   +      +    KE   ND+F             R + +R          
Sbjct: 1197 LDRAAMN--DKDLTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEA 1254

Query: 1265 -----------RSLPGIVVKGLPDISRAVINVRDDT------------KRELLVEGYGLR 1301
                         L  I ++G+ +I R V+   D              +  L  +G  L 
Sbjct: 1255 EEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLS 1314

Query: 1302 DVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDV 1361
            +VM+  GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGVDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1362 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTM 1421
            MT +G +  ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ  
Sbjct: 1375 MTTQGALTSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMA 1434

Query: 1422 SIGTGAFKVI 1431
             IGTGAF V+
Sbjct: 1435 PIGTGAFDVM 1444

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1163 (35%), Positives = 612/1163 (52%), Gaps = 117/1163 (10%)

Query: 348  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 407
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408  VTRYNRQKLQQLLINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLE 467
            VT YN  +L QL+ NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGN 587
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   +  +L  + D +
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPDWD 239

Query: 588  LQFDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEM 645
                IP PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK        
Sbjct: 240  GV--IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK-------- 283

Query: 646  SQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYL 705
              ++G ++I G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L
Sbjct: 284  --DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNFWL 339

Query: 706  GNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAK 765
             + GFS GI D     +  K+  + +  A  K +E+        L  + G    ++ E  
Sbjct: 340  LHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDN 399

Query: 766  IGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPD 825
            +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  
Sbjct: 400  VVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAF 459

Query: 826  GFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYM 885
            GF DR+LPHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+
Sbjct: 460  GFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYI 519

Query: 886  SRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNV 945
             RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E   Q ++ +   N AF  
Sbjct: 520  QRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIE--KQSIDTIGGSNQAFEK 577

Query: 946  TFNNTERGLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIE--------YID- 996
             +      +     E   D  L    + +I    +  ++ +E   L+         +ID 
Sbjct: 578  RYR-----IDLMSPEHSLDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDG 632

Query: 997  -QN------------DAERNFY--------LSLKSFMRGKAELLASVRKQRGMKELLDEP 1035
             QN            +A++ F         L+++  + G  EL + +   RG  ++++E 
Sbjct: 633  EQNWPLPVNIRRIVQNAQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEA 692

Query: 1036 GPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQ 1095
              +   +             V +  R+T  +    L    S++ R+ V PG  VG + AQ
Sbjct: 693  QNDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQ 752

Query: 1096 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERA 1153
            SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  +   D+  
Sbjct: 753  SIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEK 812

Query: 1154 ARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAP 1213
            A+ ++  IE T L  V     ++Y D      V  D   I +L   L  ++   A     
Sbjct: 813  AKFIRSAIEHTTLKSVTV-ASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKA----- 866

Query: 1214 KLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVF------------FRMQ 1261
             L  Q+  +  L+ D+ A+N   +      +    KE  +ND+F             R +
Sbjct: 867  -LDNQSPWLLRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNADKLIIRCR 923

Query: 1262 QLR---------------------RSLPGIVVKGLPDISRAVINVRD----------DTK 1290
             +R                       L  I ++G+ DI R V+   D          +  
Sbjct: 924  VVRPKSLDAETEAEEDHMLKKIENTMLESITLRGVEDIERVVMMKYDRKMPSENGAYEKV 983

Query: 1291 RELLVE--GYGLRDVMSTDGVVGHKTATNHILEVFSVLGIEAARASIIGEIDYTMSNHGM 1348
             E ++E  G  L +VM+  GV   +  TN  +++  VLGIEA RA++  E+   +++ G 
Sbjct: 984  PEWVLETDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGS 1043

Query: 1349 SVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKRDAV 1408
             V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D  
Sbjct: 1044 YVNYRHMALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDC 1103

Query: 1409 EGVSECIILGQTMSIGTGAFKVI 1431
             GVSE +ILGQ   +GTGAF V+
Sbjct: 1104 RGVSENVILGQMAPVGTGAFDVM 1126

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/312 (84%), Positives = 289/312 (92%)

Query: 1145 LVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIED 1204
            LVN NDERAARVVKGRIEKTLLSDVAFYIQDVY+DNLSF+QV+IDL TI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1205 IAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQLR 1264
            IAVAITRA KLKI A DV+I+ KDK+ INV+PEG K KSISTSAKEP EN++F+R+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1265 RSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHILEVFS 1324
            RSLPGIVVKGLPDI+RAVIN++ D  RELLVEGYGLRDVM+TDGVVGHKT TNHILEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1325 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1384
            VLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1385 QLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQDLRPK 1444
            QLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTGAFKV+KGT+L  ++L+PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1445 PTLFESLSKETA 1456
             TLFESL   TA
Sbjct: 304  ATLFESLCGNTA 315

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  565 bits (1455), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 353/931 (37%), Positives = 512/931 (54%), Gaps = 63/931 (6%)

Query: 7   SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
           SA  + +  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +L+
Sbjct: 8   SAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLK 66

Query: 67  CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSE 126
           C TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LLDDH+      +
Sbjct: 67  CQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE-----Q 121

Query: 127 LRRPGV--DNLRRMGILSKVLDQCKKQRRCLQCGALNXXXXXXXXXXXXXXLKIIHDTFR 184
           +R+     D+ +R    + +   CK +  C                      K+I     
Sbjct: 122 MRQACKIKDSKKR---FNAIWTLCKTKMIC-----------ESDVPSEEDPTKLISRGGC 167

Query: 185 WAGKKSVPEKD--KWVGDWD-EVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCEL 241
              + +V  KD  K VG W  E  + +PE        M+++     LN+FK +  ED   
Sbjct: 168 GNAQPTV-RKDGLKLVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNR 221

Query: 242 LGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKS 301
           LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +++
Sbjct: 222 LGFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302 GLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  VA Y+++D    A  P A    G+  P++    RLKGK+
Sbjct: 279 LEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKE 333

Query: 362 GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLI 421
           GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVR 393

Query: 422 NGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSLH 481
           NGPN HPGA Y+++ + D R +LRY  R    + L+ G  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542 LTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKPC 601
           ++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    IP PAI+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 602 YLWTGKQVFSLLIKPNKKSPVVINLDA--KNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659
            LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +II G +I
Sbjct: 570 PLWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-KI 612

Query: 660 LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719
           + GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIA 671

Query: 720 ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
                ++  + +  A  K +++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 780 VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
           +    L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 LAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 840 KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 900 YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNA 930
           YD+T R S   ++QF YG DG+D   +E  A
Sbjct: 852 YDSTTRNSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  161 bits (407), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 126/400 (31%), Positives = 195/400 (48%), Gaps = 43/400 (10%)

Query: 1061 RITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1120
            R+T  +    L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1121 LGVPRIKEIINASKVISTPIINAVLVN---------DNDERAARVVKG----RIEKTLLS 1167
             GVPR+      +K I + I +  L +         D D R+  + +     ++  +LL 
Sbjct: 1096 SGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLHFSLLD 1155

Query: 1168 DVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPK---LKIQASDVTI 1224
            D      +   D  S   +R++L+       +LT+  +   I    K     I + D   
Sbjct: 1156 DET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSED--- 1208

Query: 1225 LDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRMQQLRRS-LPGIVVKGLPDISRAVI 1283
             + +K+ I       K+  I T A+E H       ++++  + L  I ++G+ +I R V+
Sbjct: 1209 -NAEKLIIRCRVVRPKSMDIETEAEEDH------MLKKIENTMLENITLRGVENIERVVM 1261

Query: 1284 NVRDDT------------KRELLVEGYGLRDVMSTDGVVGHKTATNHILEVFSVLGIEAA 1331
               D              +  L  +G  L +VM+  GV   +  TN  +++  VLGIEA 
Sbjct: 1262 MKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEAG 1321

Query: 1332 RASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEK 1391
            RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+
Sbjct: 1322 RAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSFEE 1381

Query: 1392 TTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1382 TVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  452 bits (1162), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 323/984 (32%), Positives = 492/984 (50%), Gaps = 124/984 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+     
Sbjct: 340  SKKIVRADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEE 396

Query: 301  ---------SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
                     S  +K +  N +M  +  +Q  V  +I+S            S GGKV PI 
Sbjct: 397  MSKLQKDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDS-------TKAQGSAGGKV-PIP 448

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 449  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 508

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA+ +  +D    +   +    R  LA  L           + 
Sbjct: 509  NIAELRQAVINGPDKWPGASQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLN 568

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 569  KKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 628

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 629  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQ 688

Query: 579  LLSMM---SDG----NLQFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKN 630
             +       DG    N    +P PA+MKP  LWTGKQ+ + +L+         INL +KN
Sbjct: 689  YIYGCIRPEDGHATRNKLVTVP-PAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKN 747

Query: 631  KVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
            K+    K+       ++ND  VI +  E+L G++DKS  G   K+ + +++   YGP  +
Sbjct: 748  KI----KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVS 800

Query: 691  ANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMV----EFAYAKCDELID--- 743
            A  ++ + +L   Y+    F+ G+ D+   DD  K + D++    +   A   E+ +   
Sbjct: 801  AKVLSVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDP 860

Query: 744  --SYNKGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNLNAP 791
              S N  +L     E     N+   L+A     ++ +  +V   C+      +  N N+ 
Sbjct: 861  DVSANDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSM 919

Query: 792  LIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 920  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGR 979

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   +
Sbjct: 980  FYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTL 1039

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLM 971
            +QF YGGD +D             V   +H     F                        
Sbjct: 1040 IQFLYGGDAVD-------------VTQESHMTEFKFC----------------------- 1063

Query: 972  NRLIRYDNVGKLVPK-EKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGMKE 1030
                  DN   L+ K    ALIE++D   A +    +LK+  R K E +    ++     
Sbjct: 1064 -----ADNYDALLKKYNPSALIEHLDVESALKYSKKALKN--RKKNERVPHFAQKVKYDP 1116

Query: 1031 LLDEPGPEFKNIDFDEDVPENIRHSVDQLCRI--TGDSVRE--FLKIAISKYRRARVEPG 1086
            ++ +  P        E+  + +   +D    +  + DSV E  F  +   KY R+ + PG
Sbjct: 1117 VVSKFNPSKYLGSVSENFQDKLESFIDSNNELFKSRDSVNEKKFRALMQLKYMRSLINPG 1176

Query: 1087 TAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1145
             AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +
Sbjct: 1177 EAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPI 1236

Query: 1146 VNDNDERAARVVKGRIEKTLLSDV 1169
            + D  +  A      I K +LS+V
Sbjct: 1237 LADVTDSQADTFCKSITKVMLSEV 1260

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V++ + +I R V    ++ KR L+ EG   +++   D  V  +   +N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    + + ++  S  ++LG+  ++GTGAF V+
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  ++A DI   S ++I+   + D  N   P +GG  D  +G    +L C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  444 bits (1142), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 318/1002 (31%), Positives = 492/1002 (49%), Gaps = 160/1002 (15%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 332  SRKLVKADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 388

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         I  + +M  +  +Q  V  +I+S            + GGKV PI 
Sbjct: 389  LSTLQKDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDS-------TKAQGNTGGKV-PIP 440

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 441  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 500

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA+ +  +D    +   +    R  LA  L           + 
Sbjct: 501  NIAELRQAIINGPDKWPGASQIQNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLN 560

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 561  KKVYRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 620

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q
Sbjct: 621  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQ 680

Query: 579  LLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAK 629
             +       DG+        +P PAI KP  LWTGKQ+ + ++  N   P +  INL + 
Sbjct: 681  YIYGCIRPEDGHATRAKLVTLP-PAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSS 738

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+    K++       +ND  VI +  ++L G++DKS  G   K+ + +++   YGP+ 
Sbjct: 739  NKI----KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPET 791

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFA--------------- 734
            AA  ++ + +L   Y+ N  F+ G+ D+    D  K + D+++ +               
Sbjct: 792  AAKVLSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLD 851

Query: 735  ----------YAKCDELIDSYNKGKLETQPGCNEEQTLEAKI------GGLLSKVREEVG 778
                        + +E++   NK  +       +  T+ +K+      GG + K  E   
Sbjct: 852  KDTPSNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPE--- 908

Query: 779  DVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
                      N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F   
Sbjct: 909  ----------NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPY 958

Query: 839  SKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
                 + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +  
Sbjct: 959  ETDAMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHI 1018

Query: 899  QYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQ 958
             YDN+VR +   ++QF YGGD +D ++            S    FN   +N +  L  Y 
Sbjct: 1019 SYDNSVRDADGTLIQFLYGGDAVDVIK-----------ESHMTEFNFCLDNYDALLKKYN 1067

Query: 959  IEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAEL 1018
                                           AL+E++D   A +    +LK+  + K E 
Sbjct: 1068 -----------------------------PSALVEHVDVETALKYSKKTLKNRKKHKDE- 1097

Query: 1019 LASVRKQRGMKELL--DEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAIS 1076
                   +  K+ L  D    ++    +   V EN +  ++     +  + +E+  I   
Sbjct: 1098 -------KHYKQTLKYDPVLSKYNPAKYLGAVSENFQDKLELFLDKSSKTFKEYESINEK 1150

Query: 1077 KYR--------RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1128
            K+R        R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1151 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1210

Query: 1129 II-NASKVISTPIINAVLVNDNDERAARVVKGRIEKTLLSDV 1169
            II  AS  I TP +   + ND  +  A      I K +LS+V
Sbjct: 1211 IIMTASAAIKTPQMTLPIWNDVSDETADTFCKSISKVILSEV 1252

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R +    ++ KR L+ EG   + +   +  +      +N I  V    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ +E  S  I+LG+  ++GTGAF ++
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           IS ++F  L++ADI   S   I+   + D  N   P +GG  D  +G    +L C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  444 bits (1142), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 339/1100 (30%), Positives = 529/1100 (48%), Gaps = 184/1100 (16%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------SGLEKG--------IS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+      S L+K         I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            +  GK+ P+ G  Q L+ K+G FR ++
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRKHM 465

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLINGPNVHP 428
             GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L+Q +INGP+  P
Sbjct: 466  MGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 525

Query: 429  GANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVGDVVERHLEDGDVVLFNR 476
            GA  +  +D    +   +    R  LA  L           +   V RH+++ DVV+ NR
Sbjct: 526  GATQIQNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIMNR 585

Query: 477  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 535
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 586  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 645

Query: 536  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLL-------SMMSDGNL 588
               +  LTP SG P+    QD I+    ++ KDS+F R    Q +          S  N 
Sbjct: 646  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSANNK 705

Query: 589  QFDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPV---VINLDAKNKVFIPPKSKSLPSEM 645
               IP PAI+KP  LWTGKQ+ + ++     SPV    INL +KNK+    K +      
Sbjct: 706  LLTIP-PAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQHS 758

Query: 646  SQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYL 705
             +N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   Y+
Sbjct: 759  EENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNYI 815

Query: 706  GNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAK 765
             N  F+ G+ D+   D+  K + D+          L  S ++G+       N E+   A 
Sbjct: 816  TNTAFTCGMDDLRLTDEGNKWRTDI----------LKTSVDRGRQAAVEVTNLEKDTSAD 865

Query: 766  IGGLLSKVREEVGD---------VCINELDNLNAPLI-------------------MATC 797
               LL ++ E + D         V  ++++ + + ++                   MA  
Sbjct: 866  DSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALS 925

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLT 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 926  GAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIK 985

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YG
Sbjct: 986  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYG 1045

Query: 918  GDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMNRLIRY 977
            GD +D  +            S+ + F+   +N +                    + L RY
Sbjct: 1046 GDAVDVTK-----------ESYMNQFDFCLDNYD--------------------SLLKRY 1074

Query: 978  DNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGK--AELLASVRKQRGMKELLDEP 1035
            +           ALI+++D + A +    +LK   + K     L +++    + +    P
Sbjct: 1075 NPA---------ALIDFLDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKY--NP 1123

Query: 1036 GPEFKNIDFD-EDVPENIRHSVDQLCRITGDSVRE--FLKIAISKYRRARVEPGTAVGAI 1092
                 ++    +D  EN   S  QL + +  SV E  F  +   KY R+ + PG AVG I
Sbjct: 1124 AKYLGSVSEKFQDKLENFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGII 1182

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDE 1151
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +
Sbjct: 1183 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTD 1242

Query: 1152 RAARVVKGRIEKTLLSDV---------------------AFYIQDVYQD----------- 1179
              A +    I K +LS+V                      FY QD Y +           
Sbjct: 1243 DQADIFAKSISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQN 1302

Query: 1180 ---NLSFMQVRIDLNTIDKLQLELTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFP 1236
               N     + I ++   K Q + T  D+ +AI   PK ++  + V  L    +  N   
Sbjct: 1303 VVANNFLTSLEIAIHKEIKKQKKTTASDVGIAI---PKAQLALAAVEGLSSKVMEDNDEE 1359

Query: 1237 EGYKAKSISTSAKEPHENDV 1256
            +  K    + S  EP E+++
Sbjct: 1360 QSRKKTKQAVSYDEPDEDEI 1379

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLR------DVMSTDGVVGHKTATNHILEVFS 1324
            VV+ +P+I R V    ++ KR L+ EG   +      D ++ DG+      +N +  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGIT-----SNDVSSVLK 1535

Query: 1325 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1384
              G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1385 QLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            ++ S+E T   L  A    +R+ +   S  I+LG+  ++GTGAF V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++FS LSA +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  442 bits (1138), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 315/987 (31%), Positives = 488/987 (49%), Gaps = 134/987 (13%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------S 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      S
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGF 353
             L+K         +  + +M  +  +Q  V  +I+S            S GGKV PI G 
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-------GSTGGKV-PIPGV 457

Query: 354  CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR 413
             Q L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN 
Sbjct: 458  KQALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNI 517

Query: 414  QKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVGDV 461
             +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           +   
Sbjct: 518  AELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKK 577

Query: 462  VERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLH 520
            V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H
Sbjct: 578  VFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMH 637

Query: 521  VPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLL 580
             PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q +
Sbjct: 638  FPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYI 697

Query: 581  SMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV-INLDAKNKV 632
                   DG+        +P PA+MKP  LWTGKQ+ + +I     + +  INL +KNK+
Sbjct: 698  YGCIRPEDGHSTRPKIVTVP-PAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI 756

Query: 633  FIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                K++      ++N+  VI +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  ----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAK 809

Query: 693  AMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFA------------------ 734
             ++ + +L   ++ N  FS G+ D+    +  K ++D+++ +                  
Sbjct: 810  VLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDT 869

Query: 735  -------YAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN 787
                     + +E++   NK  +        +    +K+  + SKV   V      +   
Sbjct: 870  PSNDPELLKRLEEILRDDNKSGIL-------DAVTSSKVNSVTSKVVSTVIPKGTMKKFP 922

Query: 788  LNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGF 847
             N+   MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+
Sbjct: 923  QNSMQAMALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGY 982

Query: 848  VRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTS 907
            ++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR  
Sbjct: 983  IKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDG 1042

Query: 908  SNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKIL 967
               +VQF YGGD +D  +     Q           F+    N +  L  Y          
Sbjct: 1043 DGTLVQFLYGGDAVDTTKESHMTQ-----------FDFCLENYDALLRKYN--------- 1082

Query: 968  APLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRG 1027
                                  AL+E++D   A +    +LKS  R K +     +    
Sbjct: 1083 --------------------PSALVEHLDVESALKYSKKALKS--RKKIDKEPHYKNSDK 1120

Query: 1028 MKELLDEPGPEFKNIDFDEDVPENIRHSVD----QLCRITGDSVREFLKIAISKYRRARV 1083
               +L +  P        E   + +   +D    QL   +G + ++F  +   KY R+ V
Sbjct: 1121 YDPVLSKYNPAKYLGSVSEKFQDKLEGFLDSHSKQLKLHSGINEKKFRALMQLKYMRSLV 1180

Query: 1084 EPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1142
             PG AVG I AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++
Sbjct: 1181 NPGEAVGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMS 1240

Query: 1143 AVLVNDNDERAARVVKGRIEKTLLSDV 1169
              + N   +  A +    I K +LS+V
Sbjct: 1241 LPVWNHVSDDQASIFCKSITKVVLSEV 1267

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 85/167 (50%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDV------MSTDGVVGHKTATNHILEVFS 1324
            V++ +P ISR +       +R L  EG   + +      +  DG+      +N +  V  
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGI-----RSNDVAAVLR 1554

Query: 1325 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1384
              G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +
Sbjct: 1555 TYGVEAARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFM 1614

Query: 1385 QLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            ++ S+E T   L  A     R+ ++  S  I+LG+  ++GTGAF V+
Sbjct: 1615 KM-SYETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           IS ++F+  SA +I   S  +I+   + D  N   P +GG  D  +G    +L C TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  441 bits (1134), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 316/988 (31%), Positives = 485/988 (49%), Gaps = 132/988 (13%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI+     
Sbjct: 341  SKKLVRADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEE 397

Query: 301  ---------SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
                     S  +K +  N +M  +  +Q  V  +I+S            + GGKV PI 
Sbjct: 398  MSKLQKDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDS-------TKAQGNTGGKV-PIP 449

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 450  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 509

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 510  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLN 569

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 570  KKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 629

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q
Sbjct: 630  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQ 689

Query: 579  LLSMM---SDG----NLQFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKN 630
             +       DG    N    +P PA+ KP  LWTGKQ+ + +L+         INL +KN
Sbjct: 690  YIYGCIRPEDGHATRNKLLTVP-PAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKN 748

Query: 631  KVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
            K+    K++      ++ND  V+ +  E+L G++DKS  G   K+ + +++   YGP  +
Sbjct: 749  KI----KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVS 801

Query: 691  ANAMNRMAKLCARYLGNRGFSIGISDVTPAD-------DLKKKKEDMVEFAYAKCDELID 743
            A  ++ + +L   Y+    F+ G+ D+   +       D+ K   D+   A A+   L  
Sbjct: 802  AKVLSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDK 861

Query: 744  SYNKGKLETQPGCNE-----------EQTLEAKIGGLLSKVREE-VGDVCINELDNLNAP 791
              +    E      E           +    +K+  + S+V  + V D  + +  N N+ 
Sbjct: 862  DVSANDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSM 920

Query: 792  LIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 921  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGR 980

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   +
Sbjct: 981  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTL 1040

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLM 971
            +QF YGGD +D             V   +H     F                        
Sbjct: 1041 IQFLYGGDAVD-------------VTQESHMTQFKFC----------------------- 1064

Query: 972  NRLIRYDNVGKLVPK-EKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGMKE 1030
                  DN   L+ K    ALIE++D   A +    +LK   R K E +    ++     
Sbjct: 1065 -----ADNYDALLKKYNPAALIEHLDVESALKYSKKALKH--RKKTEKVPHYSQKVKYDP 1117

Query: 1031 LLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGD--------SVREFLKIAISKYRRAR 1082
            ++ +  P      +   V EN +  ++       D        S ++F  +   KY R+ 
Sbjct: 1118 VVSKFNPS----KYLGSVSENFQDKLESFIDSNNDLFKSRDTVSEKKFRALMQLKYMRSL 1173

Query: 1083 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPII 1141
            + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +
Sbjct: 1174 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQM 1233

Query: 1142 NAVLVNDNDERAARVVKGRIEKTLLSDV 1169
               ++ D  +  A      + K +LS+V
Sbjct: 1234 TLPILADVTDPQADTFCKSVTKVMLSEV 1261

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V++ + +I R V    ++ KR L+ EG   +++   D  +  +   +N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    + + ++  S  I+LG+  ++GTGAF V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 13/138 (9%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  ++A DI   S ++I+   + D  N   P +GG  D  +G    +L C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELRRPGV 132
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILSKVLDQCKK 150
             L + G+    +D+C K
Sbjct: 124 --LLQYGL----IDECYK 135

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  439 bits (1128), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 309/995 (31%), Positives = 491/995 (49%), Gaps = 150/995 (15%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLK 358
              S  ++ +  N +M  +  +Q  V  +I+S           SS G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDS-------TKAQSSSGNKV-PIPGLKQALE 461

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQ 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 419  LLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVGDVVERHL 466
             +INGP+  PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 522  AVINGPDKWPGATQIQNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHI 581

Query: 467  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            ++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E
Sbjct: 582  KNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMM-- 583
             A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +     
Sbjct: 642  NAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 584  -SDG----NLQFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKNKVFIPPK 637
              DG    N    IP PA+MKP  LWTGKQ+ + +L+     +   INL++KNK+    K
Sbjct: 702  PEDGHATRNKLVTIP-PAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----K 756

Query: 638  SKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM 697
            ++       +N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ +
Sbjct: 757  NEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVL 813

Query: 698  AKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCN 757
             +L   Y+    F+ G+ D+    +  K + D+++           S + G++      N
Sbjct: 814  GRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQ----------TSVDIGRVAAAEVTN 863

Query: 758  EEQTLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI--------------- 793
             ++ +++  G LL ++ E + D         +  ++++++ + ++               
Sbjct: 864  LDKDVKSDDGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYN 923

Query: 794  ----MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 849
                MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++
Sbjct: 924  SMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIK 983

Query: 850  NSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 909
              F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR    
Sbjct: 984  GRFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDG 1043

Query: 910  GIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAP 969
             ++QF YGGD +D             +   +H     F                      
Sbjct: 1044 TLIQFLYGGDAVD-------------ITKESHMTEFKFC--------------------- 1069

Query: 970  LMNRLIRYDNVGKLVPK-EKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGM 1028
                    DN   L+ K    AL++++D   A +    +LK+  R K   L    +    
Sbjct: 1070 -------VDNYDALLKKYNPSALVDHLDVESALKYSKKTLKN--RKKNSKLPHYAQTSKY 1120

Query: 1029 KELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGD--------SVREFLKIAISKYRR 1080
              +L +  P      +   V EN +  +++      D        + ++F  +   KY R
Sbjct: 1121 DPVLSKFNPS----KYLGAVSENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMR 1176

Query: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1139
            + + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1177 SLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1236

Query: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQ 1174
             +   + +D  +  A      I K +LS+V   +Q
Sbjct: 1237 QLTMPIRDDVSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   D  +  +   +N +  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    + + ++  S  I++G+   +GTG+F ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++FS L++ +I   S  +++   + D  N   P  GG  D  +G    +L C TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGVDNLR 136
                R  +DN+R
Sbjct: 128 ALIDERYQIDNIR 140

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  438 bits (1127), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 313/981 (31%), Positives = 496/981 (50%), Gaps = 118/981 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+     
Sbjct: 345  SRKVVKADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDE 401

Query: 301  -SGLEKG-ISINN-------MMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S ++K  +S+++       +M  +  +Q  V  +I+S            S   K+ P+ 
Sbjct: 402  MSTIQKDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDS-------TKAQGSASSKI-PVP 453

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 454  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAY 513

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNLR----------VG 459
            N  +L+Q +INGP+  PGA+ +  +D    +   +    R  LA  L           + 
Sbjct: 514  NIAELRQAVINGPDKWPGASQIQNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLN 573

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 574  KKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 633

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 634  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQ 693

Query: 579  LL--------SMMSDGNLQFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAK 629
             +           S G +   +P PA++KP  LWTGKQ+ S +L+         INL++ 
Sbjct: 694  YIYGCIRPEHGHASRGKI-VTMP-PAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESN 751

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+    K++      ++ND  VI +  E++ G++DKS  G   K+ + +++   YGP+ 
Sbjct: 752  NKI----KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEV 804

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEF-------AYAKCDELI 742
            AA  ++ + +L   Y+    F+ G+ D+    +  K + ++++        A A+   L 
Sbjct: 805  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLD 864

Query: 743  DSYNKGKLETQPGC-------NEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
                   +E            N+   L+A     ++ V  +V   C+ +      P    
Sbjct: 865  KDTPSDDVELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSM 924

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 925  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGR 984

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     +
Sbjct: 985  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSL 1044

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLM 971
            +QF YGGD +D +  E +    +F R    A    +N       P  + E  D   A   
Sbjct: 1045 IQFLYGGDAVD-VTKESHMTQFDFCRENYDALLKKYN-------PVALAEHLDVETALQY 1096

Query: 972  NRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQ--RGMK 1029
            ++ +  +       ++K++   + +Q   +  +   L  +    A+ L SV ++    ++
Sbjct: 1097 SKKVSKN-------RKKNSKTAHYEQ---KVKYDPVLAKY--NPAKYLGSVSEKFHDKLE 1144

Query: 1030 ELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAV 1089
              L++   EFK+           R SV         S + F  +   KY R+ + PG AV
Sbjct: 1145 SYLEDKAKEFKS-----------RESV---------SAKRFRALMQLKYMRSLINPGEAV 1184

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D
Sbjct: 1185 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDD 1244

Query: 1149 NDERAARVVKGRIEKTLLSDV 1169
              +  A +    I K +LS+V
Sbjct: 1245 VSDEQADLFCKSISKVVLSEV 1265

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTAT-NHILEVFSVLGIE 1329
            V++ +P I R V +   + KR L+ EG   + +   +  +     T N +  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ L+F+ L+  DI   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  436 bits (1122), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 315/996 (31%), Positives = 493/996 (49%), Gaps = 147/996 (14%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K    + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+     
Sbjct: 345  SKKYVSADAFFMDVVVVPPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDE 401

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         I  + +M  +  +Q  V  +I+S         G +SG  KV P+ 
Sbjct: 402  MSKLQKDKVSVDDRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTSG--KV-PVP 453

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +
Sbjct: 454  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSF 513

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL-----------RV 458
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L            +
Sbjct: 514  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTL 573

Query: 459  GDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEM 517
               V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEM
Sbjct: 574  NKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEM 633

Query: 518  NLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLT 577
            N+H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R    
Sbjct: 634  NMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQ 693

Query: 578  QLLSMM---SDGN---LQFDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAK 629
            Q +       DG+    +     PA+MKP  LWTGKQ+ + ++  N   P +  INL + 
Sbjct: 694  QYIYGCIRPEDGHATRAKLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSS 752

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+      K+       N+  VI +  E+L G++DKS  G   K+ + + +   YGP  
Sbjct: 753  NKI------KNDYWGKGSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDV 805

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFA--------------- 734
            +A A++ + +L   Y+    F+ G+ D+   ++  K ++++++ +               
Sbjct: 806  SAKALSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLP 865

Query: 735  ----------YAKCDELIDSYNKGKLETQPGCNEEQTLEAKI------GGLLSKVREEVG 778
                        + +E+I   NK  +      ++  T+ +K+      GG + K  E   
Sbjct: 866  KDTPSNDPELLKRLEEIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE--- 922

Query: 779  DVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
                      N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F   
Sbjct: 923  ----------NSMQSMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPY 972

Query: 839  SKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
                ++ G+++  F+SG+ P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +  
Sbjct: 973  ETDARAGGYIKGRFYSGIRPQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHV 1032

Query: 899  QYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQ 958
             YDN++R +   ++Q  YGGD +D +  E +    NF                       
Sbjct: 1033 SYDNSIRDADGTLIQMLYGGDAID-VTKESHLTKFNFC---------------------- 1069

Query: 959  IEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAEL 1018
                           L  YD +  L      ALIE++D   A +    SLK   R K   
Sbjct: 1070 ---------------LENYDAL--LKKYNPSALIEHLDVETALKYSKKSLK--YRKKHAK 1110

Query: 1019 LASVRKQRGMKELLDE--PGPEFKNIDFD-EDVPENIRHSVDQLCRITGD-SVREFLKIA 1074
             A  ++      +L +  P     ++  + +D  EN  H   +L +   D + ++F  + 
Sbjct: 1111 EAHYQQTVKYDPILSKYNPAKYLGSVSENFQDQLENFLHDNSKLLKSHEDVNEKKFRALM 1170

Query: 1075 ISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NAS 1133
              KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS
Sbjct: 1171 QLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTAS 1230

Query: 1134 KVISTPIINAVLVNDNDERAARVVKGRIEKTLLSDV 1169
              I TP +   +++D  +  A      I K +LS+V
Sbjct: 1231 AAIKTPQMTLPILDDVTDEQADTFAKSISKVVLSEV 1266

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEG------YGLRDVMSTDGVVGHKTATNHILEVFS 1324
            V++ +P I R V    ++ KR L+ EG      +   D +  DG+      +N +  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1325 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1384
              G+EAAR +++ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1385 QLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            ++ S+E T   L  A    +R+ +   S  I+LG+  ++GTG+F V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++FS L++ DI + S  +I    + D  N   P +GG  D  +G    +L CTTC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +PV++  +F      L+  C  C    L   +   F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  435 bits (1118), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 323/1005 (32%), Positives = 502/1005 (49%), Gaps = 135/1005 (13%)

Query: 234  LKPEDCELLGI-----DSSNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTV 287
             K E C L  +     + S K  + +++    +  PP   R PS +  +   ++++ L  
Sbjct: 328  FKKEQCVLQYVFHSRPNLSRKVVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL-- 385

Query: 288  KLTEIVWTSSLIK------SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVN 333
             L++++ TS LI+      S L+K         +  + +M  +  +Q  V  +I+S    
Sbjct: 386  -LSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ 444

Query: 334  PAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVA 393
                 G +SG  KV PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ 
Sbjct: 445  -----GRTSG--KV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIG 496

Query: 394  VPDRVAKVLTYPEKVTRYNRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVK 451
            VP   A  LTYPE VT YN  +L+Q +INGP+  PGA  +  +D    +   + +  R  
Sbjct: 497  VPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSFEQRKA 556

Query: 452  LAKNL----------RVGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRL 500
            LA  L           +   V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL
Sbjct: 557  LANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRL 616

Query: 501  NECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITG 560
            +      YNADFDGDEMN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+ 
Sbjct: 617  HYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISA 676

Query: 561  SYLISHKDSFFDRGSLTQLLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFSLL 613
               ++ KDSFF R    Q +       DG+        +P P I KP  LWTGKQ+ + +
Sbjct: 677  GVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLP-PTIFKPYPLWTGKQIITTV 735

Query: 614  IKPNKKSPVV--INLDAKNKVFIPPKSK-SLPSEMSQNDGYVIIRGSEILSGVMDKSVLG 670
            +  N   P +  INL +KNK+      K SL SE       V+ +   +L G++DKS  G
Sbjct: 736  LL-NVTPPDMPGINLISKNKIKNEYWGKGSLESE-------VLFKDGALLCGILDKSQYG 787

Query: 671  DGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDM 730
               K+ + +++   YGP+ AA  ++ + +L   Y+    F+ G+ D+    +  K + D+
Sbjct: 788  -ASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDI 846

Query: 731  VEFAY---AKCDELIDSYNKGKLETQPGC-----------NEEQTLEAKIGGLLSKVREE 776
            ++ +     +    + + +K      P             N+   L+A     ++ +  +
Sbjct: 847  LKTSVDTGRQAAAEVTNLDKETPSDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQ 906

Query: 777  VGDVCINELDNLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
            V   C+ +      P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++L
Sbjct: 907  VVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTL 966

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            P F        + G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K 
Sbjct: 967  PSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQ 1026

Query: 893  LEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTER 952
            LE +   YDN++R +   ++QF YGGD +D +  E +     F     +A    +N +  
Sbjct: 1027 LEGVHVSYDNSIRDADGTLIQFMYGGDAVD-ITKESHMTQFEFCLDNYYALLKKYNPSA- 1084

Query: 953  GLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKS-- 1010
                                 LI + +V   +   K  L +Y  ++  E ++  S+K   
Sbjct: 1085 ---------------------LIEHLDVESALKYSKKTL-KYRKKHSKEPHYKQSMKYDP 1122

Query: 1011 --FMRGKAELLASVRK--QRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDS 1066
                   A+ L SV +  Q  ++  LDE    FK+ D                    G +
Sbjct: 1123 VLAKYSPAKYLGSVSENFQDKLESFLDENSKLFKSTD--------------------GVN 1162

Query: 1067 VREFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRI 1126
             ++F  +   KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR+
Sbjct: 1163 EKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRL 1222

Query: 1127 KEII-NASKVISTPIINAVLVND-NDERAARVVKGRIEKTLLSDV 1169
            +EI+  AS  I TP +   + +D +DE+A    K  I K LLS+V
Sbjct: 1223 REIVMTASAAIKTPQMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 85.5 bits (210), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 1264 RRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEV 1322
            RRS    +++ +P I R V    ++ KR L+ EG   + +   +  +      +N +  V
Sbjct: 1495 RRS----IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAV 1550

Query: 1323 FSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1382
                G+EAAR +I+ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S
Sbjct: 1551 LKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSS 1610

Query: 1383 VLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
             +++ S+E T   L  A    +R+ ++  S  I++G+  ++GTG+F V+
Sbjct: 1611 FMKM-SYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  434 bits (1116), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 315/984 (32%), Positives = 486/984 (49%), Gaps = 124/984 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            SNK+   + +    +  P    R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 354  SNKAVSADMFFMDVVVVPATRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 410

Query: 301  ---------SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
                     S  ++ I  + +M  +  +Q  V  +I+S            + GGK+ PI 
Sbjct: 411  MSKLQKDKVSADDRRIIFSRLMNAFVTIQNDVNAFIDS-------TKAQGTAGGKL-PIP 462

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 463  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 522

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 523  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLN 582

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 583  KKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 642

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 643  MHFPQNENARAEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQ 702

Query: 579  LLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKN 630
             +       DG+        +P P I KP  LWTGKQ+ S +L+     +   INL + N
Sbjct: 703  YIYGCIRPEDGHATRSKLITMP-PTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSN 761

Query: 631  KVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
            K+    K++   +   +N+  V+ +  E+L G++DKS  G   K  + +++   YGP  A
Sbjct: 762  KI----KNEYWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVA 814

Query: 691  ANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDEL---IDSYNK 747
            A  ++ + +L   Y+ +  F+ G+ D+   ++  K + D+++ +     E    + + +K
Sbjct: 815  AKVLSVLGRLFTNYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDK 874

Query: 748  GKLETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL---- 792
                  P             N+   L+A     ++ +  +V   C+ +      P     
Sbjct: 875  DTPANDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQ 934

Query: 793  IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 852
             MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F
Sbjct: 935  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRF 994

Query: 853  FSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIV 912
            +SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++
Sbjct: 995  YSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLI 1054

Query: 913  QFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMN 972
            QF YGGD +D  +            S    F+   +N +  L  Y               
Sbjct: 1055 QFLYGGDAVDVTK-----------ESHMTEFDFCLDNYDALLNKYN-------------- 1089

Query: 973  RLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQR-GMKEL 1031
                             ALIE++   D E     S KS    K  +     KQ      +
Sbjct: 1090 ---------------PSALIEHL---DVESALKYSKKSLKNRKKHIKEPHYKQNIKYDPV 1131

Query: 1032 LDEPGPEFKNIDFDEDVPENIRHSVDQLCRI--TGDSVRE--FLKIAISKYRRARVEPGT 1087
            L +  P        E   + +   +D+  ++  + DSV E  F  +   KY R+ + PG 
Sbjct: 1132 LSKFNPAKYLGSVSEKFQDKLEGYLDKNSKLFKSHDSVNEKKFRALMQLKYMRSLINPGE 1191

Query: 1088 AVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLV 1146
            AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + 
Sbjct: 1192 AVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIW 1251

Query: 1147 ND-NDERAARVVKGRIEKTLLSDV 1169
            ND +DE+A    K  I K +LS+V
Sbjct: 1252 NDVSDEQADTFCKS-ISKVVLSEV 1274

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R +    ++ KR L+ EG     +   +  +      +N +  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ +E  S  I++G+  ++GTG+F ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L++ +I   S  +I+   + D  N   P  GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F S+LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  434 bits (1115), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 319/986 (32%), Positives = 497/986 (50%), Gaps = 128/986 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI+     
Sbjct: 346  SRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDD 402

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         +  + +M  +  +Q  V  +I+S         G +SG  KV PI 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 515  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLN 574

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 575  KKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMN 634

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 635  MHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQ 694

Query: 579  LLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAK 629
             +       DG+        +P P I KP  LWTGKQ+ + ++  N   P +  INL +K
Sbjct: 695  YIYGCIRPEDGHTTRSKIVTLP-PTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISK 752

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+    K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDEL---IDSYN 746
            AA  ++ + +L   Y+    F+ G+ D+    +  K + D+++ +     E    + + +
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLD 865

Query: 747  KGKLETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
            K      P             N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLM 971
            VQF YGGD +D +  E +     F     +A    +N +                     
Sbjct: 1046 VQFMYGGDAID-ITKESHMTQFEFCLDNYYALLKKYNPSA-------------------- 1084

Query: 972  NRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKS----FMRGKAELLASVRK--Q 1025
              LI + +V   +   K  L +Y  ++  E ++  S+K          A+ L SV +  Q
Sbjct: 1085 --LIEHLDVESALKYSKKTL-KYRKKHSKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQ 1141

Query: 1026 RGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEP 1085
              ++  LD+    FK+ D                    G + ++F  +   KY R+ + P
Sbjct: 1142 DKLESFLDKNSKLFKSSD--------------------GVNEKKFRALMQLKYMRSLINP 1181

Query: 1086 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1144
            G AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   
Sbjct: 1182 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLP 1241

Query: 1145 LVND-NDERAARVVKGRIEKTLLSDV 1169
            + ND +DE+A    K  I K LLS+V
Sbjct: 1242 IWNDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  +      +N +  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ ++  S  I++G+  ++GTG+F V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 315/970 (32%), Positives = 485/970 (50%), Gaps = 129/970 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------SGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      S L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            S GG V P+ G  Q L+ K+G FR ++
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-------GSTGGNV-PVPGVKQALEKKEGLFRKHM 475

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLINGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q +INGP+  P
Sbjct: 476  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 535

Query: 429  GANYLLKKDEDARR----NLRYGDRVKLAKNL----RVGDV-------VERHLEDGDVVL 473
            GA  L  ++ED        +    R  LA  L     VG         V RH+++ D+V+
Sbjct: 536  GA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVI 593

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 594  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 653

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMM---SDGNLQ 589
            NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +       DG+  
Sbjct: 654  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 713

Query: 590  ----FDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSE 644
                  +P PA+ KP  LWTGKQ+ + +L+         INL + NK+    K++     
Sbjct: 714  RPKLVTVP-PAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKS 768

Query: 645  MSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARY 704
              +N+  V+ +  E+L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   Y
Sbjct: 769  SEENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNY 825

Query: 705  LGNRGFSIGISDVTPADDLKKKKEDMVEFAYAKCDEL---IDSYNKGKLETQPGC----- 756
            +    F+ G+ D+    +  K ++D+++ +     E    + +  K      P       
Sbjct: 826  IMATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQ 885

Query: 757  ------NEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGSTLNV 806
                  N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NV
Sbjct: 886  EVLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNV 945

Query: 807  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAI 866
            SQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH +
Sbjct: 946  SQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCM 1005

Query: 867  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEM 926
            +GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D  + 
Sbjct: 1006 AGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVDVTK- 1064

Query: 927  EGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMNRLIRYDNVGKLVPK 986
                       S    F+    N +  L  Y              + LI + +V   +  
Sbjct: 1065 ----------ESHMTKFDFCLENYDALLKKYN------------PSALIEHLDVESALKY 1102

Query: 987  EKDALIEYIDQNDAERNFYLSLKS----FMRGKAELLASVRK--QRGMKELLDEPGPEFK 1040
             K +L +Y  ++  E ++  S K          A+ L SV +  Q  ++  +D+    FK
Sbjct: 1103 SKKSL-KYRKKHAKEAHYKQSPKYDPVLAKYNPAKYLGSVSEKFQDKLETFIDKNSKLFK 1161

Query: 1041 NIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVGAIGAQSIGEP 1100
            + D   D+ E    ++ QL                 KY R+ + PG AVG I +QS+GEP
Sbjct: 1162 HND---DISEKKFRALMQL-----------------KYMRSLINPGEAVGIIASQSVGEP 1201

Query: 1101 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKG 1159
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  ++ A     
Sbjct: 1202 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSK 1261

Query: 1160 RIEKTLLSDV 1169
             I K LLS+V
Sbjct: 1262 SISKVLLSEV 1271

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLR------DVMSTDGVVGHKTATNHILEVFS 1324
            ++  +P I R V    ++ KR L+ EG   +      D +  DG+      +N +  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGIT-----SNDVSAVLK 1555

Query: 1325 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1384
            V G+EAAR +I+ EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1385 QLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            ++ S+E T   L  A    +R+ ++  S  I++G+  ++GTG+F ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  RISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCH 71
           RIS ++F   SA ++ A S  +I+   + D  N   P +GG  D  +G    ++ C +C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  430 bits (1106), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 313/976 (32%), Positives = 485/976 (49%), Gaps = 142/976 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------SGLEKG-ISINN---- 311
            PP   R PS +  +   ++++ L   L++I+ T+ LI+      S L+K  +S+++    
Sbjct: 366  PPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRVI 422

Query: 312  ---MMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 368
               +M  +  +Q  V  +I+S            + GGKV PI G  Q L+ K+G FR ++
Sbjct: 423  FSRLMNAFVTIQNDVNAFIDS-------TKAQGTTGGKV-PIPGVKQALEKKEGLFRKHM 474

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLLINGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q +INGP+  P
Sbjct: 475  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 534

Query: 429  GANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVGDVVERHLEDGDVVLFNR 476
            GA  +  +D    +   +    R  LA  L           +   V RH+++ D+V+ NR
Sbjct: 535  GAAQIQNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNRDIVIMNR 594

Query: 477  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 535
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 595  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 654

Query: 536  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMM---SDGNLQ--- 589
               +  LTP SG P+    QD I+    ++ KDSFF R    Q +       DG+     
Sbjct: 655  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPK 714

Query: 590  -FDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQ 647
               +P P I KP  LWTGKQ+ S +L+         INL + NK+      K+     S 
Sbjct: 715  LITLP-PTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI------KNEYWGKSS 767

Query: 648  NDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGN 707
            N+  V+ +  E+L G++DKS  G   K  + +++   YGP  AA  ++ + +L   Y+ +
Sbjct: 768  NENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFTNYIMS 826

Query: 708  RGFSIGISDVTPADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIG 767
              F+ G+ D+  +++  K + D+          L  S + G+       N ++   A   
Sbjct: 827  TAFTCGMDDLRLSEEGNKWRSDI----------LKTSVDTGREAAAEVTNLDKDTAADDA 876

Query: 768  GLLSKVREEVGD---------VCINELDNLNAPLI-------------------MATCGS 799
             LL ++ E + D         V  ++++++ + ++                   MA  G+
Sbjct: 877  ELLKRLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGA 936

Query: 800  KGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPP 859
            KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P 
Sbjct: 937  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQ 996

Query: 860  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGD 919
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD
Sbjct: 997  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGD 1056

Query: 920  GLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMNRLIRYDN 979
             +D  +            S    F+   +N +  L  Y                      
Sbjct: 1057 AVDVTK-----------ESHMTEFDFCLDNYDALLNKYN--------------------- 1084

Query: 980  VGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGMKELLDEPGPEF 1039
                      ALIE++D   A +    +LK+  R K    A  +       +L +  P  
Sbjct: 1085 --------PSALIEHLDVETALKYSKKTLKN--RKKHAKEAHHKNATKYDPVLSKFNPAK 1134

Query: 1040 KNIDFDEDVPENIRHSVDQLCRI--TGDSVRE--FLKIAISKYRRARVEPGTAVGAIGAQ 1095
                  E   + +   +D+  ++  + D+V E  F  +   KY R+ + PG AVG I +Q
Sbjct: 1135 YLGSVSEKFQDKLESYLDKNSKLFKSHDNVSEKKFRALMQLKYMRSLINPGEAVGIIASQ 1194

Query: 1096 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDERA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  D +DE+A
Sbjct: 1195 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQA 1254

Query: 1154 ARVVKGRIEKTLLSDV 1169
                K  I K +LS+V
Sbjct: 1255 DTFCKS-ISKVVLSEV 1269

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG     +   +  +      +N +  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ +E  S  I++G+  ++GTG+F ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L++ +I   S  +I+   + D  N   P +GG  D  +G    +L C++C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C  + L   +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  429 bits (1104), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 315/986 (31%), Positives = 497/986 (50%), Gaps = 128/986 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI+     
Sbjct: 346  SRKLVKADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDD 402

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         +  + +M  +  +Q  V  +I+S         G +SG  KV P+ 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PVP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 515  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLN 574

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 575  KKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMN 634

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 635  MHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQ 694

Query: 579  LLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAK 629
             +       DG+        +P P I KP  LWTGKQ+ + ++  N   P +  INL +K
Sbjct: 695  YIYGCIRPEDGHTTRSKIVTLP-PTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSK 752

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+    K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAY---AKCDELIDSYN 746
            AA  ++ + +L   Y+    F+ G+ D+    +  K + D+++ +     +    + + +
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLD 865

Query: 747  KGKLETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
            K      P             N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLM 971
            VQF YGGD +D +  E +     F     +A    +N +                     
Sbjct: 1046 VQFMYGGDAID-ITKESHMTQFEFCLDNYYALLKKYNPSA-------------------- 1084

Query: 972  NRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKS----FMRGKAELLASVRK--Q 1025
              LI + +V   +   K  L +Y  ++  E ++  S+K          A+ L SV +  Q
Sbjct: 1085 --LIEHLDVESALKYSKKTL-KYRKKHIKEPHYKQSIKYDPVLAKYNPAKYLGSVSENFQ 1141

Query: 1026 RGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEP 1085
              ++  LD+    FK+ D                    G + ++F  +   KY R+ + P
Sbjct: 1142 DKLESFLDKGSKLFKSAD--------------------GVNEKKFRALMQLKYMRSLINP 1181

Query: 1086 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1144
            G AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   
Sbjct: 1182 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLP 1241

Query: 1145 LVND-NDERAARVVKGRIEKTLLSDV 1169
            + +D +DE+A    K  I K LLS+V
Sbjct: 1242 IWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  +      +N +  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ ++  S  I++G+  ++GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  428 bits (1100), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 306/981 (31%), Positives = 486/981 (49%), Gaps = 116/981 (11%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+     
Sbjct: 348  SKKLVKPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDE 404

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         +  + +M  +  +Q  V  +I+S           ++GG  V P  
Sbjct: 405  MSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP-- 456

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 457  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSY 516

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNLR----------VG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 517  NIAELRQAVINGPDKWPGAIQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLN 576

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 577  KKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 636

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF R    Q
Sbjct: 637  MHFPQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQ 696

Query: 579  LLSMM---SDGNLQ----FDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKN 630
             +       DG+        +P P I KP  LWTGKQ+ + +L+         INL +KN
Sbjct: 697  YIYGCIRPEDGHATRAKIVTLP-PTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKN 755

Query: 631  KVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
            K+      K+       N+  VI +   +L G++DK+  G  K + + +++   YGP  A
Sbjct: 756  KI------KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVA 808

Query: 691  ANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAY---AKCDELIDSYNK 747
            A  ++ + +L   Y+    F+ G+ D+   D+  K + D+++ +     +    + + +K
Sbjct: 809  AKVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSK 868

Query: 748  GKLETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCI--NELDNL--NAPL 792
                  P             N+   L+A     ++ +  +V   C+    +     N+  
Sbjct: 869  DTPADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQ 928

Query: 793  IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 852
             MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F
Sbjct: 929  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRF 988

Query: 853  FSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIV 912
            +SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++
Sbjct: 989  YSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLI 1048

Query: 913  QFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMN 972
            +F YGGD +D  +            S+   F     N + GL          K   P  +
Sbjct: 1049 EFLYGGDAVDVTK-----------ESYMTQFKFCLENYD-GLV---------KKYNP--S 1085

Query: 973  RLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKA--ELLASVRKQRGMKE 1030
             LI + NV   +   K AL          R  + S+  +++      +LA     + +  
Sbjct: 1086 ALIEHLNVESALKYSKKAL--------KYRKKHSSVPHYLQNSKYDPVLAKYNPSKYLGS 1137

Query: 1031 LLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTAVG 1090
            + ++         F + + E +  +   +    G + ++F  +   KY R+ ++PG +VG
Sbjct: 1138 VSEK---------FQDKLEEFLNENSKLVKSTEGVNEKKFRALMQLKYMRSLIDPGESVG 1188

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDN 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++ND 
Sbjct: 1189 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDV 1248

Query: 1150 DERAARVVKGRIEKTLLSDVA 1170
              + A      I K LLS V 
Sbjct: 1249 SNQQAETFCKSITKVLLSQVT 1269

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V++ +P+I R V    ++  R L+ EG   + +   D  +   K  +N +  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    + + +   S  I+LG+  ++GTG+F ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  LS+  I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  427 bits (1097), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 320/983 (32%), Positives = 496/983 (50%), Gaps = 122/983 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI+     
Sbjct: 346  SRKLVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDD 402

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         +  + +M  +  +Q  V  +I+S         G +SG  KV PI 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA  +  +D    +   +    R  LA  L           + 
Sbjct: 515  NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLN 574

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 575  KKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMN 634

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 635  MHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQ 694

Query: 579  LLSMM---SDG----NLQFDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAK 629
             +       DG    N    +P PAI KP  LWTGKQ+ + ++  N   P +  INL + 
Sbjct: 695  YIYGCIRPEDGHTTRNKIITLP-PAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLIST 752

Query: 630  NKVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 689
            NK+    K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAY---AKCDELIDSYN 746
            AA  ++ + +L   Y+    F+ G+ D+    +  K + D+++ +     +    + + N
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLN 865

Query: 747  KGK-----------LETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
            K              E     N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILA-PL 970
            VQF YGGD +D +  E +     F     +A    +N       P  + E  D   A   
Sbjct: 1046 VQFMYGGDAVD-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLDVESALKY 1097

Query: 971  MNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRK--QRGM 1028
              + ++Y       P  K A ++Y D   A+ N            A+ L SV +  Q  +
Sbjct: 1098 SKKTLKYRKKHSKEPHYKQA-VKY-DPVLAKYN-----------PAKYLGSVSENFQDKL 1144

Query: 1029 KELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRRARVEPGTA 1088
            +  LD+    FK+ D                    G + ++F  +   KY R+ + PG A
Sbjct: 1145 ESFLDKNSKLFKSAD--------------------GVNEKKFRALMQLKYMRSLINPGEA 1184

Query: 1089 VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1147
            VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +
Sbjct: 1185 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWD 1244

Query: 1148 D-NDERAARVVKGRIEKTLLSDV 1169
            D +DE+A    K  I K LLS+V
Sbjct: 1245 DVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  +      +N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +++ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ ++  S  I++G+  ++GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  419 bits (1078), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 311/978 (31%), Positives = 478/978 (48%), Gaps = 122/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------SGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      S L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQR 356
            K         +  N +M  +  +Q  V  +I+       +     + GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 417  QQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNLRVGDV----------VER 464
            +Q +INGP+  PGA  +  +D    +   +    R  LA  L               V R
Sbjct: 509  RQAVINGPDKWPGATQIQNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYR 568

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 569  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 628

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMM 583
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 629  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 688

Query: 584  ---SDGNL---QFDIPAPAIMKPCYLWTGKQVFSLLIKPNKKSPVV--INLDAKNKVFIP 635
                DG+    +     PA++KP  LWTGKQ+ + ++  N   P +  INL +KNK+   
Sbjct: 689  IRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI--- 744

Query: 636  PKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMN 695
               K+       N+  VI +  E+L G++DKS  G   K  + +++   YGP  A   ++
Sbjct: 745  ---KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVLS 800

Query: 696  RMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDM----VEFAYAKCDELIDSYNKGKL- 750
             + +L   Y+    F+ G+ D+   ++  K + ++    V+   A   E+ +     K  
Sbjct: 801  VLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKAD 860

Query: 751  ---------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATC 797
                     E     N+   L+A     ++ +  +V   C+ +      P      MA  
Sbjct: 861  DPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMALS 920

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLT 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 921  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIR 980

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF YG
Sbjct: 981  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLYG 1040

Query: 918  GDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMNRLIRY 977
            GD +D             V   +H     F                              
Sbjct: 1041 GDAVD-------------VTKESHMTEFKFC----------------------------V 1059

Query: 978  DNVGKLVPK-EKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGMKELLDEPG 1036
            DN   L+ K    ALIE++D   A +    ++K+  R K E +           +L +  
Sbjct: 1060 DNYDALLKKYNPSALIEHLDVESALKYSKKAMKN--RKKNEKIPHYAHNIKYDPVLSKYN 1117

Query: 1037 PEFKNIDFDEDVPENIRHSVDQLCRI--TGDSVRE--FLKIAISKYRRARVEPGTAVGAI 1092
            P        E+  + +   +D   ++  + D+V E  F  +   KY R+ + PG AVG I
Sbjct: 1118 PSKYLGSVSENFQDKLEKFIDSNSKLLKSKDNVNEKKFRALMQLKYMRSLINPGEAVGII 1177

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDE 1151
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +
Sbjct: 1178 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTD 1237

Query: 1152 RAARVVKGRIEKTLLSDV 1169
              A      I K +LS+V
Sbjct: 1238 DQADTFCKSITKVMLSEV 1255

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V+  +P+I R V    ++ KR L+ EG   + +   +  +  +   +N +  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ ++  S  I++G+   +GTG+F ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I  ++FS L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  415 bits (1067), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 310/980 (31%), Positives = 477/980 (48%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------SGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      S L+
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 305  KG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQR 356
            K         I  N +M  +  +Q  V  +I+S            S GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDS-------TKAQGSTGGKV-PIPGVKQA 439

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 417  QQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVGDVVER 464
            +Q +INGP+  PGA  +  +D    +   +    R  LA  L           +   V R
Sbjct: 500  RQAVINGPDKWPGATQIQNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYR 559

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 560  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 619

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMM 583
             E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF R    Q +   
Sbjct: 620  NENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 679

Query: 584  ---SDGNL---QFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKNKVFIPP 636
                DG+    +     PA++KP  LWTGKQ+ + +L+         INL +KNK+    
Sbjct: 680  IRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI---- 735

Query: 637  KSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNR 696
            K++       +N+  VI +   +L G++DKS  G   K+ + +++   YGP  ++  ++ 
Sbjct: 736  KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVLSI 792

Query: 697  MAKLCARYLGNRGFSIGISDVTPAD-------DLKKKKEDMVEFAYAKCDELIDSYNKGK 749
            + +L   Y+ +  F+ G+ D+   D       D+ KK  D+   A A+   L        
Sbjct: 793  LGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRPDD 852

Query: 750  LETQPGCNEEQTLEAKIGGL-------LSKVREEVGDVCINELDNLNAPL----IMATCG 798
             E      E    + K+G L       ++ +  EV   C+ +      P      MA  G
Sbjct: 853  AELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMALSG 912

Query: 799  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP 858
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P
Sbjct: 913  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGIKP 972

Query: 859  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 918
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF YGG
Sbjct: 973  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLYGG 1032

Query: 919  DGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIEEETDKILAPLMNRLIRYD 978
            D +D             V   +H     F             +  D +L        RY+
Sbjct: 1033 DAID-------------VTKESHMSEFKF-----------CVDNYDALLK-------RYN 1061

Query: 979  NVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLASVRKQRGMKELLDEPGPE 1038
                       ALI+++D   A +    ++K+  R K   L    +      +L +  P 
Sbjct: 1062 ---------PSALIQHLDVESALKYSKKAMKN--RKKNLNLPHYARHDKYDPVLSKYNPS 1110

Query: 1039 FKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR--------RARVEPGTAVG 1090
                 F   V EN +  ++          +    +   K+R        R+ + PG AVG
Sbjct: 1111 ----KFLGSVSENFQDKLESFIDSNASLFKGQATVNEKKFRALMQLKYMRSLINPGEAVG 1166

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDN 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D 
Sbjct: 1167 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDV 1226

Query: 1150 DERAARVVKGRIEKTLLSDV 1169
             +  A +      K +LS+V
Sbjct: 1227 TDETADIFCKNTTKVILSEV 1246

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V+K +P+I R V    ++ KR L+ EG   + +   +  +  +   +N +  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    +R+ ++  S  ++LG+  S+GTGAF ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           IS ++FS +SAA+I A S  +I+   + D  +   P  GG  D  +G    +L C TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNC 110
           +   C GH GHI+L +P +   +F      L+  C  C
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYC 105

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  372 bits (954), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 243/738 (32%), Positives = 386/738 (52%), Gaps = 89/738 (12%)

Query: 247  SNKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            S K  + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+     
Sbjct: 341  SRKLVKADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDE 397

Query: 301  -SGLEKG--------ISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIR 351
             S L+K         +  + +M  +  +Q  V  +I+S            + GGKV PI 
Sbjct: 398  MSKLQKDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDS-------TKAQGNTGGKV-PIP 449

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT Y
Sbjct: 450  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 509

Query: 412  NRQKLQQLLINGPNVHPGANYLLKKDED--ARRNLRYGDRVKLAKNL----------RVG 459
            N  +L+Q +INGP+  PGA+ +  +D    +   +    R  LA  L           + 
Sbjct: 510  NIAELRQAVINGPDKWPGASQIQNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLN 569

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 570  KKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 629

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQ 578
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q
Sbjct: 630  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQ 689

Query: 579  LL-------SMMSDGNLQFDIPAPAIMKPCYLWTGKQVFS-LLIKPNKKSPVVINLDAKN 630
             +          +  +    +P PA+ KP  LWTGKQ+ + +L+         INL++ N
Sbjct: 690  YIYGCIRPEHGHTTRSKIVTVP-PAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSN 748

Query: 631  KVFIPPKSKSLPSEMSQNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
            K+    K++   +  ++ND  VI +  E+L G++DKS  G   K+ + +++   YGP  A
Sbjct: 749  KI----KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVA 801

Query: 691  ANAMNRMAKLCARYLGNRGFSIGISDVTPADDLKKKKEDMVEFAY-----AKCDELIDSY 745
            A  ++ + +L   Y+    F+ G+ D+   D+  K ++D+++ +      A C+      
Sbjct: 802  AKVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVT---- 857

Query: 746  NKGKLETQPGCNEEQTLE--------------------AKIGGLLSKVREE-VGDVCINE 784
                LE +   ++ + L+                    +K+  + SKV  + V D  + +
Sbjct: 858  ---NLEKETASDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKK 914

Query: 785  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 844
                N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        +
Sbjct: 915  FP-YNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMA 973

Query: 845  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 904
             G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+V
Sbjct: 974  GGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSV 1033

Query: 905  RTSSNGIVQFTYGGDGLD 922
            R     ++QF YGGD +D
Sbjct: 1034 RDGDGTLIQFLYGGDSVD 1051

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1068 REFLKIAISKYRRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIK 1127
            ++F  +   KY R+ + PG +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++
Sbjct: 1159 KKFRALMQLKYMRSLINPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMR 1218

Query: 1128 EII-NASKVISTPIINAVLVNDNDERAARVVKGRIEKTLLSDV 1169
            EII  AS  I TP +   +++D  +  A V    I K LLS+V
Sbjct: 1219 EIIMTASAAIKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVG-HKTATNHILEVFSVLGIE 1329
            V++ +P I R V    ++ KR L+ EG   + +   +  +G     +N +  V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1330 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1390 EKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVI 1431
            E T   L  A    + + ++  S  I+LG+  ++GTGAF V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLECTTCHG 72
           I+ ++FS L+A +I   S  +I+   + D  N   P +GG  D  +G    +L C+TC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 64/115 (55%), Gaps = 1/115 (0%)

Query: 7   SATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGVSSSSLE 66
           SA  + I  ++F   S  ++ A S  +I   +  D    RA + GG  DP++G    +++
Sbjct: 8   SAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNVK 66

Query: 67  CTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDRR 121
           C TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LLD+H+ +
Sbjct: 67  CQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQ 121

>Suva_1.32 Chr1 complement(57262..58482) [1221 bp, 406 aa] {ON}
            YAL034C (REAL)
          Length = 406

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 1239 YKAKSISTSAKEPHENDVFFR-MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEG 1297
            ++AK  S SA  PH N      + +  + +P I  K LPD S  +  +  DT + L +E 
Sbjct: 254  HRAKKFSPSASAPHTNIASMEAIHEAPQYVPNISWKKLPDFSPPLSTLPADTNKSLKIEW 313

Query: 1298 YGLRDVMSTDGV 1309
             G    +STD +
Sbjct: 314  KGSPMDLSTDPL 325

>KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]
           {ON} weakly similar to uniprot|P32454 Saccharomyces
           cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
           yscII and to YHR047C uniprot|P37898 Saccharomyces
           cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase
          Length = 877

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 316 WDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDF 375
           +DY++      I     N     G SSG GK+ P++ +  + K +QG+F  +++ + +DF
Sbjct: 210 YDYIESETEKSIYPTIENYNTQDGTSSGCGKL-PVKVYTAKGKAQQGKFALDVAKRVIDF 268

Query: 376 SGRTVISPDPNLSIDEVAV 394
              +   P P   +D + V
Sbjct: 269 FSESFEIPYPLPKLDLLCV 287

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 267 CIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKSGLEKGISINNMMEHWDYLQLSVAMY 326
           C +   ++ + P  + + +    T   +TS L+ + L     +   + H+DY++ S    
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYL-----VAWAIGHYDYIEDSTEKK 214

Query: 327 INSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPN 386
           I        +  G+S   G + PIR F  + K  QGRF  N++ + VD        P P 
Sbjct: 215 IYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPL 273

Query: 387 LSIDEVAV 394
             +D V V
Sbjct: 274 PKLDIVCV 281

>YAL034C Chr1 complement(80710..81951) [1242 bp, 413 aa] {ON}
            FUN19Non-essential protein of unknown function;
            expression induced in response to heat stress
          Length = 413

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 1239 YKAKSISTSAKEPHENDVFFR-MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEG 1297
            ++AK  S SA  PH N      +    + +P +  K LPD S  +  +  D+ + L +E 
Sbjct: 261  HRAKKFSPSASTPHTNIASIEAIHDAPQYIPNVSWKKLPDYSPPLSTLPTDSNKSLKIEW 320

Query: 1298 YGLRDVMSTDGV 1309
             G    +STD +
Sbjct: 321  KGSPMDLSTDPL 332

>Skud_1.27 Chr1 complement(56318..57547) [1230 bp, 409 aa] {ON}
            YAL034C (REAL)
          Length = 409

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 1239 YKAKSISTSAKEPHENDVFFR-MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEG 1297
            +++K  S SA  PH N      + +  + +P +  K LPD S ++  +  DT + L +E 
Sbjct: 257  HRSKKFSPSASAPHTNIASIEAIHEAPQYIPNVSWKKLPDFSPSLSTLPADTNKSLKIEW 316

Query: 1298 YG 1299
             G
Sbjct: 317  KG 318

>TDEL0E04360 Chr5 complement(809654..811633) [1980 bp, 659 aa] {ON}
            Anc_5.193 YGR186W
          Length = 659

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 72/155 (46%), Gaps = 21/155 (13%)

Query: 1150 DERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLELTIEDIAVA- 1208
            DE   R+ K  ++KT L+  A Y  D    N    +  ++ N  D+++ E   E ++   
Sbjct: 471  DEEGERIKKA-LQKTELA--ALYSSDDEM-NPYLSESDVENNQSDQVKKENAEESLSRKS 526

Query: 1209 -----------ITRAPKLKIQA--SDVTILDKDKIAINVFPEGYKAKSISTSAKEPHEND 1255
                       + R P++++++    + IL  DK  +  FPEG  +  ++   +E +E D
Sbjct: 527  SPKKDSNGTNNVNREPQIRVKSIKDSIIILKADKKLLKGFPEGEWSPKVAKRKREENETD 586

Query: 1256 VFF--RMQQLRRSLPGIVVKGLPD-ISRAVINVRD 1287
                 +++    S+P I  +G+ D I   V+NV++
Sbjct: 587  DTSNKKVKVEEGSVPLITEQGIRDAIGNGVVNVKE 621

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 151,705,453
Number of extensions: 6744681
Number of successful extensions: 18074
Number of sequences better than 10.0: 72
Number of HSP's gapped: 18233
Number of HSP's successfully gapped: 178
Length of query: 1460
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1338
Effective length of database: 39,492,147
Effective search space: 52840492686
Effective search space used: 52840492686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)