Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019505.430ON61760421950.0
Suva_2.5385.430ON62961413620.0
ZYRO0F09944g5.430ON61161313431e-179
YDR365C (ESF1)5.430ON62860013151e-174
NDAI0B056405.430ON66964313141e-174
Smik_4.6325.430ON62761313101e-173
SAKL0G02442g5.430ON62360812921e-171
KAFR0E039105.430ON62561612891e-170
NCAS0F033505.430ON63962112891e-170
Kpol_1016.85.430ON63761912741e-168
CAGL0L11638g5.430ON60860712671e-167
Skud_4.6355.430ON62960612511e-165
TPHA0H017805.430ON62260812111e-159
TBLA0A065405.430ON65964712001e-156
KLLA0E21165g5.430ON62761411901e-155
KLTH0F16148g5.430ON64662711761e-153
KNAG0C049405.430ON64263011701e-152
Ecym_47905.430ON63062211581e-151
Kwal_55.214445.430ON64463311401e-148
AER259W5.430ON61960711011e-142
Skud_7.4674.77ON70846733.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01950
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   850   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   529   0.0  
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   521   e-179
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   511   e-174
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   510   e-174
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   509   e-173
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   502   e-171
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   501   e-170
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   501   e-170
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   495   e-168
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   492   e-167
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   486   e-165
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   471   e-159
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   466   e-156
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   462   e-155
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   457   e-153
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   455   e-152
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   450   e-151
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   443   e-148
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   428   e-142
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    33   3.2  

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/604 (73%), Positives = 446/604 (73%)

Query: 1   MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE 60
           MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE
Sbjct: 1   MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE 60

Query: 61  DSKESKDFDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXXXXXXXXXXXXXXX 120
           DSKESKDFDKYFEQS           ILTVDRARGEVP                      
Sbjct: 61  DSKESKDFDKYFEQSDEEKKKDKDTEILTVDRARGEVPSDYVSSSDEFTSSDSEVSDNEV 120

Query: 121 XXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP 180
                    LEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP
Sbjct: 121 ESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP 180

Query: 181 SEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLYEEGDADKNVDNKAX 240
           SEFGKERMQREEVEGPPKELF                  IDVKDLYEEGDADKNVDNKA 
Sbjct: 181 SEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEEGDADKNVDNKAL 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDS 300
                                  ESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDS
Sbjct: 241 RQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDS 300

Query: 301 CTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLAXXX 360
           CTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLA   
Sbjct: 301 CTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASDS 360

Query: 361 XXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQ 420
                   AQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQ
Sbjct: 361 DDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQ 420

Query: 421 EGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSDIEQDPKSK 480
           EGQEEESTID                   LKHQAEQD           QTSDIEQDPKSK
Sbjct: 421 EGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGKQTSDIEQDPKSK 480

Query: 481 AXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLEDP 540
           A            TEKSINKKAHFNM                     IVVDDFKPDLEDP
Sbjct: 481 AELELLMMDDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDP 540

Query: 541 RFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENGDIA 600
           RFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENGDIA
Sbjct: 541 RFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENGDIA 600

Query: 601 NIVA 604
           NIVA
Sbjct: 601 NIVA 604

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/614 (48%), Positives = 368/614 (59%), Gaps = 19/614 (3%)

Query: 3   EKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDS 62
           EK S D RF+ IY+DPKF N +T+  K+KLD RFSKKDLE++ K+KVDKYGR+++D  ++
Sbjct: 7   EKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAHNT 66

Query: 63  KESKDFDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXXX 122
           KE +DFDKYFE+              TVDRARGEVP                        
Sbjct: 67  KELEDFDKYFEKEAENEEDTEADVKATVDRARGEVPNDYVSSGDEFTSSDSESSGESEIE 126

Query: 123 XXXXXXXLEK-TEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPS 181
                    +  +P SGD+SKTLAVVNLDWD+V+S DLMITFS F+P GG+IE+I++YPS
Sbjct: 127 SEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISVYPS 186

Query: 182 EFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXID----VKDLYEEGDADKNVDN 237
           EFGKERMQREE+EGPPKELF                   D    +KDLYEEGDADK+VD+
Sbjct: 187 EFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDADKDVDS 246

Query: 238 KAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKP 297
           +A                         +IY NCDGTEYESTAN+FD+RYVPDGM FD   
Sbjct: 247 RALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDTA 306

Query: 298 KDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLA 357
           +D+C+ LPKNY+P QFSTDALQHSNVKLTWDETPADR++VAKRAFTQKEI+DMDFKAYLA
Sbjct: 307 RDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLA 366

Query: 358 XXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANK 417
                        +KSKLKSLV G   F+  ++NA+  DG++EEVDMEITFTP L+  ++
Sbjct: 367 SDSDESDEEVNEDAKSKLKSLV-GGLGFNSKKENAN--DGDEEEVDMEITFTPALEGGDE 423

Query: 418 DGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSD---IE 474
              EGQ EE++I+                   LK Q+E++             +D   I+
Sbjct: 424 KPIEGQ-EETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVADEEEIK 482

Query: 475 QDPKSKAX-XXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDF 533
            + KSKA              E SIN KAHFNM                     IV D+F
Sbjct: 483 NNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNF 542

Query: 534 KPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDT 593
            PDLEDPRFKE+FE HDFAIDPTQ E++GT+AM ++L +R K+ H  + KRK    END 
Sbjct: 543 TPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVH--DRKRKHGKNENDV 600

Query: 594 NENG----DIANIV 603
            E+G    +I N+V
Sbjct: 601 TEDGNDNKNIGNLV 614

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  521 bits (1343), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 302/613 (49%), Positives = 364/613 (59%), Gaps = 36/613 (5%)

Query: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63
           K S DPRF+ I +DPKF N K KG KVKLDDRFSKKDL+++RK KVDKYGRR+    +SK
Sbjct: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI--TGESK 65

Query: 64  ESKDFDKYFEQSXXXXXXXXXXXIL----------TVDRARGEVPXXXXXXXXXXXXXXX 113
           + KDFDKYFE+                         VDRARGE+P               
Sbjct: 66  DLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDL 125

Query: 114 XXXXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRI 173
                           +E+ +P SGD SKTLAVVNLDWD+VR++DLMITFSSFLP+GG+I
Sbjct: 126 SEEESEADVAEA----VEEAKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKI 181

Query: 174 EKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLYEEGDADK 233
           EKI IYPSEFGKERMQREE EGPP+E+F                  +D++DLYEEGDADK
Sbjct: 182 EKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDSD----VDIRDLYEEGDADK 237

Query: 234 NVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDF 293
            VDN A                        ESIY+NCDGTEYESTANIFD+RYVP+GM+F
Sbjct: 238 EVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEF 297

Query: 294 DGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFK 353
           D +PKD C ELPKNYKPL+FSTDALQHSNVKLTWDETP DRL+V+KRAF+QKE+EDMDF+
Sbjct: 298 DDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQ 357

Query: 354 AYLAXXXXXX--XXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPG 411
           AYLA              ++K+KLKSLV  S A+   +         +EE DMEITFTPG
Sbjct: 358 AYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQQ---------EEEPDMEITFTPG 408

Query: 412 LDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTS 471
           LD++     E   EE+TI+                   LK QAEQ+           +  
Sbjct: 409 LDDSKPQADEDH-EETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQV 467

Query: 472 DIEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVD 531
           + E D KSKA            TEKS+NKKAHFNM                     I+ D
Sbjct: 468 EDESDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMED 527

Query: 532 DFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQEN 591
           +FKPDL DPRF E+FE  DFAIDP+Q E++ TKAMKE+L +RSK+AH+   KRK    + 
Sbjct: 528 EFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHK---KRKPLADDG 584

Query: 592 DTNEN-GDIANIV 603
           D+ +N  DI+NIV
Sbjct: 585 DSKDNKHDISNIV 597

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 289/600 (48%), Positives = 357/600 (59%), Gaps = 16/600 (2%)

Query: 8   DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKESKD 67
           D RF+ IY DPKF N KTK  K+KLD RFSKKDLE++ K+KVDKYGR++++ ++++E +D
Sbjct: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71

Query: 68  FDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXX-XXXXXXXXXXXXXXXXXXX 126
           FDKYFE+               VDRARGEVP                             
Sbjct: 72  FDKYFEKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSDEFTSSDSESSGESEVESEEEN 131

Query: 127 XXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKE 186
              +E  +P SGD SK LAVVNLDWD+V+S DLMITFSSF+P GG+IE++AIYPSEFGKE
Sbjct: 132 EVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKE 191

Query: 187 RMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX----IDVKDLYEEGDADKNVDNKAXXX 242
           RMQREEVEGPPKELF                      I +KDLYEEGDADK+VD++A   
Sbjct: 192 RMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQ 251

Query: 243 XXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDSCT 302
                                ++IY+NCDGTEYESTAN+FD+RYVPDGM FD   +D C+
Sbjct: 252 YQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECS 311

Query: 303 ELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLAXXXXX 362
            LPKNY+P QFSTDALQHS+VKLTWDETPADR++VAKRAFTQKEI+DMDFKAYLA     
Sbjct: 312 ILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDE 371

Query: 363 XXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQEG 422
                  ++K+KLKSLV G   F+  ++  ++    DEEVDMEITFTP L+  N+   E 
Sbjct: 372 SDGQVDEEAKNKLKSLV-GDFGFNSKKETPND---EDEEVDMEITFTPALEGGNEKSSED 427

Query: 423 QEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSD---IEQDPKS 479
           + EE+TI+                   LK Q+E+D            T+D   IE++ KS
Sbjct: 428 K-EETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEIEKNAKS 486

Query: 480 KAXXXXXXXXXXXXTEK-SINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLE 538
           KA              + +IN KAHFNM                     IV D F PDLE
Sbjct: 487 KAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLE 546

Query: 539 DPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENGD 598
           DPRFKE+FE HDFAIDPTQ EF+GT+AM ++L +RSK+    N KRK+   EN+   N D
Sbjct: 547 DPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK--NKKRKLGGSENNMTNNAD 604

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  510 bits (1314), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 305/643 (47%), Positives = 360/643 (55%), Gaps = 46/643 (7%)

Query: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE-DS 62
           K S DPRF+KIY+DPKF   K K  K+KLDDRFSKKDLEI+RK+KVDKYGR++ D + + 
Sbjct: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68

Query: 63  KESKDFDKYFEQSXXXXXXXXXXXILTV-----------------------DRARGEVPX 99
           KE  DFDKYFE+              +V                       DRARG+VP 
Sbjct: 69  KEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDRARGDVPA 128

Query: 100 XXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSD 158
                                          +   EP SG+ SKTLAVVNLDWD+V+SSD
Sbjct: 129 DYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188

Query: 159 LMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXX------XX 212
           LMITFSSFLP GGRIE IAIYPSEFGKERMQRE+VEGPPKELF                 
Sbjct: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKSKKISDEA 248

Query: 213 XXXXXXXIDVKDLYEEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDG 272
                  +D+KDLYEEGDADK+VD KA                         +IY NCDG
Sbjct: 249 NDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATAIYQNCDG 308

Query: 273 TEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPA 332
           TEYESTAN+FD+RYVPDGMDF  +P+D C  LPKNYKP QFSTDALQHSNVKLTWDETP 
Sbjct: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368

Query: 333 DRLDVAKRAFTQKEIEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTG---SSAFDFTR 389
           +R +VAKRAFTQKEI+DMDFKAYLA             +K+KLK+LV G    S   F  
Sbjct: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGGFGSREIFGG 428

Query: 390 KNADEVDGNDE-EVDMEITFTPGLDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXX 448
           K A    G DE EVDMEITF P LDE N   ++G+ EE+TI+                  
Sbjct: 429 KGAKA--GEDEDEVDMEITFNPALDE-NSPKEDGEHEETTIEKVARKEKERRKARKQKLK 485

Query: 449 XLKHQAEQDXXXXXXXXXXXQTSDIEQDP------KSKAXXXXXXXXXXXXTEKSINKKA 502
            LK +A+Q+           +    E D       KS+A            T  +IN KA
Sbjct: 486 ELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETGSTINNKA 545

Query: 503 HFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRG 562
           HFNM                     IV D+FKPDL DPRFKE+FE HDFAIDP++ EF+ 
Sbjct: 546 HFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE 605

Query: 563 TKAMKEMLNKRSKQAHR--VNSKRKIATQENDTNENGDIANIV 603
           TKAMKE+L +RSK+ H+   N KR+++  EN   E+ DI NIV
Sbjct: 606 TKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIV 648

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  509 bits (1310), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 288/613 (46%), Positives = 358/613 (58%), Gaps = 19/613 (3%)

Query: 3   EKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDS 62
           +K   D RF+ IY DPKF N +TK  K+KLD RFSKKDLE++ K+KVDKYGR++++ +++
Sbjct: 7   QKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNN 66

Query: 63  KESKDFDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXX-XXXXXXXXXXXXXX 121
           KE +DFDKYF++               VDRARGE+                         
Sbjct: 67  KELEDFDKYFQKEAENDEDTEASVKTVVDRARGEISGDYVSSSDEFTSSDSESSEQSEVE 126

Query: 122 XXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPS 181
                   +E  +P  GD SKTLAVVNLDWD+V+S DLMITFSSF+P GG++E++AIYPS
Sbjct: 127 SEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPS 186

Query: 182 EFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX----IDVKDLYEEGDADKNVDN 237
           EFGKERMQREEVEGPPKELF                      I + DLYEEGDADK+VD+
Sbjct: 187 EFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKDVDS 246

Query: 238 KAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKP 297
           +A                        ++IY+NCDGTEYESTAN+FD+RYVPDGM FD   
Sbjct: 247 RALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAV 306

Query: 298 KDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLA 357
           +D CT LPKNY+P QFSTDALQHSNVKLTWDETPADRL+VAKRAFTQKEI+DMDFKAYLA
Sbjct: 307 RDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLA 366

Query: 358 XXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANK 417
                        +K+KLKSLV G + F+  ++N   V  +DEEVDMEITFTP L+  N+
Sbjct: 367 SDSDESDEQIDEDAKNKLKSLVGGIN-FNSKKEN---VKDSDEEVDMEITFTPALEGGNE 422

Query: 418 DGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQT---SDIE 474
              E Q EE+TI+                   LK Q+E+D                 DI+
Sbjct: 423 QPSEEQ-EETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKKYAEGEEDIK 481

Query: 475 QDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFK 534
            + K+KA             + +IN KAHFNM                     IV D+F 
Sbjct: 482 NNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFT 541

Query: 535 PDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTN 594
           PDL DPRFKE+FE HDFAIDPTQ E++ T+AM ++L +R K+    + KRK    END  
Sbjct: 542 PDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVK--DKKRKHDGSENDII 599

Query: 595 ENGD----IANIV 603
           +NGD    I N+V
Sbjct: 600 KNGDSKGNIGNLV 612

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  502 bits (1292), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 285/608 (46%), Positives = 368/608 (60%), Gaps = 15/608 (2%)

Query: 6   SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKES 65
           + DPRFS I+ DPKF + K K  K+KLDDRFSKKDLEIK+K KVDKYGRR++DV D+KE+
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDV-DNKET 69

Query: 66  KDFDKYFEQSXXXXXXXXX----XXILTVDRARGEVPX-XXXXXXXXXXXXXXXXXXXXX 120
           KDF++YFE+                + ++DRARGEVP                       
Sbjct: 70  KDFERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEEESENSE 129

Query: 121 XXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP 180
                    +E+++P +GD+++ LAVVNLDWD+V+S+DLM+TFSSF+P GG+I KIAIYP
Sbjct: 130 LESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYP 189

Query: 181 SEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLYEEGDADKNVDNKAX 240
           SEFGKERMQREEVEGPP+ELF                  +D+KDLYEEGDA+K+ D+KA 
Sbjct: 190 SEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSD--VDIKDLYEEGDAEKDYDSKAL 247

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDS 300
                                  E+IY NCDGTEYESTAN+FD+RYVP+GMDF  +PKD 
Sbjct: 248 RRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDE 307

Query: 301 CTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLAXXX 360
           C ++PKNYKP QFSTDALQHSNVKLTWDETPA+R++++KRAFTQKEIEDMDFKAYLA   
Sbjct: 308 CEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDS 367

Query: 361 XXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQ 420
                     S++KLKSLV+ S      +   D+ D    +VDMEITFTPGLDEA KD +
Sbjct: 368 EGSEEEINEDSRNKLKSLVSESIRIG-DKSLFDKSDNEGGDVDMEITFTPGLDEAKKDDE 426

Query: 421 EGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSD-IEQDPKS 479
           +G++E +                       K   E+            +T+D +E++ KS
Sbjct: 427 DGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEVEKEKKS 486

Query: 480 KAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLED 539
           KA            TE  +NKKAHFNM                     IV D+FKPDL D
Sbjct: 487 KAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLND 546

Query: 540 PRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQE----NDTNE 595
           PRF+E+FE HDFAIDP+Q EF+GT AMKE+L +R+++  +    +K   ++    N++NE
Sbjct: 547 PRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVSKKKGNKKRKLEQPRKNNNSNE 606

Query: 596 -NGDIANI 602
            NG +A +
Sbjct: 607 LNGLVAKL 614

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 361/616 (58%), Gaps = 19/616 (3%)

Query: 1   MSE--KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRD 58
           MSE  K+S DPRFS+IY+DPKF N KTK  K++LD RFSK+DLEI+ K KVDKYGR+ +D
Sbjct: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60

Query: 59  VEDSKESKDFDKYFEQSXXXXXXXXXXXILT--VDRARGEVPXXXXXXX-XXXXXXXXXX 115
               KE  DF+KYFE+                 VDRARGEVP                  
Sbjct: 61  EGSKKELDDFEKYFEKEDEEEKKDTEETEEKPKVDRARGEVPSDYVSSSDEYTSSESEDS 120

Query: 116 XXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEK 175
                         +E T+P +GD+SKTLAVVNLDWD+V+S+DLM+TFSSF+P GG+I +
Sbjct: 121 EEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR 180

Query: 176 IAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXX-XXXXXIDVKDLYEEGDADKN 234
           I IYPSEFGKER+QREEVEGPPKELF                   +D+KDLYEEGDA+K+
Sbjct: 181 ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEKD 240

Query: 235 VDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFD 294
           VD+KA                         +IY NCDGTEYESTAN+FD+RYVPDGM FD
Sbjct: 241 VDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 300

Query: 295 GKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKA 354
            +P+D C  LPKNYKP+QFSTDALQHSNVKLTWDETPADR++VAKRAF+QKEIEDMDFKA
Sbjct: 301 DEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKA 360

Query: 355 YLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDE 414
           YLA             SK+KLK+LV  S   DF    A   DG + EVDMEITFTPGLDE
Sbjct: 361 YLASDSDESEEEVNENSKNKLKALVGES--LDFGTNGAS--DG-ESEVDMEITFTPGLDE 415

Query: 415 ANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSDIE 474
           A +  +E +E                            + E+            + ++ E
Sbjct: 416 AKESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKAETE 475

Query: 475 QD--PKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDD 532
            +   K+KA            TE+S+NKKAHFN+                     IV DD
Sbjct: 476 NEEAAKAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDD 535

Query: 533 FKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRV-----NSKRKIA 587
           FKPDL DPRFKE+FE HDFAIDP+Q EF+ T AMK++LN+RSK++        N KRK+ 
Sbjct: 536 FKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLD 595

Query: 588 TQENDTNENGDIANIV 603
           T  +   +N  I+NIV
Sbjct: 596 TSTSKNGKNA-ISNIV 610

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/621 (48%), Positives = 363/621 (58%), Gaps = 22/621 (3%)

Query: 2   SEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVED 61
           S K + D RFS IY+DPKF   K K  K+KLD+RFSKKDLEI+RK KVDKYGR++ +  D
Sbjct: 6   STKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKIHEDND 65

Query: 62  --SKESKDFDKYFE---QSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXXXXXXXXXXX 116
             +KE KDFDKYFE   +S            +TVDRARGEVP                  
Sbjct: 66  MNNKELKDFDKYFEKEGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSSESEDS 125

Query: 117 XXXXXXXXXXXX-XLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEK 175
                         +++  P +GD++KTLAVVNLDWD+VRSSDLMITFS FLP GG+IEK
Sbjct: 126 GESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKGGKIEK 185

Query: 176 IAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXID--VKDLYEEGDADK 233
           I + PSEFGKERMQREE EGPP+ELF                   D  +KDLYEEGDADK
Sbjct: 186 IVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKDLYEEGDADK 245

Query: 234 NVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDF 293
           +VD +A                         +IY NCDGTEYESTAN+FD+RYVPDGMDF
Sbjct: 246 DVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVPDGMDF 305

Query: 294 DGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFK 353
           D +P+D C+ LPKNYKP QFSTDALQHSNVKLTWDETPA+R++VAKRAFTQKEIEDMDFK
Sbjct: 306 DDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIEDMDFK 365

Query: 354 AYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFD----FTRKNADEVDGNDEEVDMEITFT 409
           AYLA             +K+KLKSLV  S        F  K  D ++G DEEVDMEITF 
Sbjct: 366 AYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSK--DTLEGEDEEVDMEITFD 423

Query: 410 PGLDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQ 469
           PGL E  +  +  + EE+TI+                   LK+ A+++           +
Sbjct: 424 PGLSEGVE--KTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGKK 481

Query: 470 TSD-IEQD---PKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXX 525
            +D  E D    KSKA            TE  INKKAHFNM                   
Sbjct: 482 HNDSTEGDASTAKSKAELELLMMDDEDDTETGINKKAHFNMKEILRSEKEKSKKGKYQDK 541

Query: 526 XXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHR--VNSK 583
             IV D+FKPDL DPRFKE+FE HDFAIDP++ EF+ T AMKE+L +RSK++ +     K
Sbjct: 542 RRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSSKNAQKKK 601

Query: 584 RKIATQENDTNENGDIANIVA 604
           R  +  +N  NE  DI+NIV+
Sbjct: 602 RSHSLMDNQANETSDISNIVS 622

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  495 bits (1274), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/619 (47%), Positives = 365/619 (58%), Gaps = 17/619 (2%)

Query: 2   SEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVED 61
           S K+S DPRFS IY DPKF N K K  K+KLDDRF K DL+IK K+KVDKYGR+++DV+D
Sbjct: 6   SMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKD 65

Query: 62  SKESKDFDKYFEQSXXXXXXX---XXXXILTVDRARGEVPXXXXXXXXXXXXXXXXXXXX 118
           +KE +DFDKYFE+               +  +DRARGEVP                    
Sbjct: 66  NKELEDFDKYFEKEDEEDKEEEIGTEAKVKVLDRARGEVPSDYESSSEEFTSSDSESSGE 125

Query: 119 XXXXXXXXXXXLEKT-EPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIA 177
                        +T +P SGDSSKTLAVVNLDWD V+S DLMITFSSFLP GG+IEKI 
Sbjct: 126 SEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKIC 185

Query: 178 IYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX-------IDVKDLYEEGD 230
           IYPSEFGKERM REEVEGPP+ELF                         +D+++LYEEGD
Sbjct: 186 IYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIRELYEEGD 245

Query: 231 ADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDG 290
           A+K+VD+KA                        ESIY NCDGTEYES+ANIFD+RYVPDG
Sbjct: 246 AEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYVPDG 305

Query: 291 MDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDM 350
            +FD +P+D C +LPKNYK  QF+TDALQHSNVKLTWDETPADR+++AKRAFTQKEIE+M
Sbjct: 306 TEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIEEM 365

Query: 351 DFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDE-EVDMEITFT 409
           DFKAYLA              K+KLKSLV+ S+         D+ D N+E +VDMEITFT
Sbjct: 366 DFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDVDMEITFT 425

Query: 410 PGLDEANKDGQEGQE-EESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXX 468
           PGL E  +DG E ++ EE+TI+                   LK Q+E +           
Sbjct: 426 PGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEKLKELKKE 485

Query: 469 QTS---DIEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXX 525
           +     +   D K+KA            +  ++NKKAHFNM                   
Sbjct: 486 RNGNGKNTNVDAKAKAELELLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGKKSKYQDK 545

Query: 526 XXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRK 585
             IV DDFKPDL DPRFKE+FE HDFAIDPTQSEF+ T AMKE+L +RS+++++  S  K
Sbjct: 546 NKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKERSRRSNKNKSNNK 605

Query: 586 IA-TQENDTNENGDIANIV 603
                 ND N+  +I+N+V
Sbjct: 606 RKHLSSNDNNQKKNISNLV 624

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  492 bits (1267), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/607 (47%), Positives = 353/607 (58%), Gaps = 25/607 (4%)

Query: 1   MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE 60
           MSE++S DPRFS+IY+DPKF    +K  K+KLDDRF KKDLE+ R+ KVDKYGR++++  
Sbjct: 1   MSEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGS 60

Query: 61  DSKESKDFDKYFEQSXXXXXXXXX------XXILTVDRARGEVPXXXXXXX---XXXXXX 111
            SK+ +DFDKYFE+                     VDRARGEVP                
Sbjct: 61  -SKDIEDFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSD 119

Query: 112 XXXXXXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGG 171
                              E+T+  +GD++KTLA VNLDWD+VRS D+M+TFSSFLP GG
Sbjct: 120 TSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGG 179

Query: 172 RIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX-IDVKDLYEEGD 230
           +IEKI IYPSEFGKERM+REEVEGPP+ELF                   +D+KDLYEEG+
Sbjct: 180 KIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGN 239

Query: 231 ADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDG 290
           AD  VD +A                        ++IY NCDGTEYESTANI D+RYVPDG
Sbjct: 240 ADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDG 299

Query: 291 MDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDM 350
           MDFD +PKD C ELPKNYKP QFSTDALQHSNVKLTWDETP DR++VAKRAFTQKEIEDM
Sbjct: 300 MDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDM 359

Query: 351 DFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTP 410
           DFKAYLA            ++K+KLKSLV  S   D  +  +DE    DE +DMEITFTP
Sbjct: 360 DFKAYLASDSDESEEEVNEEAKNKLKSLVGESLKID-GKDGSDE----DEGMDMEITFTP 414

Query: 411 GLDEANKDGQ--EGQE-EESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXX 467
           GLDEAN +G+  +G++ EE+TI+                   LK ++E++          
Sbjct: 415 GLDEANAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHD 474

Query: 468 XQTSDIEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXX 527
              SD       K             +   IN KAHFNM                     
Sbjct: 475 EPLSD------KKKAELELLMMDENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQR 528

Query: 528 IVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIA 587
           IV DDFKP+L+D RFKE+FE HDFAIDP+Q EF+ TKAMKE+L +R K++      ++  
Sbjct: 529 IVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKRSRDSKHGKEEH 588

Query: 588 TQENDTN 594
           T +ND N
Sbjct: 589 TDKNDIN 595

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  486 bits (1251), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 291/606 (48%), Positives = 354/606 (58%), Gaps = 15/606 (2%)

Query: 2   SEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVED 61
           SEK S D RF+ I  DPKF N +T+  K+KLD RFSKKDLE++ K+KVDKYGR+++D  +
Sbjct: 6   SEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARN 65

Query: 62  SKESKDFDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXX 121
           +KE +DFDKYFE+             + VDRARGEVP                       
Sbjct: 66  NKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPSDYVSSSDEFTSSDSESSGESEV 125

Query: 122 XXXXXXXXLEKTEPS-SGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP 180
                     +   + SGD SKTLAVVNLDWD+V+S DLMITFSSF+P GG+IE+IAI+P
Sbjct: 126 ESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFP 185

Query: 181 SEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX----IDVKDLYEEGDADKNVD 236
           SEFG+ERM+REEVEGPPKELF                      I + DLYEEGDADK+VD
Sbjct: 186 SEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDADKDVD 245

Query: 237 NKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGK 296
           ++A                        ++IY+NCDGTEYESTAN+FD+RYVPDGM FD  
Sbjct: 246 SRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDA 305

Query: 297 PKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYL 356
            +D CT LPKNY+P QFSTDALQHSNVKLTWDETPADRL+VAKRAFTQKEI+DMDFKAYL
Sbjct: 306 ARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYL 365

Query: 357 AXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDE-EVDMEITFTPGLDEA 415
           A             +K+KLKSLV G    DF  K     DG +E EVDMEITFTP L+  
Sbjct: 366 ASDSDESDEQVDEDAKNKLKSLVGG---LDFNMKKKGANDGKEEGEVDMEITFTPALEGE 422

Query: 416 NKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSD--- 472
           N+   EGQ +E+TI+                   LK Q+E+D             +D   
Sbjct: 423 NEKPIEGQ-DETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHVADEEE 481

Query: 473 IEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDD 532
           I+ + KSKA            TE S+N KAHF+M                     IV D 
Sbjct: 482 IKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDT 541

Query: 533 FKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQEND 592
           F PDLEDPRFKE+FE HDFAIDPTQ E++ T+AM  +L +R K+    + KRK +   ND
Sbjct: 542 FAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVK--DKKRKHSDNGND 599

Query: 593 TNENGD 598
             +NGD
Sbjct: 600 VAKNGD 605

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  471 bits (1211), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 283/608 (46%), Positives = 359/608 (59%), Gaps = 19/608 (3%)

Query: 8   DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKESKD 67
           D RFS +++DPKF N + K  K+KLD RFSK DLE+ RK +VDKYGR++ ++ +++E+KD
Sbjct: 10  DERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNL-NNQEAKD 68

Query: 68  FDKYFEQSXXXXXXXXXXXILTVDRARGEVPXXXXXXXX-XXXXXXXXXXXXXXXXXXXX 126
           FDKYFE+             L +DRARGEVP                             
Sbjct: 69  FDKYFEKEEDGKGEEIAVKPL-IDRARGEVPSDYQSSLDDYTSSESEDSEDEDLESEGES 127

Query: 127 XXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKE 186
              +E+T+P SGDSSKT+AVVNLDWD+V+++DL++TFSSF+P GG+IE+IAI+PSEFGK+
Sbjct: 128 EAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPSEFGKQ 187

Query: 187 RMQREEVEGPPKELFXXXXXXXXXXXXXXXX--XXIDVKDLYEEGDADKNVDNKAXXXXX 244
           RM+REE+EGPPKELF                    +D+ DLYEEGD DK VD+K+     
Sbjct: 188 RMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEGDVDKEVDSKSLRQYQ 247

Query: 245 XXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDSCTEL 304
                              E+IYNNCDGTEYESTAN+FD+RYVPDGMDF+ +P D CTEL
Sbjct: 248 LDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYDECTEL 307

Query: 305 PKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLAXXXXXXX 364
           PKNY PL F+TDALQHSNVKLTWDETPADR+++AKRAFTQKEI++MDFKAYLA       
Sbjct: 308 PKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYLA-SDSEES 366

Query: 365 XXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQEGQE 424
                + K+KLKSLV  S          ++ D  D EVDMEITFTPGL E + + +E + 
Sbjct: 367 EGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTPGLAENDNNDKEEEN 426

Query: 425 EESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXX---XXXXXXXXXQTSDIEQDPKSKA 481
           EE+TI+                   +K  +EQ+              ++ D E D  +KA
Sbjct: 427 EETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTERSKKSEDTESDKNAKA 486

Query: 482 XXXXXXXXXXXXTEKS-INKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLEDP 540
                          S INKKAHFNM                     IV D+FK DL DP
Sbjct: 487 ELELLMMDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDP 546

Query: 541 RFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQ-----AHRVNSKRKIATQENDTNE 595
           RF EMFE HDFAIDPTQSE++ T AMKE+L +RSK+     A+R + KRKI+  +     
Sbjct: 547 RFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRSTMKKANR-SEKRKISPSD---GS 602

Query: 596 NGDIANIV 603
             DI+NIV
Sbjct: 603 QKDISNIV 610

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 284/647 (43%), Positives = 359/647 (55%), Gaps = 46/647 (7%)

Query: 1   MSEKRSK-DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDV 59
           MSE++ K D RF+ ++ DPKF   K    KVKLD+RFSKKDL++  K+KVD+YGR++ D 
Sbjct: 1   MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID- 59

Query: 60  EDSKESKDFDKYF--------------------------EQSXXXXXXXXXXXILTVDRA 93
            + K+ KDFDKY+                                        +  +DRA
Sbjct: 60  RNEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRA 119

Query: 94  RGEVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXLEKTEPSSGDSSKTLAVVNLDWD 152
           RG+VP                                +E  +P +GD SKT+AVVNLDWD
Sbjct: 120 RGDVPSDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWD 179

Query: 153 NVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXX 212
           +V+S+DLMITFS F+P GG+I KIAIYPSEFGKERMQREE+EGPPKELF           
Sbjct: 180 HVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKST 239

Query: 213 XXXXX---XXIDVKDLYEEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNN 269
                     +D+ DLYEEGDADKN+D+K+                        ESIY N
Sbjct: 240 AEDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKN 299

Query: 270 CDGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDE 329
           CDGTEYESTAN+FDIRYVPD M FD  P+D C +LPKNYKPLQFSTDALQHSNVKLTWDE
Sbjct: 300 CDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDE 359

Query: 330 TPADRLDVAKRAFTQKEIEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFD--F 387
           TPADR++++KRAF+QKEI++MDFKAYLA             SK+KLKSLV G  AF   F
Sbjct: 360 TPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLV-GGGAFGNVF 418

Query: 388 TRKNADEVDGNDEE--VDMEITFTPGLDEANKDG-QEGQEEESTIDXXXXXXXXXXXXXX 444
            +    ++DG+D+E  VDMEITFTPGLDE  +    E ++EESTI+              
Sbjct: 419 GKDTEYDLDGSDDEDGVDMEITFTPGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRK 478

Query: 445 XXXXXLKHQAEQDXXXX---XXXXXXXQTSDIEQDPKSKAXXXXXXXXXXXXTE----KS 497
                LK ++ Q+                +++ +D K K              E      
Sbjct: 479 QKVKDLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISG 538

Query: 498 INKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQ 557
           +N KAHFNM                     IV D+FKP+L D RF E+FE H FAIDPTQ
Sbjct: 539 VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQ 598

Query: 558 SEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNEN-GDIANIV 603
            EF+ T AMKE+LN+R+K+A +  +K K   +  +TNE+  DI+NIV
Sbjct: 599 PEFKQTSAMKEILNERTKRASKKQNKDKDNKKRKNTNEDKSDISNIV 645

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  462 bits (1190), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 274/614 (44%), Positives = 347/614 (56%), Gaps = 25/614 (4%)

Query: 3   EKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDS 62
           EK ++DPRFS I++DPKF + K+K FK+KLDDRFSK+DLE++RK KVDKYGR++ D   +
Sbjct: 9   EKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA--N 66

Query: 63  KESKDFDKYFEQSX--------------XXXXXXXXXXILTVDRARGEVPXXXXXXXXXX 108
           K+ KDFD+YF +                            +VDRARGE P          
Sbjct: 67  KDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGE-PPADYVSSSDE 125

Query: 109 XXXXXXXXXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLP 168
                                LE+++P+SG+++ TLAVVNLDWD+V+S+DL +TF SF+P
Sbjct: 126 ESSSESEEESGDSDIESEEIELEESKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVP 185

Query: 169 AGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLYEE 228
            GG I+KIAIYPSEFGKERMQREE+EGPPKELF                  I+V+ +YEE
Sbjct: 186 KGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDE----INVESIYEE 241

Query: 229 GDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVP 288
           GDA+ + D+KA                        ESIY NCDGTEYESTAN+FD+RYVP
Sbjct: 242 GDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP 300

Query: 289 DGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIE 348
           DGM+ D  P+D CT LPKNYKP QFSTDALQHS VKLTWDETPADR++++KRAFTQKEIE
Sbjct: 301 DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE 360

Query: 349 DMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITF 408
           +MDFKAYLA            Q K+KLK+LV  S           + D +D E DMEITF
Sbjct: 361 EMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITF 420

Query: 409 TPGLDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXX 468
           TPGLDE+ +      EEESTID                   LK ++E             
Sbjct: 421 TPGLDESGQQDTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKENLKKKKDT 480

Query: 469 QTSDIEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXI 528
             S I+ D   K              E +IN KAHFNM                     I
Sbjct: 481 SHS-IDDD--KKKGELELLMLDENEGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKI 537

Query: 529 VVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIAT 588
           V D+F PD+ DPRFKE+FE HDFAIDPTQ EF+ T AM+++L +R+ ++ + +  +K   
Sbjct: 538 VDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSSKKSRGKKRNH 597

Query: 589 QENDTNENGDIANI 602
           +  +T  + DI  I
Sbjct: 598 EIANTEHSKDINKI 611

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  457 bits (1176), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/627 (43%), Positives = 343/627 (54%), Gaps = 50/627 (7%)

Query: 6   SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKES 65
           S DPRF+ + +DPKF   + K FK+KLDDRFSKKDLE KRK +VDKYGRR++  E SK+ 
Sbjct: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQE-SKDK 70

Query: 66  KDFDKYFEQSXXXXXXXXXXXI-----------------------LTVDRARGEVPXXXX 102
           +DFDKY+E+            +                       +++DRARGEV     
Sbjct: 71  RDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYV 130

Query: 103 XXXXXXXXXXXXXXXXXXX-XXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMI 161
                                       +E+ E  SGDSSKTLAVVNLDWD+V+S+DLM+
Sbjct: 131 SSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDLMV 190

Query: 162 TFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXID 221
           TFSSF+P GG+I ++AIYPSEFGKER+ +EE EGPP+E+F                  + 
Sbjct: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEE-LT 249

Query: 222 VKDLYEEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANI 281
           VKDLYEEGDAD + D K+                        ESIY NCDGTEYESTAN+
Sbjct: 250 VKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYESTANM 308

Query: 282 FDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRA 341
           FD+RYVPDGMDFD + +D C  +PKNY+P +FSTDALQHS VK TWDETPADR  +AKRA
Sbjct: 309 FDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKRA 368

Query: 342 FTQKEIEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGS------SAFDFTRKNADEV 395
           FTQ+EIEDMDFKAYLA            + K+KLKSLV  S      S FD      D  
Sbjct: 369 FTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD-----QDPK 423

Query: 396 DGNDEEVDMEITFTPGLDEANK-DGQEGQE-EESTIDXXXXXXXXXXXXXXXXXXXLKHQ 453
           DG + +VDM+ITF P L E    D  +G++ EE+T++                   LK Q
Sbjct: 424 DG-ESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQ 482

Query: 454 AEQDXXXXXXXXXXXQTSDIEQDPKSKAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXX 513
           AE D                  D KS+A                +NKKAHFNM       
Sbjct: 483 AEDDKKQKLKEARRKPEPSA-TDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIVRSE 541

Query: 514 XXXXXXXXXXXXXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKR 573
                         IV D+FKPDL DPRF E+FE HDFAIDP+Q EF+GT AMK++L +R
Sbjct: 542 KEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQER 601

Query: 574 SKQAHRVNSKRKIATQENDTNENGDIA 600
           +K++ +  +K++ A        NGDIA
Sbjct: 602 NKRSQKGKNKKREA--------NGDIA 620

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  455 bits (1170), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 281/630 (44%), Positives = 360/630 (57%), Gaps = 26/630 (4%)

Query: 1   MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVE 60
           MS+K S DPRFS +Y+DPKF + K K  KVKLD RFSKKDLE+K+K KVDKYGR++++ +
Sbjct: 1   MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGD 60

Query: 61  -DSKESKDFDKYFEQSXXXXXXXXXXXI-----LTVDRARGEVPXXXXXXXXXXXXXXXX 114
            + KE +DFDKYFE+                  + VDRARGEVP                
Sbjct: 61  ANKKELEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSE 120

Query: 115 XXXXXXXXXXXXXXXLE------KTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLP 168
                          +E        +P SGD SKTLAVVNLDWD+V+S DLMITF+ F+P
Sbjct: 121 SSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIP 180

Query: 169 AGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXX---------XXXXXXXXXXXX 219
            GG+IE+I IYPSEFGKER+ REE EGPPKELF                           
Sbjct: 181 KGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSD 240

Query: 220 IDVKDLYEEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTA 279
           +D+KDLYEEGDA+K++D+KA                        ++IY+NCD TEYESTA
Sbjct: 241 VDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300

Query: 280 NIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAK 339
           N+FD+RYVP+GM FD  P+D C  LPKNYKPL F+TDALQHSNVKLTWDETPADR+++AK
Sbjct: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360

Query: 340 RAFTQKEIEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGND 399
           RAF+QKEI+DMDFKAYLA              K++LK+LV G+      +  A+E + ++
Sbjct: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDE 420

Query: 400 EEVDMEITFTPGLD-EANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDX 458
           E +DMEITFTPGLD     + +   EEESTID                   LK  AE++ 
Sbjct: 421 EGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEK 480

Query: 459 XXXXXXXXXXQTSDIEQ--DPKSKAXXX--XXXXXXXXXTEKSINKKAHFNMXXXXXXXX 514
                     + +  E+  D K+KA              ++ ++NKK HFNM        
Sbjct: 481 RDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEK 540

Query: 515 XXXXXXXXXXXXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRS 574
                        IV D+FKPDL D RFKE+FE HDFAIDP++ EF+ T AM+++L +RS
Sbjct: 541 EKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERS 600

Query: 575 KQAHRVNSKRKIATQENDTNENGDIANIVA 604
            +A     KRK A Q  DT++  DI+ IV+
Sbjct: 601 NRARSKGKKRKSAEQSTDTSDKTDISQIVS 630

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  450 bits (1158), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 261/622 (41%), Positives = 344/622 (55%), Gaps = 24/622 (3%)

Query: 1   MSEKRSK------DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGR 54
           MS+KR K      D RF+ I++DPKF   K    K+ LDDRFSKKDLE KRK KVDKYGR
Sbjct: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60

Query: 55  RMRDVEDSKESKDFDKYFE--------QSXXXXXXXXXXXILTVDRARGEVPXXXXXXXX 106
           R+    D KE+KDFD+YF         QS           +  +DRARGEVP        
Sbjct: 61  RIGSY-DEKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSD 119

Query: 107 XXXXXXXXXXXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSF 166
                                  +E+++P +GD +K  AVVNLDWD+VRS DL+ TF+SF
Sbjct: 120 ENSSSESEEESEDSALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSF 179

Query: 167 LPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLY 226
           +P GG I+K+AIYPSEFGKERM+REEVEGPP+ELF                  ID+ DLY
Sbjct: 180 VPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSD-IDINDLY 238

Query: 227 EEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRY 286
           E  DA+K+ D+KA                        ++IY NCDGTE+ESTAN+FD+RY
Sbjct: 239 EVDDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRY 298

Query: 287 VPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKE 346
           VPD M F+  P+D C  +PK+YKP QFST ALQHS VKLTWDETPADR++++KRAF QKE
Sbjct: 299 VPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKE 358

Query: 347 IEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEI 406
           IE+MDFKAYLA            ++K+ L+SLV  S       K+  +  G++EE D+EI
Sbjct: 359 IEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDS--IQVAHKSVFDKHGSEEEADVEI 416

Query: 407 TFTPGLDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXX 466
           TFTPGL+  +   +E  EEE+ +D                   LK QA  +         
Sbjct: 417 TFTPGLENGDAPKEEN-EEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGD 475

Query: 467 XXQTSDIEQDPKSKAXXXXXXXXXXXXTEK--SINKKAHFNMXXXXXXXXXXXXXXXXXX 524
               ++ E++ + K             T K  ++N  AHFNM                  
Sbjct: 476 DGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQN 535

Query: 525 XXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVN--- 581
              IV D+FKPDL DPRFKE+FE HDFAIDP+Q EF+ T AMKE+L +R++++ ++    
Sbjct: 536 KNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595

Query: 582 SKRKIATQENDTNENGDIANIV 603
           +KRK +     + +   + ++V
Sbjct: 596 NKRKASYDHPQSGQTDSLNSLV 617

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  443 bits (1140), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 276/633 (43%), Positives = 350/633 (55%), Gaps = 46/633 (7%)

Query: 6   SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKES 65
           S DPRF+ ++ DPKF   K K FK+KLDDRFSKKDL+ KRK +VDKYGR ++  E+ K+ 
Sbjct: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQEN-KDK 70

Query: 66  KDF-----------------------DKYFEQSXXXXXXXXXXXI--LTVDRARGEVPX- 99
           KDF                       D   E +           +  +++DRARGEVP  
Sbjct: 71  KDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSD 130

Query: 100 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDL 159
                                         +E T+P SGDSSKTLAVVNLDWD+V+S+DL
Sbjct: 131 YVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDL 190

Query: 160 MITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXX 219
           MITFSSF+P+GG+I KIA+YPSEFGKER++REE+EGPP+E+F                  
Sbjct: 191 MITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDV 250

Query: 220 IDVKDLYEEGDADKNVDNKAXXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTA 279
                LYEEGDA+ + D K+                        E+IY NCDGTE+ESTA
Sbjct: 251 DVRD-LYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFESTA 308

Query: 280 NIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAK 339
           N+FD+RYVPDGM FD + +D CT +PKNY+P QFSTDALQHS VKLTWDETPADR+ ++K
Sbjct: 309 NMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMSK 368

Query: 340 RAFTQKEIEDMDFKAYLAXXXXXXXXXXXAQSKSKLKSLVTGS------SAFDFTRKNAD 393
           RAFTQKEIEDMDFKAYLA              K+KLKSLV+ S      S FD     A 
Sbjct: 369 RAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFD----QAP 424

Query: 394 EVDGNDEEVDMEITFTPGLDEANKDGQEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQ 453
           E   +D  VDM+ITF PGL E  +D ++   EE+T++                   LK Q
Sbjct: 425 EEGESD--VDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQ 482

Query: 454 AEQDXXXXXXXXXXXQTSDIEQDPKSKAXXXXXXXXXXXXTEKS-INKKAHFNMXXXXXX 512
           AE++             S +E D KSKA               S +NKKAHFNM      
Sbjct: 483 AEEEKKQKRKESRYKPESTVE-DAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRS 541

Query: 513 XXXXXXXXXXXXXXXIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNK 572
                          IV D+FKPDL DPRF E+FE  DFAIDP+Q EF+GT AMK++L +
Sbjct: 542 EKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQE 601

Query: 573 RSKQAHRVNSKRKIATQENDTNENG--DIANIV 603
           R+K++H+  +K++ A   N  N+NG  D+  +V
Sbjct: 602 RTKRSHKGQNKKRKADG-NLANQNGQSDLKGLV 633

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  428 bits (1101), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 264/607 (43%), Positives = 347/607 (57%), Gaps = 14/607 (2%)

Query: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63
           K S D RF++I  DPKF   K K  K+KLDDRFSK+DLE KRK KVDKYGRR+      K
Sbjct: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI-GTAPGK 68

Query: 64  ESKDFDKYFEQSXXXXXXXXX----XXILTVDRARGEVPXXXXXXXXXXXXXXXXXXXXX 119
           E KDF+KYF +                +  +DRARGEVP                     
Sbjct: 69  EEKDFEKYFTKESSESAAEESDKEDSSVAKLDRARGEVPADYVSSSDEESSSESEADSDD 128

Query: 120 XXXXXXXXXXLEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIY 179
                     +E+ +P SGD SK LAVVNLDWD+V+ +DL++ F+SF+P GG+IE++AIY
Sbjct: 129 ATAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIY 188

Query: 180 PSEFGKERMQREEVEGPPKELFXXXXXXXXXXXXXXXXXXIDVKDLYEEGDADKNVDNKA 239
           PSEFGKERMQREEVEGPP+E+F                  I +KDLYE+GDA+K+ D+KA
Sbjct: 189 PSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDE---IGLKDLYEQGDAEKDYDSKA 245

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKD 299
                                   E+IY NCDGTEYESTAN+FD+RYVP+G+ FD +P++
Sbjct: 246 LRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPRE 305

Query: 300 SCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLAXX 359
            C  +PK+YKP+QFST ALQH  VKLTWDETPADR+++AKRAF+QKEIEDMDFKAYLA  
Sbjct: 306 ECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASD 365

Query: 360 XXXXXXXXXAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDG 419
                    +++K+KL+SLV+     D     ADE D  +EE D++ITFTPGL E  +  
Sbjct: 366 SEESEADDNSEAKNKLRSLVSSVKVAD-KPLFADESD--EEEADVQITFTPGL-EGGEAK 421

Query: 420 QEGQEEESTIDXXXXXXXXXXXXXXXXXXXLKHQAEQDXXXXXXXXXXXQTSDIEQDPKS 479
           +E  EEE+ ++                   LK QAE++           ++   ++    
Sbjct: 422 EEDAEEENILEKLKRKEKERRKKRKERVKELKKQAEEEKKSSKKEKHASKSESEQKSEND 481

Query: 480 KAXXXXXXXXXXXXTEKSINKKAHFNMXXXXXXXXXXXXXXXXXXXXXIVVDDFKPDLED 539
           K               +SIN  AHFNM                     IV DDFKPDL D
Sbjct: 482 KRAELELLMMEDDENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLND 541

Query: 540 PRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDT--NENG 597
           PRFKE+FE  DFAIDP+Q EF+ T AMK++L +R K++ +  SK++   +++D+  +  G
Sbjct: 542 PRFKEVFEDRDFAIDPSQPEFKETAAMKQILQERRKRSSKSASKKRKTDEQSDSAMDSAG 601

Query: 598 DIANIVA 604
           D+  +VA
Sbjct: 602 DLKGLVA 608

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 537 LEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNS 582
           L D RFKEMFE  +F +D T  +F+    +K +       A R+ +
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSLRETEEGAAKRIRA 522

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,308,191
Number of extensions: 1960712
Number of successful extensions: 6189
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6228
Number of HSP's successfully gapped: 65
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)