Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019405.431ON56756729990.0
ZYRO0F09966g5.431ON55455015030.0
YOR118W (RTC5)5.431ON56757114460.0
SAKL0G02464g5.431ON56355214440.0
Suva_8.1715.431ON56756814430.0
NCAS0H020505.431ON57358014210.0
Smik_15.2965.431ON56656814070.0
Skud_15.2815.431ON56755614010.0
NDAI0C016105.431ON58458913820.0
KLLA0E21143g5.431ON57258012681e-169
Kpol_1016.75.431ON56257212631e-168
KLTH0F16126g5.431ON55455212371e-164
Kwal_55.214375.431ON55455112361e-164
TPHA0H017905.431ON56557111581e-152
KNAG0B042305.431ON57758011561e-152
CAGL0L11616g5.431ON55557211221e-147
Ecym_47645.431ON56658110881e-142
AER258C5.431ON5575759121e-115
TBLA0A065305.431ON4925287652e-94
TDEL0C048203.340ON1009118723.5
TDEL0E004302.8ON96795714.9
TDEL0D00170singletonON33641688.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01940
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...  1159   0.0  
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   583   0.0  
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   561   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   560   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   560   0.0  
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   551   0.0  
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   546   0.0  
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   544   0.0  
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   536   0.0  
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   493   e-169
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   491   e-168
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   481   e-164
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   480   e-164
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   450   e-152
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   449   e-152
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   436   e-147
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   423   e-142
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   355   e-115
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   299   2e-94
TDEL0C04820 Chr3 (872071..875100) [3030 bp, 1009 aa] {ON} Anc_3....    32   3.5  
TDEL0E00430 Chr5 (99878..102781) [2904 bp, 967 aa] {ON} Anc_2.8 ...    32   4.9  
TDEL0D00170 Chr4 complement(25816..26826) [1011 bp, 336 aa] {ON}       31   8.2  

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score = 1159 bits (2999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/567 (98%), Positives = 558/567 (98%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60

Query: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120
           RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH
Sbjct: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120

Query: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180
           KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP
Sbjct: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180

Query: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240
           ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS
Sbjct: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240

Query: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300
           VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL
Sbjct: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300

Query: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSKKNS 360
           ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSKKNS
Sbjct: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSKKNS 360

Query: 361 RYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPT 420
           RYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPT
Sbjct: 361 RYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPT 420

Query: 421 QDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGY 480
           QDVFKAASNEVMYFNTL         QPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGY
Sbjct: 421 QDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGY 480

Query: 481 GGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNI 540
           GGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNI
Sbjct: 481 GGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNI 540

Query: 541 NLRSFGEDRALLEMAGLVGHSQNGGSM 567
           NLRSFGEDRALLEMAGLVGHSQNGGSM
Sbjct: 541 NLRSFGEDRALLEMAGLVGHSQNGGSM 567

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/550 (51%), Positives = 397/550 (72%), Gaps = 12/550 (2%)

Query: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79
            FTSNS++++ F+ RA+  FT TEL +FK+KL GK L + + +EELT+WL +P + +LL 
Sbjct: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73

Query: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139
           E +Y FV+VL NFPLMK+S+++VTG+G+LK+++LTNP +C KYV  +NYD +KL FIALS
Sbjct: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133

Query: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199
           +RK+VKE+P+ SSS+S E+      +L+T++ + V++L++P   +V  ++WLLILT+YCP
Sbjct: 134 IRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193

Query: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYSVKFEQFSKAISTVMPNIFR 259
            +NC+     ++  W S+  +A  +LR+M        ES  +++E F+  + ++ P+IF 
Sbjct: 194 INNCKLENVAMFDNWNSYIKSAHTILRSMR----PMDESSWIEYEPFAHTMRSIAPHIFD 249

Query: 260 ALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLYVG 319
            L  VMEHLL++D +LV   S + G I +SK    A+LAQ+ +ALS ++     Q LY+G
Sbjct: 250 PLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLYLG 309

Query: 320 RESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSKKNSRYRDFLSKYPKLK--DRDQ 377
           R+ GFSMRS QAKVFKW APT+MLL GK +LDDE++S KN+R+R FL +YPKLK  D D 
Sbjct: 310 RDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDT 369

Query: 378 HLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNTL 437
            + ++   K+K++ AVY+ +PWK TNK++FGG  TTIVQLSP Q+VF ++    +YFNT+
Sbjct: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTI 429

Query: 438 XXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNRED 497
                    QP IK+  KSYSPGNVSLT+DS LEFA  RH G GG   PGL++      D
Sbjct: 430 GGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVG-----D 484

Query: 498 DPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAGL 557
             FE+K L+QDVEVWGCGG++ELEEQ K+W+WEE+EAKRRQ INLRS GEDRALLEMAGL
Sbjct: 485 KDFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGL 544

Query: 558 VGHSQNGGSM 567
           VG +Q+GGS+
Sbjct: 545 VGQAQSGGSV 554

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/571 (49%), Positives = 387/571 (67%), Gaps = 8/571 (1%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQ++S+   + E     ++FT++ +++ +F+ +A    T  EL +FK  L+ + L  P+
Sbjct: 1   MGQSSSISSSNEEGSSHSKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60

Query: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120
             + L   L  P  + ++   V   +RVLSNFPLMK S++ +TG GLLK +LL N ++C 
Sbjct: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120

Query: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSI---NLLRTYNNIVVDDL 177
           K++  K+YD +KLLFI+LS++K+ KEE S  S     DG   +    ++  ++++  + L
Sbjct: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESEN---DGNKELTIKQIITGFDDVDTEML 177

Query: 178 AIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLE 237
            IPA  ++Q L WLLILT  CPT+N +      + +WG+FK++A NLLRTMN ++V ++E
Sbjct: 178 CIPADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIE 237

Query: 238 SYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVL 297
           S+S+ F+QFS AI TVMPN+ + L+N+MEH  Y   DLV   +N +  I  SK  T A+L
Sbjct: 238 SHSITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSS-IQDSKVMTPALL 296

Query: 298 AQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS- 356
           AQL T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + E+++ 
Sbjct: 297 AQLSTGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAA 356

Query: 357 KKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQ 416
           +KN RYR FL ++PKLK+ DQ +     NK K  FAVYI +PWK TNKDYFG   T I++
Sbjct: 357 EKNPRYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIE 416

Query: 417 LSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFR 476
           +SP QD++K      +YFNT+         QP IK   K Y PGNVSLT DSTLEFA FR
Sbjct: 417 ISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFR 476

Query: 477 HVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKR 536
           + GYGG+ +PGLL  +   E+ P+E+ FLIQDVEVWGCGG++ELEEQ K+ +WEEAE+KR
Sbjct: 477 NTGYGGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKR 536

Query: 537 RQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           RQ INLRS GEDRALLEMAGLVG  Q GGSM
Sbjct: 537 RQQINLRSLGEDRALLEMAGLVGQHQGGGSM 567

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/552 (51%), Positives = 384/552 (69%), Gaps = 9/552 (1%)

Query: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79
           QF S  +L+ +F  RA   FT  EL AFKS L+GK   D V  EE+ + L+IP  N LL 
Sbjct: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76

Query: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139
           + ++  ++ LSNFPL+++S+DD+T  GLLKS +L +  +C KYVG KNYD +KL++IAL+
Sbjct: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136

Query: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199
           +RK+VKE PS        D     +++R YN++ +DDL +PA S++QLL   L+L+ +C 
Sbjct: 137 LRKTVKELPSSPDPAKPWDAK---SIIRNYNSVDIDDLYVPADSMLQLLTLSLVLSRHCT 193

Query: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS--VKFEQFSKAISTVMPNI 257
            +N +  E V +  W  +K  A NLLRTMN +IV   ++    + FEQFS AI+ V P +
Sbjct: 194 VNNAKIRESV-FQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252

Query: 258 FRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLY 317
            + L+ ++EH+LY D DL    ++++ P  TSK  T+ +LAQL T L  E+ ++K + LY
Sbjct: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPS-TSKLVTEPLLAQLSTMLPKELVYSKLRKLY 311

Query: 318 VGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDF-SKKNSRYRDFLSKYPKLKDRD 376
           VGRESGFSMRS Q+K FKWMAP+++L+ G  + DD+++ + KN RY+ FL +YP+LKD+D
Sbjct: 312 VGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKD 371

Query: 377 QHLSD-LQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFN 435
           QH+ D    N+ K++FAVY+ EPWK TNK+ FG   TT+VQLSP Q++FKA     +YFN
Sbjct: 372 QHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFN 431

Query: 436 TLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNR 495
           TL         QP IK   K Y PGNVSLTIDS+LEFA+FRHVGYGG  +PG L+T+   
Sbjct: 432 TLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEE 491

Query: 496 EDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMA 555
           E   FE KF++QDVEVWGCGG++EL+EQ K+W+WEEAEAKRRQ INL+S GEDRALLEMA
Sbjct: 492 EKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMA 551

Query: 556 GLVGHSQNGGSM 567
           GLVG  Q+GGSM
Sbjct: 552 GLVGQHQSGGSM 563

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/568 (48%), Positives = 383/568 (67%), Gaps = 2/568 (0%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQ++S    + E     R+FT+N +++ +F+ +A    T  EL + K  L+ + +  P+
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPI 60

Query: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120
             + L   L  P ++ LL   V   +RVLSNFPLM  S++ +TG GLLK +LL N  +C 
Sbjct: 61  SHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCG 120

Query: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180
           KY+  K+YD +KLLFI+LS++K+ KEE S  +  +++       ++  ++++  + L +P
Sbjct: 121 KYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVP 180

Query: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240
           A  ++Q L+WLLIL+  CPTSN +     +Y +W SFK++A NLLRTMN ++V+N ES+ 
Sbjct: 181 ADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTESHL 240

Query: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300
           + F+QFS +I TVMPN+ + L+N+MEH  Y ++DLV++ + S   +  S+  T A+L QL
Sbjct: 241 ITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDT-SLSSVRDSRIMTPALLTQL 299

Query: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS-KKN 359
            T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + ++++ +KN
Sbjct: 300 STVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKN 359

Query: 360 SRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSP 419
            RYR FL ++PKLKD DQ +     NK K  FAVYI +PWK TNKDYFG   T I+Q+SP
Sbjct: 360 PRYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISP 419

Query: 420 TQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVG 479
            QD++K      +YFNT+         QP IK   K + PGNVSLT DSTLEFA FRH G
Sbjct: 420 RQDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTG 479

Query: 480 YGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQN 539
           YGG+  PG L  +   ED  FE+ FLIQDVEVWGCGG++ELEEQ K+  WEEAE+KRRQ 
Sbjct: 480 YGGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQ 539

Query: 540 INLRSFGEDRALLEMAGLVGHSQNGGSM 567
           INLRS GEDRALLEMAGLVG ++ GGSM
Sbjct: 540 INLRSLGEDRALLEMAGLVGQNRGGGSM 567

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/580 (48%), Positives = 377/580 (65%), Gaps = 20/580 (3%)

Query: 1   MGQNASVQQDH-AEIGHEKRQ-----FTSNSELMEFFDKRAVHMFTATELAAFKSKL--- 51
           MGQ  S  Q+  + +  E +Q     F S  EL E F +R +  FT  EL AFK K+   
Sbjct: 1   MGQTPSSNQNEPSHLKEEGKQYKGITFNSEEELRESFKRRILCHFTPLELVAFKKKIGHE 60

Query: 52  --EGKTLKDPVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLK 109
             + +   + +   ELT  L +P ENVLL +  Y+ + +LSNFPL+++   +VT +GLL 
Sbjct: 61  QTDSEAGVEYISKNELTNLLHLPRENVLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLM 120

Query: 110 SVLLTNPSKCHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTY 169
            ++L +  +CH+++G   YD + L+FIA+S+  + K  P   +   L        LLRT+
Sbjct: 121 CIILLSKERCHRFIGSNTYDQLGLIFIAMSLDYADKLLPYARTPKKL----NVEELLRTF 176

Query: 170 NNIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQF-PEDVVYAEWGSFKLAATNLLRTM 228
           +NI +D+L IPA  L+Q L+W L+L   CPTSNCQ  P +  Y  W S++ AA N++R+M
Sbjct: 177 DNIPIDELEIPAPVLLQFLSWGLLLLIKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSM 236

Query: 229 NNNIVTNLESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILT 288
           + +I+ NL    + + QFS     V+PN    L+++M HLLY DSDL+    +   P+  
Sbjct: 237 DQSIIRNLTDVRINYTQFSDVFKAVLPNFTTPLESLMGHLLYMDSDLID---HETMPMNN 293

Query: 289 SKPTTQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKC 348
           SK  ++ +LAQL T L  E+  +K Q LYVGRESGFSMRSLQ+K F W AP+++L+SG  
Sbjct: 294 SKLMSEPLLAQLATVLPKELFLSKLQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSGML 353

Query: 349 VLDDEDFSK-KNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYF 407
           + DD  ++K KN RY  FL +YPKLK+  QHL      + K  FAVYI +PW+ TNK++F
Sbjct: 354 ISDDLQYAKEKNPRYGKFLEQYPKLKEEQQHLDACHSQRKKATFAVYIDDPWRVTNKEFF 413

Query: 408 GGSGTTIVQLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTID 467
           G   + I+QL+P QDVF A+   ++YFNT+         QP I N  K Y PGNVSLTID
Sbjct: 414 GSMNSMIIQLAPRQDVFHASKPNMIYFNTVGGGIGFGNKQPLISNAHKKYIPGNVSLTID 473

Query: 468 STLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKW 527
           STLEFA FRH+GYGG F P  LLT+  +ED+ FEIKF+IQDVEVWGCGG++EL+EQ KK 
Sbjct: 474 STLEFAVFRHIGYGGAFKPSALLTKRGKEDESFEIKFIIQDVEVWGCGGEKELQEQIKKL 533

Query: 528 QWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           +WEEAEAKRRQ+INL+S GEDRALLEMAGLVG SQ+GGSM
Sbjct: 534 EWEEAEAKRRQHINLKSLGEDRALLEMAGLVGQSQSGGSM 573

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/568 (47%), Positives = 378/568 (66%), Gaps = 3/568 (0%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQ++S+  ++ E     R+F ++ +++ +F+ +A    T  EL + K  L+ + L  P+
Sbjct: 1   MGQSSSISSNNEEGSSHSRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60

Query: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120
             + L  +L  P  + ++   V   +RVLSNFPL+  S++ +TG GLLK ++L N S+C 
Sbjct: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120

Query: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180
           K++ +K+YD +KLLFI+LS++K+ KEE S  +  +         ++  ++++  + L +P
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180

Query: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240
           A  ++Q L WLLIL+  CPT+N     +    +W  FK+ A NLLRTMN ++V N+ES+ 
Sbjct: 181 ADFMLQFLTWLLILSVECPTTNSTINNET-NVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239

Query: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300
           + ++QFS AI TVMPN+ + L+N+MEH LY   DLV + +N +  I  SK  T A+LAQL
Sbjct: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSS-IQDSKIMTPALLAQL 298

Query: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS-KKN 359
            T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + E+++  KN
Sbjct: 299 STGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKN 358

Query: 360 SRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSP 419
            RYR FL ++P LKD DQ +     NK K  FAVYI +PWK TNKDYFG   T I+Q+SP
Sbjct: 359 PRYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISP 418

Query: 420 TQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVG 479
            QD++K      +YFNT+         QP IK+  K Y PGNVSLT DSTLEFA FR+ G
Sbjct: 419 RQDIYKVNKKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTG 478

Query: 480 YGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQN 539
           YGG+ +PGLL  +   E+  FE+  LIQDVEVWGCGG++ELEEQ K+  WEEAE+KRRQ 
Sbjct: 479 YGGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQ 538

Query: 540 INLRSFGEDRALLEMAGLVGHSQNGGSM 567
           INLRS GEDRALLEMAGLVG  Q GGSM
Sbjct: 539 INLRSLGEDRALLEMAGLVGQHQGGGSM 566

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/556 (48%), Positives = 377/556 (67%), Gaps = 2/556 (0%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQ++SV   + E     ++FT+N +++ +F+ +A    T  EL +FK  L+ + L  P+
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60

Query: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120
             + L   L  P  + ++   V   +RVLSNFPL+  S++ +TG GLLK +LL N ++C 
Sbjct: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120

Query: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180
           K++ +K+YD +KLLFI+LS++K+ KEE S  +  ++        ++  ++++  + L +P
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLP 180

Query: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240
           A  ++Q L+WLLIL+   PT+N +   D  Y +W +FK++A NLLRTMN ++V+N+ES+ 
Sbjct: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240

Query: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300
           + FEQFS AI TVMPN+F+ L+N+MEH  Y D+DLVS  +N +  I  S+  T A+LAQL
Sbjct: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSS-IQDSRIMTPALLAQL 299

Query: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS-KKN 359
            T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + ++++ +KN
Sbjct: 300 STGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKN 359

Query: 360 SRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSP 419
            RYR FL ++PKLKD DQ +     +K K  FAVYI +PWK TNKDYFG   T I+Q+SP
Sbjct: 360 PRYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISP 419

Query: 420 TQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVG 479
            QD++K      +YFNT+         QP IK   K Y PGNVSLT DSTLEFA FRH G
Sbjct: 420 RQDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTG 479

Query: 480 YGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQN 539
           YGG  +PGLL  +   E+  FE+ FLIQDVEVWGCGG++ELEEQ K+  WEEAE+KRRQ 
Sbjct: 480 YGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQ 539

Query: 540 INLRSFGEDRALLEMA 555
           IN RS GEDRALLEMA
Sbjct: 540 INFRSLGEDRALLEMA 555

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/589 (44%), Positives = 389/589 (66%), Gaps = 27/589 (4%)

Query: 1   MGQN-ASVQQDHAEIGHEKR-QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKD 58
           MGQ+ +S ++ + +  +EK  QF +  E+ ++F KR +  FT  EL ++K+KL    L D
Sbjct: 1   MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDD 60

Query: 59  PVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSK 118
            +  EE+ + L +P +NV+L   ++  V  L NFP + +   D+T   LL  ++L +  +
Sbjct: 61  MITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDR 120

Query: 119 CHKYVGVKNYDHMKLLFIALSM-------------RKSVKEEPSCSSSTSL---EDGGGS 162
           C +++G K+YD +KLLFI L +                ++E+    S+TS+   E G   
Sbjct: 121 CQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNL 180

Query: 163 INLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQ-FPEDVVYAEWGSFKLAA 221
            ++L++YN I +DDL++PA SL +   W LI++  CPT+NC+  P + +Y  W  ++ A+
Sbjct: 181 TDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKAS 240

Query: 222 TNLLRTMNNNIVTNLESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSN 281
            N+LR+M+++IV+NL+ Y + F QF    ++V+PN    L+N+M HLLY D DL++ P  
Sbjct: 241 LNILRSMDSSIVSNLDDYRISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHP-- 298

Query: 282 SAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTV 341
               I  SK  ++++LAQL T L  E+  +K Q LY+GR+SGFSMRSLQ+K FKW+APT+
Sbjct: 299 -VMEIPKSKLMSESLLAQLSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTI 357

Query: 342 MLLSGKCVLDDEDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKT 401
           +L+SG  + +DE+++  N R++ FL ++PKL D +Q L      K K+ FAVYI EPW+ 
Sbjct: 358 LLVSGLIIPNDEEYN--NPRFKRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPWRV 415

Query: 402 TNKDYFGGSGTTIVQLSPTQDVFKA-ASNEVMYFNTLXXXXXXXXXQPHIKNGVKS--YS 458
           TNK++FG   + I++LSP QD+FK+  S+E++YFNT+         QPH+ NG  S  Y 
Sbjct: 416 TNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQ 475

Query: 459 PGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKE 518
           PGNVSLT++STLEFA FRHVG+GG F+P  LLT+   E++ FEIKF+IQDVEVWGCGG++
Sbjct: 476 PGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEK 535

Query: 519 ELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           ELEEQ K+  WEEAEAKRRQ +NL+S  EDRALLEM GLVG  Q+GGSM
Sbjct: 536 ELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  493 bits (1268), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 269/580 (46%), Positives = 369/580 (63%), Gaps = 21/580 (3%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKL-EGKTLKDP 59
           MGQ+ S + ++A     K +  S   LM+FF+ R +   T  EL +FK+ + EGK L D 
Sbjct: 1   MGQSTSKEHENARTNESKLKGES---LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57

Query: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKC 119
           V   +++R   IP ++ ++          L+NFPL++DS++ VT   LLK+ LL    + 
Sbjct: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEKVTFKTLLKATLLLVKERA 117

Query: 120 HKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAI 179
            KY   K Y+ +K+LFI LS+ K++K EP   SS +L D      ++R+YN    D+L +
Sbjct: 118 IKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSS-ALSDCKDWKGVIRSYNGTDFDELKV 176

Query: 180 PATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NLE 237
            A +L+  LA +L L+  C  +NC+   DV+      FK  A N++RTMN  I++  +  
Sbjct: 177 NANNLLHFLALILALSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCL 236

Query: 238 SYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPT---TQ 294
             S+ + QFS A++ V PN+   L+ +MEH+LY D DLV   ++   PI  S PT    +
Sbjct: 237 DSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVD--ADVLQPI--SNPTKIVNE 292

Query: 295 AVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDED 354
           + L+QL T L  E+ F++FQ LYVGRESGFSMRS Q+KVFKWMAPT++ + G  + D++D
Sbjct: 293 SELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDD 352

Query: 355 -----FSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGG 409
                ++ KN RYR+FL +Y KLK  DQHL  L K K K++FAV I +PWK +NKD FG 
Sbjct: 353 EDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGD 412

Query: 410 SGTTIVQLSPTQDVFKAASNEV--MYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTID 467
           S T I+QL P Q++F A   +   +YFNT+         QP IK   K Y PGNVSLTID
Sbjct: 413 SSTKIIQLHPRQEIFDADPFKTGNVYFNTVGGGIGIGSSQPIIKANGKKYFPGNVSLTID 472

Query: 468 STLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKW 527
           S+LEF  FRH+G GG+F PG L++    E + FE +F+IQDVEVWGCGG++ELEEQ K+W
Sbjct: 473 SSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQW 532

Query: 528 QWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           QWEEAEAKRRQ INL+S GEDRALLEMAGLVG  Q+GGS+
Sbjct: 533 QWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  491 bits (1263), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 248/572 (43%), Positives = 359/572 (62%), Gaps = 15/572 (2%)

Query: 1   MGQNASVQ-QDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDP 59
           MGQ  SV+ Q+  E  +E  +  S  ++++FF+ R++ +    E+  FKS+L  K L DP
Sbjct: 1   MGQTPSVESQESKETKNEMPELKSREDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDP 60

Query: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKC 119
           +  +E    LRI   N  L   ++ F   +S FP + +  + +TG G+LK ++L    + 
Sbjct: 61  LTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRERI 120

Query: 120 HKYVGVKNYDHMKLLFIALSMRK--SVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDL 177
            KY+G  N   +KL+FI L+ ++   VK E S              ++L T + I +   
Sbjct: 121 KKYLGWSNAKLIKLIFIGLTSQEKVGVKTEASVFKIQ---------HVLDTLDGIDLASS 171

Query: 178 AIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLE 237
            +  T ++  + WLL+L+ +CPTSNC+  E  +Y +W  +++ A++++R+MN  I T  +
Sbjct: 172 TVKDTDMLSFITWLLLLSVHCPTSNCKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGK 231

Query: 238 SYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVL 297
              + +  FS  I  V  N+   L+N++EH+LY+  DL+ FP      +  +K  T  ++
Sbjct: 232 GIGISYSDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTF-LKETKLMTYPLV 290

Query: 298 AQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSK 357
           AQL T L NE+  ++ Q LYVGRESG+SMRSLQ+KVF W A T++L+SG  ++DD ++S+
Sbjct: 291 AQLCTVLPNEIVMSQLQKLYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSE 350

Query: 358 -KNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQ 416
            KN RY+ FL +YPKLKD DQ + D    K KV FAVYI EPW+ TNK+YFG   T+I++
Sbjct: 351 NKNPRYKRFLEEYPKLKDEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIE 410

Query: 417 LSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFR 476
           LSP QD F +     +YFNT+         QP  K     Y+PGNVSLT+D+TLEF  FR
Sbjct: 411 LSPRQDKFNSLKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFR 470

Query: 477 HVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKR 536
           H GYGGT  P  LL + N E+  FEI+FLI+DVEVWGCGG++ELEEQ ++W+WEEAEAKR
Sbjct: 471 HTGYGGTIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKR 530

Query: 537 RQNINLRSFGEDRALLEMAGLVG-HSQNGGSM 567
           RQ INL++ GEDRALLEMAG++G H Q+GGS+
Sbjct: 531 RQEINLKTMGEDRALLEMAGIIGQHGQSGGSI 562

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  481 bits (1237), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 248/552 (44%), Positives = 363/552 (65%), Gaps = 18/552 (3%)

Query: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79
            F S ++L+ ++DK+A+ + +  EL ++K  ++GK L   +  +EL R LR+   N  + 
Sbjct: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76

Query: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139
             ++  V+ L+NFPL+KD +++VT +G+LKS +L N ++C +YV  K Y+H KL++I+L+
Sbjct: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136

Query: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199
           + K+VKE  S  +S    D   +  ++ T+NN+  ++L +PA ++++ L  +L ++    
Sbjct: 137 LNKAVKEMSSLPNSN---DSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATV 193

Query: 200 TSNCQFPEDVVYAE-WGSFKLAATNLLRTMNNNIVTNLESYS--VKFEQFSKAISTVMPN 256
             N +   DV  +E W SFK  A ++LRTMN +I+T+ ++    + + QF   IS+V PN
Sbjct: 194 IKNSRL--DVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPN 251

Query: 257 IFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNL 316
           +   L+ +MEH+L+ + DLV   + S   I  SK  T+ +LAQL T    E+ F++ Q L
Sbjct: 252 LLVPLECLMEHVLFLNRDLVDLEA-SKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKL 310

Query: 317 YVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSK-KNSRYRDFLSKYPKLKDR 375
           YVGR+SGFSMRS QAK FKWMAP+++L+ G  + DD+D++K KN RY+ FL +YP+LKD 
Sbjct: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDE 370

Query: 376 DQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFN 435
           DQH+      K K++FA+ I EPWK TN + FG   TTIVQLSP Q+V+KA+    +YFN
Sbjct: 371 DQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFN 430

Query: 436 TLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNR 495
           TL         QP IK+    + PGNVSLTID  LEFAAFR+VG+GG+  P    T    
Sbjct: 431 TLGGGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS--- 487

Query: 496 EDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMA 555
                E KFLIQD+E WGCGG++ELEEQ K W+WEEAEA+RRQ INL+S  +DRALLE+A
Sbjct: 488 -----EHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELA 542

Query: 556 GLVGHSQNGGSM 567
           GLVG +Q+GGS+
Sbjct: 543 GLVGQNQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 248/551 (45%), Positives = 357/551 (64%), Gaps = 16/551 (2%)

Query: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79
           QF S  +++ +FDK+A+   T+ EL +FK+ + GK L D V S+EL + LR+   N  + 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139
             ++  V+ LSNFP ++D ++++T  GLLKS +L N ++C  YV  K YDH KL++I+L+
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199
           + K+VKE  S S+S    D      ++ T+N++ V++L +P+  +++ +  +L ++    
Sbjct: 137 LNKTVKEVSSSSNSQESLDAP---RIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NLESYSVKFEQFSKAISTVMPNI 257
             N +   +V    W SF+  A ++LRTMN NI T  +L  Y + F QF   ISTV PN+
Sbjct: 194 IKNSKLDPNVSEG-WESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252

Query: 258 FRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLY 317
               +++MEH+L+   DLV   + S  P+L SK  ++ +LAQL T    E+ F++ Q LY
Sbjct: 253 LLPFESLMEHVLFLGRDLVDIDA-SQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLY 311

Query: 318 VGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSK-KNSRYRDFLSKYPKLKDRD 376
           VGR+SGFSMRS QAK FKWMAP+++L+ G  + +DE+++K KN RY++FL +YP+LK+ D
Sbjct: 312 VGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEED 371

Query: 377 QHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNT 436
           Q L      K K++FAVY+  PWK TN + FG   TTI+QLSP Q+V+KA+    +YFNT
Sbjct: 372 QVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNT 431

Query: 437 LXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNRE 496
           L         QP +K   + Y PGNVSLTID  LEFA FR  G+GG+  P   +      
Sbjct: 432 LGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN---- 487

Query: 497 DDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAG 556
               E KFLIQD+E WGCGG++ELEEQ K W+WEEAEA+RRQ INL+S  +DRALLEMAG
Sbjct: 488 ----EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAG 543

Query: 557 LVGHSQNGGSM 567
           LVG +Q+GGS+
Sbjct: 544 LVGQNQSGGSI 554

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 235/571 (41%), Positives = 355/571 (62%), Gaps = 10/571 (1%)

Query: 1   MGQNASVQQDHAEIGHEK-RQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDP 59
           MGQ +S+ +  +   +E  +  TS  E++++F+KR +  F+  EL  FK  LE       
Sbjct: 1   MGQGSSIPEASSGDSNESIKDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTI 60

Query: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKC 119
           +    + + L+I   +  L   +  F++ L+NFP +    D+VT  GLLK++++    K 
Sbjct: 61  IDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKF 120

Query: 120 HKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSIN-LLRTYNNIVVDDLA 178
            KY      + +K+LFIAL      +EE    +   L+    SI+ +L TY+ I + D++
Sbjct: 121 IKYTNNNQLNMLKILFIALGDYD--REE---DNKKILDCHNISISTILTTYDGIPIHDIS 175

Query: 179 IPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLES 238
           + +++++  L W+L L++ CPT+N       ++  W  ++ +A +L+R+MN +I+   ++
Sbjct: 176 VSSSNMISFLTWILALSNVCPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDN 235

Query: 239 YSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLA 298
            ++ F QF  A+ T+MP+++  L++++ HLL+ +S L+            SK  T AV +
Sbjct: 236 QNILFIQFKTALETIMPHVYLPLEHLLNHLLFMESSLIK-SQEIEISFQESKLMTFAVAS 294

Query: 299 QLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDF-SK 357
           QL T L N++  +K   LY GRESGFSMRS Q+K FKW APT++L+SG  V DD ++ +K
Sbjct: 295 QLSTLLRNDVVISKLHKLYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATK 354

Query: 358 KNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQL 417
           KN RY+ F+ +YP+L+D DQ+L        KV FAVY+ EPWK +NK  FGG  T IV+L
Sbjct: 355 KNPRYKKFIDQYPRLRDLDQNLEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVEL 414

Query: 418 SPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRH 477
           SP QD F+AA   V+YFNT+         QP  K    SY+PGNVSLTID++LEF AFRH
Sbjct: 415 SPRQDCFRAAKPGVIYFNTVGGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRH 474

Query: 478 VGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRR 537
            GYGG+  P  +L +       FEI+FLIQD+EVWGCGG++E++EQ K+W WEE EAK+R
Sbjct: 475 TGYGGSIEPSSILQKKEDATRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKR 534

Query: 538 QNINLRSFGEDRALLEMAGLVG-HSQNGGSM 567
           Q +NL+S GEDRALLEMAG++G H+ +GGS+
Sbjct: 535 QRVNLKSMGEDRALLEMAGIIGNHAHSGGSL 565

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  449 bits (1156), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 241/580 (41%), Positives = 356/580 (61%), Gaps = 16/580 (2%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEF-FDKRAVHMFTATELAAFKSKLE-GKTLKD 58
           MGQ+ S Q+       + +     +E +E  ++ R +  F A+EL  FK ++   + L D
Sbjct: 1   MGQSVSSQEPEPTQESDPQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLND 60

Query: 59  PVRSEELTRWLRIPCENVLL--CEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNP 116
            V  +EL  WL +P E  L    + +   ++VL  FP + ++  ++T V LLK+V+L N 
Sbjct: 61  VVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTGGNLTAVSLLKAVILINR 120

Query: 117 SKCHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTY--NNIVV 174
            KC KY+G K+Y+H++L+F+AL + +    + +   S   ++      ++ +Y  N+  V
Sbjct: 121 GKCLKYIGNKSYNHLELIFMALYLAQD-SHDSTKKESYDPKEPHNIEKVISSYDGNSDCV 179

Query: 175 DDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT 234
            ++ + A +L+Q    LL+L++  P  N Q        +W  ++ +A N++RTMN++I++
Sbjct: 180 SEITVQADNLLQFTTMLLLLSARIPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIIS 239

Query: 235 NLESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILT-SKPTT 293
           + +++++ F QF   IS ++P I   L N+++HLLY    LV     + GP  T +K   
Sbjct: 240 SCQTHTISFHQFYDVISILLPTILTTLDNLLQHLLYTPDQLVD--HTALGPTFTETKVMN 297

Query: 294 QAVLAQLITALSNE-MTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDD 352
               A L  AL+++    +K Q LYVGR+SGFSMRS Q KVF W APT++ +SG  + DD
Sbjct: 298 HGSFALLQFALADKGYPISKLQKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDD 357

Query: 353 EDFSK-KNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSG 411
           +D+SK KN RY  FL  + KL+D DQ LS     K KV+F +YI  PW+ TNKDYF    
Sbjct: 358 DDYSKNKNPRYSKFLEDFRKLRDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFSAGR 417

Query: 412 TTIVQLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLE 471
           TTI QLSP  D+FKA  ++V+YFNT+         QP+ K   + Y PGN+SLT+DS+LE
Sbjct: 418 TTIFQLSPELDIFKANRDDVVYFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDSSLE 477

Query: 472 FAAFRHVGYGGTFNPGLLLTQFNRE----DDPFEIKFLIQDVEVWGCGGKEELEEQYKKW 527
           F AFR+VG GG F PG L T+ N +     + +E++FLIQDVEVWGCGG++EL EQ K+ 
Sbjct: 478 FGAFRNVGPGGMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQL 537

Query: 528 QWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           QWEE EAKRRQ++NL+S  EDRALLEMAGLVG  Q+GGS+
Sbjct: 538 QWEETEAKRRQHVNLKSLSEDRALLEMAGLVGQHQSGGSI 577

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  436 bits (1122), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 236/572 (41%), Positives = 341/572 (59%), Gaps = 22/572 (3%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60
           MGQ AS  QD+ E      QF +  E++++F+ R V +FT TE+AAFK +     L +P+
Sbjct: 1   MGQTASSPQDNKE-SKSHPQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPI 59

Query: 61  RSEELTRWLRIPCE-NVLLCEAVYEFVRVLSNFPLMKDSF-DDVTGVGLLKSVLLTNPSK 118
               +   L +  + NV    AV E +R+L NFPL      D +TG GLLK + + N  +
Sbjct: 60  DDTLIKEALYLDAQPNV--WSAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKR 117

Query: 119 CHKYVG--VKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDD 176
             K V   +  YD    + + L +    KE  +   ST+L D      +L+TY++I ++ 
Sbjct: 118 FEKLVNTTITRYD----ITVTLGLCGQAKESENKIKSTNLGD------ILKTYDHIEIES 167

Query: 177 LAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNL 236
           + IP   L+ L+AWLL L +   T+NC+       A W +FK +A ++  T++ + + N 
Sbjct: 168 IHIPYDKLILLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNA 227

Query: 237 ESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAV 296
               +       A +T+M ++   + N+ EHLL+   DL+   ++ A  +      T ++
Sbjct: 228 NDIGIPATDILNAFNTIMISLVPYMSNLFEHLLFGVDDLIDHVNDLAN-LSHQDVLTPSL 286

Query: 297 LAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS 356
            AQ+I  L N +T  K Q LYVG+ESGFSMRSLQ+KVF+W APT+M++SG  + DDE ++
Sbjct: 287 YAQVIIGLPNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYA 346

Query: 357 -KKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIV 415
             KN RYR FL  +PKL++ DQ+L  +   K KV +AVYI EPWK +NK+ FG +  TI+
Sbjct: 347 DSKNPRYRSFLYSFPKLRENDQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIM 406

Query: 416 QLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEFAAF 475
           +L+P Q  +++     MYFNT+         QP +K     + PGN+SLT+DS+LEF  F
Sbjct: 407 ELTPQQKTYQSCMERTMYFNTIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVF 466

Query: 476 RHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAK 535
           RHVG GG F   LL    N +   FEI+F+IQ+VEVWGCGG++EL EQ K+ +WEEAEAK
Sbjct: 467 RHVGAGGGFKTSLL---DNDDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAK 523

Query: 536 RRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           RRQ INL+S  ED+ALLEM GLVG  Q+GGS+
Sbjct: 524 RRQTINLQSLSEDKALLEMVGLVGQHQSGGSV 555

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  423 bits (1088), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/581 (40%), Positives = 337/581 (58%), Gaps = 29/581 (4%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLE-GKTLKDP 59
           MGQNAS +   AE    +  F    E++EFFD +AV      EL AF++ +     LKD 
Sbjct: 1   MGQNASSRS--AESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58

Query: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKD-SFDDV-TGVGLLKSVLLTNPS 117
           +  E L +  ++P       +  Y+ +   S FPLM   + +DV T VGL+K+ LL +  
Sbjct: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118

Query: 118 KCHKYVGVKNYDHMKLLFIALSM-------RKSVKEEPSCSSSTSLEDGGGSINLLRTYN 170
           K  KY   K YD + L+FI L++       +K +   PS   +           ++ ++N
Sbjct: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDAR---------KIMESFN 169

Query: 171 NIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNN 230
           +I ++ + + A  L+Q + +LL++T YC   N +    + Y  W  ++  A N+LRTMN 
Sbjct: 170 DINLETIEVSADDLLQFMTFLLVITKYCIFENVEVNPSI-YENWKDYESQALNILRTMNP 228

Query: 231 NIVTNLESYS--VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPI-- 286
            IV+  ++    V   QF   I+ V PN+   L   M+H+LY+   LVS   +S   I  
Sbjct: 229 CIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVS---DSGATIND 285

Query: 287 LTSKPTTQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSG 346
            +S   T  +LAQL T     + +   + L++ ++SGFS+RS QAKV  WMAP+++L+SG
Sbjct: 286 RSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSG 345

Query: 347 KCVLDDEDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDY 406
             ++DD     KN RY+ FL +YPKLKD DQ    +   K KV FAV++ E WK TNK+ 
Sbjct: 346 MKIMDDSKLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQ 405

Query: 407 FGGSGTTIVQLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTI 466
           FG   T I+QLSP Q+VF+A+ N  +YFNT+         QP IK+  K Y PGNVSLTI
Sbjct: 406 FGNLKTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTI 465

Query: 467 DSTLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKK 526
           D + EF  FR+VG+GG+ +PG L  +    +   E +F+IQDVEVWGCGG +E E Q K+
Sbjct: 466 DPSFEFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQ 525

Query: 527 WQWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           W+WEEAE++RRQ INL S GED+ALLEM GLVGH Q+GGS+
Sbjct: 526 WEWEEAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/575 (36%), Positives = 308/575 (53%), Gaps = 26/575 (4%)

Query: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLK--D 58
           MGQ AS      E    +  FT    L+ FF+ RA+   +A E  AF   + GK ++  +
Sbjct: 1   MGQRASSHV--TETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTE 57

Query: 59  PVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSK 118
            +  + L     +P +     E  Y FV  L++FPLM D     T +GLLK  LL N  +
Sbjct: 58  ELDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKR 116

Query: 119 CHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLA 178
             +Y   K+YD   L+   L+  +      +C  +    DG     L+ T +   + +L 
Sbjct: 117 AARYTARKSYDVASLVLALLAPPRD-----ACDENVDQFDGD---KLIDTLDGTFIAELE 168

Query: 179 IPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NL 236
           +    LV+   ++  ++  C  SN      + +  W         LLR++++ IV+  + 
Sbjct: 169 VRPNKLVRYSPFIAQISQVCNGSNEPLSRSM-FPAWNRNNQIPLALLRSLDSTIVSRSDA 227

Query: 237 ESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSD----LVSFPSNSAGPILTSKPT 292
            S S+ ++QF+  + +V PN+F AL   +E L Y   D    L+  P+       TS   
Sbjct: 228 RSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKE-----TSTIV 282

Query: 293 TQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDD 352
           T  +L QL T       F   Q L+V  ++GFSM   QAKVFKWMAPT++ +SG  + DD
Sbjct: 283 TNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDD 342

Query: 353 EDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGT 412
           E    KN RY+ FL  YP LKD +Q L+   + K  +++A+++ +PWK TNKD FG   T
Sbjct: 343 EIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDT 402

Query: 413 TIVQLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIKNGVKSYSPGNVSLTIDSTLEF 472
           TI+QL+P Q +FKA     +YFN +         QP +K   K Y PGNVS T+D ++EF
Sbjct: 403 TIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEF 462

Query: 473 AAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEA 532
           A FR+VG GG F+ G  +     +   +E + +I+D+EVWG GG+EEL++Q ++WQWEEA
Sbjct: 463 AVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEA 522

Query: 533 EAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567
           EA +R+ I      EDRALLEMAG+VGH Q+GGS+
Sbjct: 523 EATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  299 bits (765), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 189/528 (35%), Positives = 289/528 (54%), Gaps = 69/528 (13%)

Query: 38  MFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKD 97
           +FT +EL  F+ ++  ++L D +  +E+ ++  IP     L      F+R L+ +P    
Sbjct: 24  IFTVSELITFQKRI-NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP---- 78

Query: 98  SFDDV-TGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSL 156
           S D++ TG   LK + L N  + +K       + +K++F+ LS  +    +  C  +T  
Sbjct: 79  SNDNIITGYSYLKIITLLNKKRRNKMF--PKIEWIKIIFMCLSDEEV---QFPCWETTH- 132

Query: 157 EDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVY--AEW 214
                              D+ +    L++ ++ LL L   C T  C   +D+ +   +W
Sbjct: 133 -------------------DIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDW 173

Query: 215 GSF-KLAATNLLRTMNNNIVTNLESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDS 273
            ++ + +A+ ++R M    V   E+           +  ++PNIF  L+N++EH LY   
Sbjct: 174 DTYWRKSASCIVRDMKECNVEEFEN-----------VLLIVPNIFDCLKNLIEHSLYTKD 222

Query: 274 DLVSFPSNSAGPI-LTSKPTTQAVLAQLITALSNE-MTFAKFQNLYVGRESGFSMRSLQA 331
            L   P    GP   T     QA+L Q++ ++    M  +K   LY+GRE+G+SMRS Q+
Sbjct: 223 QLKECP---LGPSQFTKTKMNQAILCQILLSMRKRSMDISK---LYIGRENGYSMRSFQS 276

Query: 332 KVFKWMAPTVMLLSGKCVLDDEDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVF 391
           KVFKW APT++L++GK +++D+++S+KN+RY+ FL+ YP+LKD         +      F
Sbjct: 277 KVFKWKAPTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKDGKTTF----QTPLHYTF 332

Query: 392 AVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNTLXXXXXXXXXQPHIK 451
           A+YI EPWK T K YFGG  T I+QLSP QDVF       +YF+T            H+ 
Sbjct: 333 AIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT---QNGIGIGNEHMS 388

Query: 452 NGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEV 511
           +  K Y PGNVS+TIDSTLEFA FRH G  G F  G++  Q     + FEI+  IQ VEV
Sbjct: 389 SDNK-YKPGNVSITIDSTLEFAVFRHSG-PGVFKTGIIANQ-----EIFEIRLHIQSVEV 441

Query: 512 WGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAGLVG 559
           WGCGG +EL EQ  +W+WEE EA+RRQ++++    EDRALLE+AG++G
Sbjct: 442 WGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIG 488

>TDEL0C04820 Chr3 (872071..875100) [3030 bp, 1009 aa] {ON} Anc_3.340
           YPR055W
          Length = 1009

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 150 CSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDV 209
           CS+ +S E G    ++L   N + VD +     ++  +L+WL  L     TSN Q P+D+
Sbjct: 705 CSAFSSKERGLRREDIL---NTVTVDAVIHFLGTVCWILSWLPGLRKVINTSNQQ-PDDM 760

Query: 210 ----VYAEWGSFKLAATNLLRTMNN-NIVTNLESYSVKFEQFSKAISTVMPNIFRALQ 262
               +  +W  F+L  +  L  +NN  I+ N E  + KF++     S++   ++ A++
Sbjct: 761 NVEKLRTDWCIFELNDSAALEQLNNLKIMMNSE-VAGKFDEIVNGFSSLQIKLYSAIR 817

>TDEL0E00430 Chr5 (99878..102781) [2904 bp, 967 aa] {ON} Anc_2.8
           YNL236W
          Length = 967

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 279 PSNSAGPILTSK---PTTQAVLAQLITALSNE--MTFAKFQNLYVGRESGFSMRS---LQ 330
           PS+S  P L  K   P+  + +   + A SN   ++  K  ++Y    SG  + +    +
Sbjct: 803 PSSSREPSLLVKAEIPSNVSKIGDFLLAYSNNAVISHVKANSVYFADTSGLRISNDEFFE 862

Query: 331 AKVFKWMAPTVMLLSGKCVLDDEDFSKKNSRYRDF 365
            +VF+ + P    L    V+DDEDF +K    + F
Sbjct: 863 PEVFRLLQP----LEKGLVIDDEDFPEKYRNSKSF 893

>TDEL0D00170 Chr4 complement(25816..26826) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 454 VKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFN 494
           V+ Y+ G      D  +EF+ +R + Y  T NP   LTQ +
Sbjct: 178 VQIYNTGKNECVFDENVEFSRWRKLVYNATLNPVCALTQLD 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,163,684
Number of extensions: 2663650
Number of successful extensions: 8017
Number of sequences better than 10.0: 27
Number of HSP's gapped: 8151
Number of HSP's successfully gapped: 27
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)