Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019305.432ON50239020930.0
Skud_15.2825.432ON48538915760.0
YOR119C (RIO1)5.432ON48438915730.0
Suva_8.1725.432ON48638915680.0
Smik_15.2975.432ON48638915600.0
NCAS0F033605.432ON50942315420.0
KAFR0E039205.432ON49740715330.0
KLTH0F16104g5.432ON54038315320.0
KLLA0E21121g5.432ON52641115270.0
SAKL0G02486g5.432ON50038715210.0
Kwal_55.214335.432ON47638315140.0
AER257W5.432ON47737515140.0
TPHA0E017805.432ON50841915130.0
Kpol_1062.315.432ON51342514990.0
KNAG0C049305.432ON49641214740.0
TBLA0A037605.432ON50440214680.0
CAGL0L11594g5.432ON50740914540.0
Ecym_47635.432ON53838814450.0
NDAI0B056505.432ON46237214360.0
ZYRO0F09988g5.432ON46037913600.0
NCAS0G015802.44ON4242251534e-10
TPHA0H009202.44ON4292251525e-10
CAGL0H08019g2.44ON4252271429e-09
KAFR0A077602.44ON4252251421e-08
Suva_14.1362.44ON4262271411e-08
NDAI0F036002.44ON4212251383e-08
KNAG0F010602.44ON4282261349e-08
Smik_14.1252.44ON4202251331e-07
Skud_14.1292.44ON4252251331e-07
ZYRO0C10340g2.44ON4162251321e-07
Kwal_23.45632.44ON4252511321e-07
TDEL0A008602.44ON4192251303e-07
ABL166W2.44ON4142281294e-07
Kpol_400.72.44ON4252251242e-06
YNL207W (RIO2)2.44ON4252251232e-06
SAKL0E13552g2.44ON4192251222e-06
Ecym_64492.44ON4172271223e-06
KLTH0B07722g2.44ON4282501187e-06
KLLA0D19008g2.44ON4222251189e-06
Ecym_11191.104ON791116780.68
Ecym_50637.64ON1189126742.3
KLLA0D14553g7.110ON42069704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01930
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   810   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   611   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   610   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   608   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   605   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   598   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   595   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   594   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   592   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   590   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   587   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   587   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   587   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   582   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   572   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   570   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   564   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   561   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   557   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   528   0.0  
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      64   4e-10
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    63   5e-10
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    59   9e-09
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    59   1e-08
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    59   1e-08
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    58   3e-08
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    56   9e-08
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    56   1e-07
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    56   1e-07
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    55   1e-07
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    55   1e-07
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    55   3e-07
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    54   4e-07
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    52   2e-06
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    52   2e-06
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    52   2e-06
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    52   3e-06
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    50   7e-06
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    50   9e-06
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    35   0.68 
Ecym_5063 Chr5 (138497..142066) [3570 bp, 1189 aa] {ON} similar ...    33   2.3  
KLLA0D14553g Chr4 (1234322..1235584) [1263 bp, 420 aa] {ON} simi...    32   4.5  

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/390 (100%), Positives = 390/390 (100%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKT 120
           TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKT
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKT 120

Query: 121 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK 180
           SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK
Sbjct: 121 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK 180

Query: 181 NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN 240
           NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN
Sbjct: 181 NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN 240

Query: 241 AIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISET 300
           AIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISET
Sbjct: 241 AIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISET 300

Query: 301 LEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDG 360
           LEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDG
Sbjct: 301 LEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDG 360

Query: 361 KFDLLKSLIAHDNERHLRAAHDPIDQDLEH 390
           KFDLLKSLIAHDNERHLRAAHDPIDQDLEH
Sbjct: 361 KFDLLKSLIAHDNERHLRAAHDPIDQDLEH 390

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/389 (76%), Positives = 341/389 (87%), Gaps = 9/389 (2%)

Query: 1   MSLEDQFDRLDISH-GREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59
           MSLED+FDRL +S    +H N Q+L+K+S+ IKTDELSF+++K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111
           RTMRFLKSM+NRGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G +K
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120

Query: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231
           PAP+PVEVKNNVLVMEFLSRG+GFASP+L+D+ + DR EI+HYYHTM+AY+RLLYQVCRL
Sbjct: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240

Query: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291
           VHADLSEYN I+H+ KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMG+ IFPER+
Sbjct: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300

Query: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351
           IFQFVISE+LEKF G+  +  DL  Y++K LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/389 (76%), Positives = 337/389 (86%), Gaps = 9/389 (2%)

Query: 1   MSLEDQFDRLDISHG-REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59
           MSLED+FD L +S G  +H N Q+L+K+S+ IKTDELSF+R+K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111
           RTMRFLKSM+ RGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G + 
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120

Query: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231
           PAPKP+EVKNNVLVMEFLSRG+GFASP+LKD+ + +R EI+HYYHTM+AY+RLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240

Query: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291
           VHADLSEYN IVHD KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGI IFPER+
Sbjct: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351
           IFQFVISETLEKF G+  + + L  Y++  LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/389 (75%), Positives = 339/389 (87%), Gaps = 9/389 (2%)

Query: 1   MSLEDQFDRLDISH-GREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59
           MS ED+F++L +S    +H N Q+LDK S+ IKTDELSF+++K+SKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111
           RTMRFLKSM+NRGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G + 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDGLRA 120

Query: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171
           E AIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNL+RI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231
           PAPKPVEVKNNVLVMEFLSRGDGFASP+LKD+ + DR EI+HYY+TM+AY+RLLYQVCRL
Sbjct: 181 PAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRL 240

Query: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291
           VHADLSEYN I+HD +LY+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGI+IFPER+
Sbjct: 241 VHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERV 300

Query: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351
           IFQFVISE LEKF G+ K+  DL  Y+SK LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 301 IFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/389 (75%), Positives = 336/389 (86%), Gaps = 9/389 (2%)

Query: 1   MSLEDQFDRLDISH-GREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59
           MSLED FD+L +S    +H N Q+L+K+S+ IKTDELSF R+K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111
           RTMRFLKSM+NRGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G + 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120

Query: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231
           PAPKP+EVKNNVLVMEFLSRG+GFASP+LKD+ + DR EI+HYY+TM+AY+RLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240

Query: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291
           VHADLSEYN I+HD KL++IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGI IFPER+
Sbjct: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351
           IFQFVISE+LEKF  +  +  DL  Y++K LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/423 (69%), Positives = 343/423 (81%), Gaps = 43/423 (10%)

Query: 1   MSLEDQFDRLDISHG--REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLD 58
           MSLED+FDRL+IS+    EHAN +ILDK+ +  KTDE+SFTRSK++KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 59  PRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES------IEDSKD--------- 103
           PRTMRFLK++ +RGVIS+FNGCLSTGKEANVYHAFAG+S      + ++K+         
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 104 --------------------------GHVQGEKKELAIKIYKTSILVFKDRERYVDGEFR 137
                                       V  +KKE A+KI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 138 FRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFAS 197
           FRNSRSQHNPRKMIKIWAEKEFRNLRRI QSGVIP PKP+EVKNNVLVMEFL RGDGFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 198 PRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSV 257
           PRLKDH + DR EI+HYYHT++AY+RL+YQ+CRLVHADLSEYN ++H  K+YIIDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 258 EPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNY 317
           EPEHPMSLDFLRMDIKNIN YFEKMGIDIFPER+IFQF+IS+TLE F+G+ +   DL +Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 318 VSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHL 377
           V++ LP+K +  D  EDEIFRSL+LVRNLEGLEERDFDR+TDGKFDLLKSLIAHDNE++ 
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 378 RAA 380
            AA
Sbjct: 421 SAA 423

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/407 (71%), Positives = 338/407 (83%), Gaps = 27/407 (6%)

Query: 1   MSLEDQFDRLDISHGR---EHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVL 57
           MS+ED+FD L IS GR   +H N QILDK+ + IKT+E S +R K++KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 58  DPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGE--------------------- 96
           DPRTM+FL+++M+RGVIS F+GCLSTGKEANVYHAFAG                      
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 97  ---SIEDSKDGHVQGEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 153
              S ++ KD +    ++E AIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 154 WAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYH 213
           WAEKEFRNL+RI QS VIPAPKP+E+KNNVLVMEFL+RGDGFASPRLKDH + DR EI+H
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 214 YYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIK 273
           YYHT++AYIRLLYQVC LVHADLSEYN +VH  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 274 NINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEE 333
           N+N YFEKMGIDIFPER+IFQFVISETL+KF+G+ KSS DL +YV + LP+K+T  D  E
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 334 DEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           DEIFRSL+LVRNL GLEERDFDR+T+G+FDLLKSL+AHDNE++  A+
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAAS 407

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/383 (75%), Positives = 330/383 (86%), Gaps = 8/383 (2%)

Query: 1   MSLEDQFDRLDI--SHG--REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56
           MSLED   +L +   HG  R+H N QILDKH++NIKTDELS TR+K+SKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHV----QGEKKE 112
           LDPRTMRFL+++ +RGVISEFNGCLSTGKEANVYHAFAG   + S++       QGE++E
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172

Query: 113 LAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIP 172
            AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGV+P
Sbjct: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232

Query: 173 APKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLV 232
           AP+P+EVK+NVLVMEFL+RGDGFASP+LKD  + DR E  +YYHTM+AYIRLLYQ C+LV
Sbjct: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292

Query: 233 HADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLI 292
           HADLSEYN IVH+QKLY+IDVSQSV+PEHPMSLDFLRMDIKNIN+YFE+M IDIFPER I
Sbjct: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352

Query: 293 FQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEER 352
           FQFVIS+ LEKF+G   ++ DL  YV+K L  KS   D  EDE+FRSLHLVRNL GLEER
Sbjct: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412

Query: 353 DFDRFTDGKFDLLKSLIAHDNER 375
           DFDRFT GKFDLLKSLIAHDN++
Sbjct: 413 DFDRFTLGKFDLLKSLIAHDNQK 435

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/411 (69%), Positives = 338/411 (82%), Gaps = 35/411 (8%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           M+++D+ ++L++++  EH N QIL++++N+IKTDELS TR K+SKDKANRATVENVLDPR
Sbjct: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG-------------------ESIEDS 101
           TMRFLKSMMNRG++S FNGCLSTGKEANVYHAFAG                   ++IE +
Sbjct: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121

Query: 102 KDGHVQGE----------------KKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQH 145
           K   +  E                KKE A+KIYKTSILVFKDRERYVDGEFRFRNSRSQH
Sbjct: 122 KQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181

Query: 146 NPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLF 205
           NPRKMIKIWAEKEFRNL+RI QSGVIP PKP+EV++NVLVMEFL+RGDGFASPRLKDH +
Sbjct: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241

Query: 206 ADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSL 265
            DR EI HYY+ M+AY+RLLYQVCRLVHADLSEYN+IVH+ KLYIIDVSQSV+PEHPMSL
Sbjct: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301

Query: 266 DFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVK 325
           DFLRMDIKN+N+YF+K+GIDIFPER+IFQF+ISE L+KF G+ +SS DL  YV+  LP+K
Sbjct: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361

Query: 326 STTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERH 376
            T  D  EDE+FRSLHL+RNL GLEERDFDRFTDGKFDLLKSLIA++N ++
Sbjct: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKY 412

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/387 (74%), Positives = 335/387 (86%), Gaps = 14/387 (3%)

Query: 1   MSLEDQFDRLDISHG----REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56
           MS+E  F +L +  G    R+H N +ILDK+S+ IKTDELS TR K++KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG-------ESIEDSKDGHVQGE 109
           LDPRTMRFL+ +++RGV+S+ NGCLSTGKEANVYHAFAG       E+ +DSKD  V   
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELV--- 117

Query: 110 KKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSG 169
           K+E A+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSG
Sbjct: 118 KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSG 177

Query: 170 VIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVC 229
           VIP P+P+EV++NVLVMEFL+RG+GFASPRLKDH + DR EI +YYHTM+AY+RLLYQVC
Sbjct: 178 VIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVC 237

Query: 230 RLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPE 289
           +LVHADLSEYN IVH  +LY+IDVSQSV+PEHPMSLDFLRMDIKNIN+YFEK GIDIFPE
Sbjct: 238 QLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPE 297

Query: 290 RLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGL 349
           R+IFQF+ISETL+KF G+  +  DL +YVSK LP+KST  D  EDE+FRSLHLVRNL GL
Sbjct: 298 RVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGL 357

Query: 350 EERDFDRFTDGKFDLLKSLIAHDNERH 376
           EERDFDRFTDGKFDLLKSLIAHDN+++
Sbjct: 358 EERDFDRFTDGKFDLLKSLIAHDNKKN 384

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/383 (74%), Positives = 333/383 (86%), Gaps = 8/383 (2%)

Query: 1   MSLEDQFDRLDISHGRE----HANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56
           MSL+D+ D L +    E    H N QILDKH++NIK DELS +R K+SKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKD-GHVQG---EKKE 112
           LDPRTMRFL+++ +RGVIS+FNGC+STGKEANVYHAFA    +++++ G V     E++E
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120

Query: 113 LAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIP 172
           LAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSG++P
Sbjct: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180

Query: 173 APKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLV 232
           AP+PVEV++NVLVMEFLSRG+GFASPRLKD+ + DR E  HYY+TM+AYIRLLYQ C+LV
Sbjct: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240

Query: 233 HADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLI 292
           HADLSEYNAIVH+++LYIIDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M +D+FPER+I
Sbjct: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300

Query: 293 FQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEER 352
           FQFVISETL+KF G+  SS DL +YVSK LPVKS   D  EDE+FRSLHLVRNL GLEER
Sbjct: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360

Query: 353 DFDRFTDGKFDLLKSLIAHDNER 375
           DFDRFT GKFDLLKSLIAHDNER
Sbjct: 361 DFDRFTLGKFDLLKSLIAHDNER 383

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/375 (74%), Positives = 321/375 (85%), Gaps = 7/375 (1%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           M LEDQ  +L +    +H N +IL+K +N IKTDELS T+ K++KDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKT 120
           TMRFL++++NRGV+SEFNGCLSTGKEANVYHA +G +           EK E A+KIYKT
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGAT-------EGAPEKSEYAVKIYKT 113

Query: 121 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK 180
           SILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNL+RI QSGVIP P+PVE+K
Sbjct: 114 SILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIK 173

Query: 181 NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN 240
           +NVLVMEFL+RGDGFASPRLKD+ F DR EIYHYYH M++YIRLLYQVC+LVHADLSEYN
Sbjct: 174 SNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYN 233

Query: 241 AIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISET 300
           +IVH  KLYIIDVSQSV+PEHPMSLDFLRMDIKNIN YFE+MGIDIFPER+IFQFVISET
Sbjct: 234 SIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISET 293

Query: 301 LEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDG 360
           L+KF G+ +S+ DL +YV+  LP K T  D  ED++FRSLHLVRNL GLEERDFDRFTDG
Sbjct: 294 LDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDG 353

Query: 361 KFDLLKSLIAHDNER 375
           KFDLLKSLIA DN +
Sbjct: 354 KFDLLKSLIAQDNAK 368

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/419 (69%), Positives = 332/419 (79%), Gaps = 47/419 (11%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           MSLE +FD+L + H  EH N +IL+K+ + IKTDELS T+ K++KDKANRATVENVLDPR
Sbjct: 1   MSLEGKFDKLKV-HESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQG------------ 108
           TM+ LK+++NRGVI EFNGCLSTGKEANVYHAFAG       DG V+G            
Sbjct: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAG-------DGKVKGNAEVLPQISELE 112

Query: 109 ---------------------------EKKELAIKIYKTSILVFKDRERYVDGEFRFRNS 141
                                      ++KE AIKIYKTSILVFKDRERYVDGEFRFRN+
Sbjct: 113 DVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNA 172

Query: 142 RSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLK 201
           RSQHNPRKMIKIWAEKEFRNLRRI QSG+IPAP+PVEVK N+LVMEFL RGDGFASPRL+
Sbjct: 173 RSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLR 232

Query: 202 DHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEH 261
           DH +  R EI +YYHT++AYIRLLYQVCRLVHADLSEYN IVHD KLY+IDVSQSVEPEH
Sbjct: 233 DHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEH 292

Query: 262 PMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKA 321
           PMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQFVIS  L+KF G+P+SS DL NY++  
Sbjct: 293 PMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHY 352

Query: 322 LPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           LPVK T  D  +DEIFRSLHLVRNL+GLEERDFDRFTDGKFDLLK+LIA DN+++  A+
Sbjct: 353 LPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS 411

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/425 (69%), Positives = 336/425 (79%), Gaps = 38/425 (8%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           MS +++FDRL IS      N +IL+K+ + IKTDELSFT+ K++KDKANRATVENVLDPR
Sbjct: 1   MSFDEKFDRLKISGN--DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGE------------------------ 96
           TMRFLK++ NRGVIS FNGCLSTGKEANVYHAFAG+                        
Sbjct: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118

Query: 97  -SIEDSKDGH----VQGEK-------KELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 144
            S ED+ D +    + G K       KE AIKIYKTSILVFKDRERYVDGE+RFRNSRSQ
Sbjct: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178

Query: 145 HNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHL 204
           HNPRKMIKIWAEKEFRNLRRI+QSGVIPAPKPVEVK+NVLVMEFL+RG+GFASPRLKD+ 
Sbjct: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238

Query: 205 FADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMS 264
           + DR EI+ YYH ++AY+RLLYQVCRLVHADLSEYN IVH  KLY+IDVSQSVEPEHPMS
Sbjct: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298

Query: 265 LDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPV 324
           LDFLRMDIKN+N YFEKMGIDIFPER+IFQFVISE LE F G+  S+ DL  +V   LP+
Sbjct: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358

Query: 325 KSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAAHDPI 384
           KST  D  EDE+FRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN+++  A+    
Sbjct: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQYG 418

Query: 385 DQDLE 389
            +DL+
Sbjct: 419 MEDLD 423

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/412 (68%), Positives = 339/412 (82%), Gaps = 22/412 (5%)

Query: 1   MSLEDQFDRLDISH--GREHANIQILDKHSNNIKTDELSFTR-SKSSKDKANRATVENVL 57
           MS+E++F++L I H    + AN ++LDK+++ IK D+ SF++  K++KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 58  DPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESI---------EDS------- 101
           DPRTMRFL+++MNRG+IS+FNGCLSTGKEANVYHAFAG+ +         E+S       
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 102 KDGHVQ---GEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 158
           ++  VQ   G KKE AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180

Query: 159 FRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTM 218
           FRNL+RI QSG +P PKPVEVKNNVLVMEFL+RGDGFASPRL+D+ + D   I  YY T+
Sbjct: 181 FRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240

Query: 219 LAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAY 278
           +AY+RL+YQVC LVHADLSEYN +VH+ +LYIIDVSQSV+PEHPMSLDFLRMDIKN+N Y
Sbjct: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300

Query: 279 FEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFR 338
           F KMGIDIFPER+IFQFVISE+L+KF+G+ KSS DL+ YV   LPVK T  D  EDE+FR
Sbjct: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360

Query: 339 SLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAAHDPIDQDLEH 390
           SL+LVRNLEGLEERDFDRFT+GKFDLLKSL+AHD E++  AA    + D E+
Sbjct: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEFDDEN 412

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/402 (70%), Positives = 323/402 (80%), Gaps = 24/402 (5%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           M L+D F +LD+S+   H N +ILDKH + IKTDE S +R K++KDKANRATVENVLDPR
Sbjct: 1   MVLDDDFQKLDLSNN--HDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPR 58

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIE-------DSKDGHVQG----- 108
           TMRFLK++ +RG+IS+FNGC+STGKEANVYHAFAG++I        DS +  V       
Sbjct: 59  TMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPYS 118

Query: 109 ----------EKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 158
                      +KE AIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKE
Sbjct: 119 NPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKE 178

Query: 159 FRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTM 218
           FRNL+RI QS VIP PKP+EVKNNVLVMEFL+RGDGFASPRLKD+ + D  +I HYYHTM
Sbjct: 179 FRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHTM 238

Query: 219 LAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAY 278
           + YIRLLYQVCRLVHADLSEYN +VH  KLY+IDVSQSVEPEHPMSLDFLRMDIKNIN Y
Sbjct: 239 IVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINNY 298

Query: 279 FEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFR 338
           FE+MG+ IF ER+IFQF ISETL+ F+GN  +  DL  YV   LP+K    D  EDEIFR
Sbjct: 299 FERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIFR 358

Query: 339 SLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380
           SLHLVRNL GLEERDFDR+TDGKFDLLKSLIAHDNE++  A+
Sbjct: 359 SLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSAS 400

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/409 (67%), Positives = 327/409 (79%), Gaps = 32/409 (7%)

Query: 3   LEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPRTM 62
           L D+F  + +S   +H N QI+DK+ + IKTDELS  ++K++KDKANRATVENVLDPRTM
Sbjct: 4   LSDKFRNVKVST--DHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTM 61

Query: 63  RFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG----------ESIED------------ 100
           RFL +++NRGVI+  NGCLSTGKEANVYHAFAG          E  ED            
Sbjct: 62  RFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGNI 121

Query: 101 --------SKDGHVQGEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 152
                   + +  ++  +KE AIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMIK
Sbjct: 122 DISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMIK 181

Query: 153 IWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIY 212
           IWAEKEFRNL+RI Q GVIP+P+P+EVKNNVLVMEFL+RGDGFASP+L+D+ + DR EIY
Sbjct: 182 IWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEIY 241

Query: 213 HYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDI 272
           +YYH +++Y+RLLYQVCRLVHADLSEYN IVH +KLY+IDVSQSVEPEHPMSLDFLRMDI
Sbjct: 242 YYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMDI 301

Query: 273 KNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVE 332
           KN+N YFEKMGI+IF E+ IFQFVI++TL+KFDG+  S  DL  YV+  +P+K T  D  
Sbjct: 302 KNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDEA 361

Query: 333 EDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAAH 381
           EDE+FRSLHLVRNLEGLEERDFDRFTDGKFDLLKSL+A DN+++  AA 
Sbjct: 362 EDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/388 (71%), Positives = 323/388 (83%), Gaps = 14/388 (3%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60
           M LE++  RL +    EH N +ILDK +N IKTDELS TR K+SKDKANRATVENVLDPR
Sbjct: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92

Query: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGH-----------VQGE 109
           TMRFL+S+++RG+I+EFNGCLSTGKEANVYHAF G +++  +  H            +G+
Sbjct: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSDSEGD 151

Query: 110 KK--ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQ 167
            K  E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI  
Sbjct: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211

Query: 168 SGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQ 227
           +GVI  PKP+E+K+NVLVMEFL+RGDGFASP+LKD+ ++DR EIY++YH M+AYIRLLYQ
Sbjct: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271

Query: 228 VCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIF 287
           VC+LVHADLSEYN+IVH+ KLYIIDVSQSV+PEHPMSLDFLRMDIKNINAYF K+GI++F
Sbjct: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331

Query: 288 PERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLE 347
            ER IFQFVISE LEKF G+ +S   L  Y S+ LP+K T  D  EDEIFRSLHLVRNL 
Sbjct: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391

Query: 348 GLEERDFDRFTDGKFDLLKSLIAHDNER 375
           GLEE DFDRFT+GKFDLLKSL++ DN++
Sbjct: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQK 419

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/372 (71%), Positives = 310/372 (83%), Gaps = 27/372 (7%)

Query: 36  LSFTRSKSSKDKANRATVENVLDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG 95
           +SFT+ K++KDKANRATVENVLDPRTM+FLK++ +RGVIS+FNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 96  ES---IEDSKDGH------------------------VQGEKKELAIKIYKTSILVFKDR 128
           +S    +D+ + H                        +Q +KKE A+KI+KTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 129 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEF 188
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI QS VIP PKP+EVKNNVL+MEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 189 LSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKL 248
           L+RGDGFASPRL+D+ + DR E+ HYYH  +AY+RL+YQVCRLVHADLSEYN ++H+  +
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 249 YIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNP 308
           YIIDVSQSVEPEHPMSLDFLRMDIKNIN YF++MGIDIFPER+IFQF+ISETL+KF GN 
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 309 KSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSL 368
               DL +YV+K LP+K T  D  EDEIFRSL+LVRNLEGLEERDFDR+TDGKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 369 IAHDNERHLRAA 380
           IAHDNE++  AA
Sbjct: 361 IAHDNEKNFSAA 372

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/379 (68%), Positives = 308/379 (81%), Gaps = 16/379 (4%)

Query: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRS-KSSKDKANRATVENVLDP 59
           MSLE +FDRL +S  +   N +IL+K+ N I+    +  +  K+ KDK++RATVENVLDP
Sbjct: 1   MSLETEFDRLHVS--KHQDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDP 58

Query: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYK 119
           RTM+FL ++ NRGVISEFNGC+S+GKEANVYHAF  E              +ELAIKIYK
Sbjct: 59  RTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEG-------------QELAIKIYK 105

Query: 120 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEV 179
           TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI+ SGV+P   PVEV
Sbjct: 106 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEV 165

Query: 180 KNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEY 239
           K+NVLVM+FL+RGDG  SPRLKD+ + D  E+ HYY+  +AY+RLLYQVCRLVHADLSEY
Sbjct: 166 KSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEY 225

Query: 240 NAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISE 299
           N +VH   L+IIDVSQSVEP HPMSLDFLRMDIKNINAYF KMG+ +F ER+IFQF+I+E
Sbjct: 226 NIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAE 285

Query: 300 TLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTD 359
           TLE F G+ K++ DL  Y+ + LP+K+ T   +EDEIFRSLHLVR+L GLEERDFDRFTD
Sbjct: 286 TLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTD 345

Query: 360 GKFDLLKSLIAHDNERHLR 378
           GKFDLLKSLIA+DNER+L+
Sbjct: 346 GKFDLLKSLIANDNERNLQ 364

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 101/225 (44%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  I    G +  GKE+++Y   A           V G  + + I ++ +TS  
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSA-----------VDGNPRVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             ++   Y+      RN++   N   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 TVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEPFDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +    G+   RL+ H       I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 IVMELIK---GYPMRRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLIHCDFNEFNIMI 237

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 238 KDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 99/225 (44%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LKS++N+  +    G +  GKE+++Y                 G K+ L I ++ +TS  
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG-----------SDKNGNKRVLKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+      R S    N   + K+ A KE++ +  +   G    P+P +   +V
Sbjct: 134 TVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEPFDNSRHV 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +    G+   RL+ H      +I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 IVMELIR---GYPMRRLRKH-----KDIPKLYSDLMKFILQLAN-SGLIHCDFNEFNIMI 237

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 238 KDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 100/227 (44%), Gaps = 37/227 (16%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           L++++N+ V+      +  GKE+++Y       + D       G  K + I ++ +TS  
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQ------VSDR-----NGTAKVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+      RNSR   N   + K+ A KEF  +  +   G I  P+      +V
Sbjct: 134 TVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCSRHV 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VM+ +   DG+   RL++H       I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 VVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLIHCDFNEFNIMI 237

Query: 244 ---------HDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
                     D    +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 238 KNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 103/225 (45%), Gaps = 34/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +    G +  GKE+++Y       + D       G +K + I ++ +TS  
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYR------VSDR-----NGTEKVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K++  Y+      +N+++  N   + KI A KE++ +  +   G    P+  +   + 
Sbjct: 134 TVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEAFDCSRHC 187

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +    G+   RL+ H       I   Y  ++++I  L     L+H D +E+N ++
Sbjct: 188 IVMELIK---GYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLIHCDFNEFNIMI 238

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 239 KDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 100/227 (44%), Gaps = 39/227 (17%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIY---KTS 121
           LK+M+NR  +      +  GKE+++Y           KDG+ +       IKI+   +TS
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV-------SDKDGNPR------VIKIHRLGRTS 131

Query: 122 ILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKN 181
               ++   Y+      R S    N   + ++ A KE++ +  +   G    P+P +   
Sbjct: 132 FHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSR 184

Query: 182 NVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNA 241
           +++VME +   +GF   RL+ H       I   Y  ++ +I  L     L+H D +E+N 
Sbjct: 185 HIVVMELI---NGFPMRRLRKH-----KNIPKLYSDLMCFIVQLGN-SGLIHCDFNEFNV 235

Query: 242 IVHDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
           ++ D+          +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 236 MIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 103/225 (45%), Gaps = 34/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +    G +  GKE+++Y       + D       G  K + I ++ +TS  
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQ------VSDK-----NGVSKVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             ++   Y+      +N ++  N   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 TVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHI 187

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           ++M  +   +G+   RL+ H       I   Y+ ++ +I  L     L+H D +E+N ++
Sbjct: 188 IIMGLI---EGYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMI 238

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +HP +  + + D+  I  +F+K
Sbjct: 239 KDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 98/226 (43%), Gaps = 34/226 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKTSILV 124
           LK+M+NR  +      +  GKE+++Y       +E     H  G          +TS   
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYKVSDKNGVEKVMKIHRLG----------RTSFHT 134

Query: 125 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVL 184
            ++   Y+      +NS++  N   + K+ A KE++ +  ++  G    P+P +   +++
Sbjct: 135 VRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEPFDHSRHII 188

Query: 185 VMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVH 244
           +ME +    GF   RL+ H       +   Y  ++ +I  L     L+H D +E+N ++ 
Sbjct: 189 IMELIK---GFPMTRLRKH-----QNVPKLYSDLMKFILELGN-SGLIHCDFNEFNIMIK 239

Query: 245 DQ---------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
           D+            +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 240 DKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 99/225 (44%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +      +  GKE+++Y           K     G+ + + I ++ +TS  
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY-----------KVSDKNGKPRVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             ++   Y+      RNS    N   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 SVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +   +G+   RL+ H       I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 VVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFIVELAN-SGLIHCDFNEFNIMI 237

Query: 244 -------HDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
                   D    +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 238 KNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 99/225 (44%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +      +  GKE+++Y           K     G  + + I ++ +TS  
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIY-----------KVSDKNGNPRVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             ++   Y+      +NS    N   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 SVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +   +G+   RL+ H       I   Y  ++ ++  L     L+H D +E+N +V
Sbjct: 187 VVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFVVELAN-SGLIHCDFNEFNIMV 237

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 238 KDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 101/225 (44%), Gaps = 34/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKTSILV 124
           +K+M+NR  +      +  GKE+++Y           ++G+ Q  K     ++ +TS   
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYKV-------SDRNGNAQVMKIH---RLGRTSFTS 134

Query: 125 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVL 184
            ++   Y+      ++SR   +   +  + A KE+  L  ++  G    P+  +   +++
Sbjct: 135 VRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNSRHMV 187

Query: 185 VMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVH 244
           +MEF+    GF    L+ H     + I   Y  ++ +   L +   L+H D +E+N ++ 
Sbjct: 188 LMEFIK---GFPMKNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIK 238

Query: 245 DQ--------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
           DQ           +ID  Q +  +HP +  F R DI+ I  +F+K
Sbjct: 239 DQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 112/251 (44%), Gaps = 46/251 (18%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +      +  GKE++VY   A       KD    G  + L I ++ +TS  
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSA-------KD----GTPRVLKIHRLGRTSFT 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLRRINQSGVIPAPKPVEVKNN 182
             K+   Y+         R+Q      + ++ A KE++ +  +   G +  P+P +   +
Sbjct: 134 TVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPEPFDNSRH 184

Query: 183 VLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAI 242
           +++M+ +   DG+   R++ H       +   Y  ++++I  L     L+H D +E+N +
Sbjct: 185 MILMQLI---DGYPMRRMRSH-----KNLPKLYSDLMSFIVKLANHG-LIHCDFNEFNIM 235

Query: 243 VH-------DQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQF 295
           +        D    +ID  Q +  +H  + ++ + D+  I  +F K        +L ++ 
Sbjct: 236 IKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK--------KLKYEP 287

Query: 296 VISETLEKFDG 306
           V+ E++   DG
Sbjct: 288 VVDESMLDEDG 298

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 100/225 (44%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           +KSM+NR  +  F   +  GKE+++Y       + D       G  K + I ++ +TS  
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQ------VSDK-----NGVAKVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+      + +    N   +  + A+KE++ +  +   G I  P+P +   ++
Sbjct: 134 TVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQPYDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           ++ME +   DGF    L++H     + I   Y  ++ +   L     L+H D +E+N ++
Sbjct: 187 VLMELI---DGFPMRNLRNH-----SNIPKLYSDLMTFAVKLAN-SGLIHCDFNEFNIMI 237

Query: 244 -------HDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
                   D    +ID  Q +  +H  +  + + DI+ I  +F K
Sbjct: 238 KNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 97/228 (42%), Gaps = 42/228 (18%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYK---TS 121
           LKS++ +  I      +  GKE+++Y      S             + L +KI++   TS
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQVSDAAS-------------QSLVMKIHRLGRTS 131

Query: 122 ILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK 180
               K +  Y+         R Q  N  ++  + AE+E+  +  +   G    PKP    
Sbjct: 132 FHTVKTKREYL--------KRGQSANWMRLSHLSAEREYAYMCLLYSKG-FSVPKPYANS 182

Query: 181 NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN 240
            + +VME++    G+   RL+ H     + +   Y  ++A++  L     ++H D +E+N
Sbjct: 183 RHAIVMEYIR---GYPMRRLRSH-----SNVPKLYSDLMAFVVKLANHG-MIHCDFNEFN 233

Query: 241 AIV-------HDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            ++        DQ   +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 234 IMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LKS++N+  +      +  GKE+++Y A               GE + + I ++ +TS  
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA-----------SDRNGEHRVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+      +      +   + ++ A KE++ +  +   G    PK  +   ++
Sbjct: 134 TVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FTVPKAFDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +    GF   RL+ H       I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 VVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMI 237

Query: 244 HDQK-------LYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+K         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 238 KDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 98/225 (43%), Gaps = 35/225 (15%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +      +  GKE+++Y           K     G  + + I ++ +TS  
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY-----------KVSDKNGNPRVMKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             ++   Y+      + S    N   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 SVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHI 186

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           +VME +   +G+   RL+ H       I   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 187 VVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFIVDLAN-SGLIHCDFNEFNIMI 237

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 238 KDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 99/225 (44%), Gaps = 36/225 (16%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LK+M+NR  +      +  GKE+++Y       + D       G  + + I ++ +TS  
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQ------VSDR-----NGNSRVMKIHRLGRTSFQ 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+ G       R   +   + ++ A KE++ +  +   G    P+P +   ++
Sbjct: 134 TVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEPFDNSRHI 185

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           ++ME +    G+   RL+ H      ++   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 186 ILMELIK---GYPMRRLRKH-----HDLPKLYSDLMCFIVNLANHG-LIHCDFNEFNIMI 236

Query: 244 HDQ-------KLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 237 KDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 102/227 (44%), Gaps = 40/227 (17%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIY---KTS 121
           LKS++N+  +      +  GKE+++Y      S             + L +KI+   +TS
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQVSTSTS-------------EALVMKIHRLGRTS 131

Query: 122 ILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKN 181
               K+   Y+    R +++   H    +  + A KE++ +  +   G    P+P +   
Sbjct: 132 FHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRPYDNSR 183

Query: 182 NVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNA 241
           ++++ME++    G+   RL++H      ++   Y  ++ +I  L     L+H D +E+N 
Sbjct: 184 HIILMEYIK---GYPMRRLREH-----KDLPRLYSELMKFIVQLGNHG-LIHCDFNEFNI 234

Query: 242 IVHDQK-------LYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
           ++ D+          +ID  Q +  +H  +  + + D++ I  +F+K
Sbjct: 235 MIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 108/250 (43%), Gaps = 44/250 (17%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKTSILV 124
           L++M++R  I      +  GKE++VY   A       KDG  +  K     ++ +TS   
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSA-------KDGSARVLKIH---RLGRTSFTT 134

Query: 125 FKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
            K+   Y+         R+Q      + ++ A KE++ +  ++  G    P+P +   ++
Sbjct: 135 VKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-FTVPEPFDNSRHM 185

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           ++ME +   DG+    ++ H    +     Y   ML  ++L      L+H D +E+N ++
Sbjct: 186 ILMELI---DGYPMRNMRLHKNLPKL----YSDLMLFIVKLANH--GLIHCDFNEFNIMI 236

Query: 244 -------HDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFV 296
                   D    +ID  Q +  +H  +  F + D+  I  +F+K        +L F+  
Sbjct: 237 KNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK--------KLKFEPR 288

Query: 297 ISETLEKFDG 306
           + E++   DG
Sbjct: 289 VDESMLDVDG 298

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 98/225 (43%), Gaps = 36/225 (16%)

Query: 65  LKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAI-KIYKTSIL 123
           LKSM+NR  +      +  GKE+++Y       + D       GE K L I ++ +TS  
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQ------VSDR-----SGESKVLKIHRLGRTSFH 133

Query: 124 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNV 183
             K+   Y+      RN +S  +   + K+ A KE++ +  +        P+P +   + 
Sbjct: 134 TIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQPFDNSRHC 185

Query: 184 LVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIV 243
           ++ME +    G+   RL  H       +   Y  ++ +I  L     L+H D +E+N ++
Sbjct: 186 VLMEHIR---GYPMRRLGKH-----KNLPKLYSDLMCFIVKLANHG-LIHCDFNEFNIMI 236

Query: 244 HDQK-------LYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEK 281
            D+          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 237 KDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 59/116 (50%), Gaps = 17/116 (14%)

Query: 117 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKP 176
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ +++R+    +   P+ 
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRVKL--IENGPRC 366

Query: 177 VEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLV 232
           +++    +VM  + + DG        H+  +  E+   +  ML    +L  +C LV
Sbjct: 367 IDLD---IVM--MKKSDG-------QHVLWNSDELVIPHSRMLERTFVLEPLCELV 410

>Ecym_5063 Chr5 (138497..142066) [3570 bp, 1189 aa] {ON} similar to
           Ashbya gossypii ADR357C
          Length = 1189

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/126 (18%), Positives = 58/126 (46%), Gaps = 3/126 (2%)

Query: 226 YQVCRLVHADLSEYNAIVHDQKLYIIDVSQSV-EPEHPMSLDFLRMDIKNINAYFEKMGI 284
           + + R+ H +  ++N      K Y+  + + + + ++P++ + L+  I +  AY+     
Sbjct: 557 WTLLRIPHPNGPDFNCTNLLSKPYLHFMEKGILQSQYPLAREALK--INSSGAYWTASRD 614

Query: 285 DIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVR 344
            I  + ++ +       + FDG+P +S D    + + +P+ + T    E+    + +  +
Sbjct: 615 RIMGQHVVSKAEFPNQFKMFDGSPTNSVDFGAIIPRVIPMGTVTRRAVENTWLTASNAKK 674

Query: 345 NLEGLE 350
           N  G E
Sbjct: 675 NRIGSE 680

>KLLA0D14553g Chr4 (1234322..1235584) [1263 bp, 420 aa] {ON} similar
           to uniprot|P23180 Saccharomyces cerevisiae YHL021C FMP12
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 420

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 302 EKFD-GNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTD- 359
           E FD  N  S A+   Y +K LP+      +E    ++ LH ++N EGLEE   + F D 
Sbjct: 217 ELFDVKNQASQANNIAYTAKPLPLHMDLLYLENIPGWQLLHCIKNSEGLEENGQNYFVDS 276

Query: 360 -GKFDLLKS 367
            G  + +K+
Sbjct: 277 LGALNYIKN 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,637,575
Number of extensions: 1911140
Number of successful extensions: 6216
Number of sequences better than 10.0: 55
Number of HSP's gapped: 6308
Number of HSP's successfully gapped: 57
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)