Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019105.434ON31131116580.0
ZYRO0F10032g5.434ON31030911081e-152
Kwal_47.18084na 1ON30930410961e-151
Kpol_1062.295.434ON31130910751e-147
Suva_8.1735.434ON31231210681e-146
Suva_2.5405.434ON31231210591e-145
YDR368W (YPR1)5.434ON31231210591e-145
KLTH0E15532gsingletonON30930210521e-144
Skud_4.6375.434ON31231210511e-144
Smik_15.2985.434ON31231210491e-143
Smik_4.6345.434ON31231210461e-143
CAGL0I01100g5.434ON31030910441e-143
Skud_15.2835.434ON31231210421e-142
NDAI0C016005.434ON31331210371e-142
TBLA0A02825singletonON31131210341e-141
SAKL0G02530g5.434ON31231210301e-141
YOR120W (GCY1)5.434ON31231210231e-139
NCAS0H020605.434ON32231210061e-137
CAGL0A02816g5.434ON3103099991e-136
KNAG0C049105.434ON3133129961e-135
KLTH0A03476gna 1ON3083009901e-134
TPHA0E017605.434ON3103099861e-134
KLLA0B14707gsingletonON3103079841e-134
KAFR0E03850singletonON3113129681e-131
TBLA0A065105.434ON3123129631e-130
KLTH0F16060g5.434ON3093079551e-129
TPHA0G00210singletonON3113129531e-129
KAFR0E038405.434ON3103139331e-126
NCAS0F033805.434ON3133139311e-125
TBLA0A02835singletonON3113119211e-124
TDEL0D00230singletonON3123139201e-124
Kwal_55.214265.434ON3083079181e-124
KLLA0D10109gsingletonON3093079051e-122
KLTH0E00220gsingletonON3063049001e-121
KLTH0A00528gsingletonON3063049001e-121
NDAI0B056705.434ON3183088721e-116
AER401W5.434ON3133098351e-111
KLLA0F02728g3.108ON3303115602e-69
KLTH0C10010g3.108ON3213145583e-69
NDAI0A070003.108ON3202985505e-68
Kwal_56.226113.108ON3212875437e-67
KAFR0G013503.108ON3243125384e-66
YBR149W (ARA1)3.108ON3443085387e-66
NCAS0I024203.108ON3202935322e-65
SAKL0C09922g3.108ON3222865323e-65
Skud_2.2763.108ON3443085256e-64
Suva_4.3983.108ON3443085187e-63
TDEL0D051603.108ON3252785142e-62
Smik_2.289singletonON3443085119e-62
Smik_2.2883.108ON3443085101e-61
KNAG0K020703.108ON3233105036e-61
ZYRO0B06138g3.108ON3283014924e-59
SAKL0C10626gsingletonON3222904881e-58
KLTH0F16610g5.409ON3293294691e-55
KNAG0B03780singletonON3263304663e-55
NCAS0A066605.409ON3263284611e-54
ACL107C5.409ON3543304604e-54
Ecym_55085.409ON3263144471e-52
NDAI0D016005.409ON3273344462e-52
TBLA0F01720singletonON3263294402e-51
CAGL0I01122g5.409ON3263324383e-51
TPHA0E018605.409ON3263334351e-50
ZYRO0A06336g5.409ON3273334332e-50
Kwal_55.215365.409ON3293364307e-50
SAKL0G01914g5.409ON3293364271e-49
KAFR0C05320singletonON3273404253e-49
KAFR0G009207.468ON2862904214e-49
Suva_15.3005.409ON3273304236e-49
Skud_8.1655.409ON3273094228e-49
YHR104W (GRE3)5.409ON3273084201e-48
Kpol_1013.827.468ON2852834163e-48
TBLA0A00630singletonON3283144183e-48
TDEL0E021505.409ON3293334175e-48
SAKL0F14278g7.468ON2862834121e-47
Smik_8.1825.409ON3273084142e-47
KLLA0F03256g7.468ON2852784075e-47
KLLA0E21627g5.409ON3293104098e-47
KNAG0D013707.468ON2822894058e-47
Kwal_47.182197.468ON2932884023e-46
Ecym_7160na 2ON2712883926e-45
KLTH0G05786g7.468ON2862833911e-44
ABL209Cna 2ON3102883922e-44
Suva_12.1847.468ON2822883883e-44
YJR096W7.468ON2822883874e-44
CAGL0C04543g7.468ON2872743866e-44
Smik_10.3847.468ON2822883735e-42
Skud_10.3187.468ON2822873701e-41
NCAS0H005607.468ON2842873665e-41
Kwal_47.18893na 3ON2892933632e-40
Kwal_33.13276na 4ON3022863562e-39
KLLA0F05775g7.285ON3093023572e-39
TDEL0C033207.468ON2832873552e-39
KLTH0G02420gna 3ON2893013543e-39
KLTH0F01892gna 4ON3022783546e-39
CAGL0J09394g7.285ON3113053539e-39
Kwal_47.19278na 5ON3143163493e-38
TBLA0F019807.285ON3023163423e-37
NCAS0A137407.285ON3093043424e-37
Kpol_1020.137.285ON3133063391e-36
SAKL0F02574gna 3ON2892923353e-36
Smik_4.1137.285ON3123103353e-36
Skud_4.1317.285ON3123113353e-36
KLTH0G00638gna 5ON3133103354e-36
KNAG0C041107.285ON3113103346e-36
ZYRO0G17600g7.468ON2832873326e-36
YDL124W7.285ON3123113321e-35
ZYRO0E09614gna 5ON3083123293e-35
KAFR0B012007.285ON3152603275e-35
SAKL0F00704gna 5ON3153043277e-35
ZYRO0C09196g7.285ON3123043153e-33
NDAI0A023007.285ON3132583111e-32
Kpol_381.8singletonON3093133092e-32
TDEL0D02790singletonON3292993033e-31
SAKL0F09746g7.285ON3123023004e-31
Ecym_32647.285ON3113102725e-27
Kwal_33.13274singletonON108911693e-14
Suva_4.1227.285ON2062351111e-05
Ecym_22962.604ON3402021121e-05
Suva_12.272singletonON2651931067e-05
TDEL0A08000singletonON3191821041e-04
TBLA0B10110singletonON345329960.002
ABR094W2.604ON359176950.002
Kwal_26.83772.604ON338143910.007
KLTH0E01474gsingletonON313196890.009
TBLA0E05040singletonON342307900.010
Suva_9.17singletonON308195880.013
Kpol_2000.109singletonON342225880.016
Kpol_400.9singletonON341298840.047
KLLA0B09658g3.462ON342190830.071
TBLA0G01120singletonON343147820.085
SAKL0H09438g8.565ON342298820.090
KNAG0M023402.604ON309148800.14
Kpol_449.4singletonON341321800.16
SAKL0F03696g3.462ON34436770.37
NDAI0I01760na 6ON339291770.39
AAR033W3.462ON341180750.62
Skud_13.1972.604ON35184731.2
KLLA0C13343g2.180ON21052711.3
NDAI0B013002.604ON33381721.3
KAFR0C03670singletonON343346693.2
KAFR0F03890singletonON319112659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01910
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   643   0.0  
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   431   e-152
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   426   e-151
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   418   e-147
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   416   e-146
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   412   e-145
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   412   e-145
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   409   e-144
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   409   e-144
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   408   e-143
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   407   e-143
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   406   e-143
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   405   e-142
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   404   e-142
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     402   e-141
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   401   e-141
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   398   e-139
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     392   e-137
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   389   e-136
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   388   e-135
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   385   e-134
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   384   e-134
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   383   e-134
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     377   e-131
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   375   e-130
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   372   e-129
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 371   e-129
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   363   e-126
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     363   e-125
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     359   e-124
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   358   e-124
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   358   e-124
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   353   e-122
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   351   e-121
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   351   e-121
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   340   e-116
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   326   e-111
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   220   2e-69
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   219   3e-69
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   216   5e-68
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   213   7e-67
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   211   4e-66
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   211   7e-66
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   209   2e-65
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   209   3e-65
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   206   6e-64
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   204   7e-63
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   202   2e-62
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   201   9e-62
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   201   1e-61
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   198   6e-61
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   194   4e-59
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   192   1e-58
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   185   1e-55
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               184   3e-55
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             182   1e-54
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   181   4e-54
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   176   1e-52
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               176   2e-52
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     174   2e-51
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   173   3e-51
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   172   1e-50
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   171   2e-50
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   170   7e-50
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   169   1e-49
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   168   3e-49
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   166   4e-49
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   167   6e-49
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   167   8e-49
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   166   1e-48
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   164   3e-48
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     165   3e-48
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   165   5e-48
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   163   1e-47
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   164   2e-47
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   161   5e-47
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   162   8e-47
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   160   8e-47
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   159   3e-46
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   155   6e-45
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   155   1e-44
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   155   2e-44
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   154   3e-44
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   153   4e-44
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   153   6e-44
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   148   5e-42
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   147   1e-41
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   145   5e-41
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   144   2e-40
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   141   2e-39
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   142   2e-39
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   141   2e-39
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   140   3e-39
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   140   6e-39
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   140   9e-39
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   139   3e-38
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   136   3e-37
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   136   4e-37
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   135   1e-36
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   133   3e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   133   3e-36
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   133   3e-36
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   133   4e-36
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   133   6e-36
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   132   6e-36
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   132   1e-35
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   131   3e-35
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   130   5e-35
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   130   7e-35
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   125   3e-33
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     124   1e-32
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   123   2e-32
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     121   3e-31
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   120   4e-31
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   109   5e-27
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    70   3e-14
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    47   1e-05
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    48   1e-05
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    45   7e-05
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              45   1e-04
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    42   0.002
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    41   0.002
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    40   0.007
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    39   0.009
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             39   0.010
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     39   0.013
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    39   0.016
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    37   0.047
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    37   0.071
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    36   0.085
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    36   0.090
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    35   0.14 
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    35   0.16 
SAKL0F03696g Chr6 complement(292000..293034) [1035 bp, 344 aa] {...    34   0.37 
NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON}               34   0.39 
AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic ho...    33   0.62 
Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {...    33   1.2  
KLLA0C13343g Chr3 complement(1139922..1140554) [633 bp, 210 aa] ...    32   1.3  
NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.6...    32   1.3  
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    31   3.2  
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      30   9.8  

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
           RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
           SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR
Sbjct: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
           HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN
Sbjct: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300

Query: 301 APDMSPFPLFE 311
           APDMSPFPLFE
Sbjct: 301 APDMSPFPLFE 311

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  431 bits (1108), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 250/309 (80%)

Query: 3   ATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEV 62
            TL N+TST+KLNTG TIPQVGLGTWRSKE +GYKAV  ALKAGYRHIDGAA+Y NE EV
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61

Query: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           GKAI+DSG+PR E+F+TTKLW TQQRNPQEAL+QSL+RLGL+YVDLYL+HWPVPL+T+ I
Sbjct: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121

Query: 123 TDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182
            DGNL     K DG  DVD EW+F+KTWELMQ+L ++ K +++GVSNFS+NNLK+LLA+P
Sbjct: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K+ PAV QVE+HPLLPQ  L  F KE+ I +EAYSPLGG  AP+L DP +++IA  + 
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
            +AG+VV+SW VQ+G+VTLPKS TP R+V NL+   LSD ++  ++ L K++G++RT   
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 303 DMSPFPLFE 311
           D SPFP+F+
Sbjct: 302 DFSPFPIFQ 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  426 bits (1096), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 241/304 (79%)

Query: 5   LSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGK 64
           L NNT   KLNTG TIP +G GTWRS E +GY AV +A+K GYRHID AA+Y NE  VG+
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 65  AIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD 124
           AIRDSG+PREELF+TTKLWNTQQR P +AL+QSL+RLGL+YVDLYL+HWP+P+KT RITD
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITD 123

Query: 125 GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
           GNL S P KEDGKPDVDTEWD++KTW+LMQELP T K R+VGVSN S++ L++LLA  GN
Sbjct: 124 GNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGN 183

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
           K+VPAV QVE HPLLPQ  L DFC +H+I +EAYSPLG  G+P++D+P+IK+IA ++NAD
Sbjct: 184 KVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNAD 243

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDM 304
              +++SW ++RG V LPKS TP R+ SNL+T  L DE+   IN L   +G+KR N P+ 
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPEW 303

Query: 305 SPFP 308
             FP
Sbjct: 304 FTFP 307

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  418 bits (1075), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 243/309 (78%), Gaps = 2/309 (0%)

Query: 4   TLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG 63
           +L N  + VKLNTG  +P VGLGTW+S E D YKAV  ALK GYRHIDGAAIY NE EVG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  KAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRIT 123
           KAIRDSG+PR E+F+TTKLW TQQR PQ ALEQSLERLGL+YVDLYL+HWP+PL   +  
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
           + GN L+ P   +GK DVD + W+FVKTWELMQELP T K ++VGVSNFSINN+KELL+S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241
           PGNKLVPAV Q+E+HPLLPQ  L +FCKE  I VEAYSPLGG GA +L +P+++++A ++
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNA 301
           N  A N+VVSW VQRG+V LPKS T  R++SNL+T  L+ E++  I NLSK +G+KRT A
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 302 PDMSPFPLF 310
           PD SPF  F
Sbjct: 302 PDFSPFNTF 310

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  416 bits (1068), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/312 (63%), Positives = 242/312 (77%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MSATL  +T T+ LNTG  IPQVGLGTW+SK+ D YK+V AALK GYRHID AAIY NE+
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VG+AI+DSG+PREE+F+TTKLW TQ   P +AL+QSL+RLGL+YVDLYLMHWPV L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I DG++LS P KEDG   VD T W+F+KTWELMQELPKT K R+VGVSNFSINNLK+LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           ASPGN+L PA  QVE+HPLLPQ  L DFCK   I VEAYSPLG   AP+L +P++ +IA 
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++N   G+VV+SW  QRG V LPKS  P+R+ +N + F LSDE+  +INN+SK +G+KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 300 NAPDMSPFPLFE 311
             PD SPF  F+
Sbjct: 301 VNPDWSPFEAFK 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/312 (62%), Positives = 240/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL N+++T+KLNTG +IP +G GTWRS +  GY +V AALKAGYRHID AAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVGKAI+DSG+PREE+FITTKLW T+QR+P+ AL++SL+RLGL+YVDLYLMHWPVPLKT 
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            ITDG+ L  P  EDG  DVDT EW+FVKTW+LMQ+LPKT K ++VGVSNFSINN+KELL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            SP NKLVPA  Q+EIHPLLPQ  L  FCKE  I VEAYSP G   AP+L +  I  +A 
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +H  +   +++SW +QRG V L KS  PERVVSN + F L +++  +I+NLSK  G+KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 300 NAPDMSPFPLFE 311
                + FP+FE
Sbjct: 301 VNMQWNSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 240/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL N+++T+KLNTG +IP +G GTWRS + +GY +V AALKAGYRHID AAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVG+AI+DSG+PREE+FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT 
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
           R+TDGN+L  P  EDG  D+DT EW+F+KTWELMQELPKT K ++VGVSNFSINN+KELL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            SP NK+VPA  Q+EIHPLLPQ  L  FCKE  I VEAYSP G   AP+L +  I  +A 
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +H  +   +++SW +QRG V L KS  PER+VSN + F L +++  +I+NLSK  G KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 300 NAPDMSPFPLFE 311
                  FP+F+
Sbjct: 301 VDMKWGSFPIFQ 312

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  409 bits (1052), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 184/302 (60%), Positives = 237/302 (78%)

Query: 6   SNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKA 65
           +N+++  KL TG TIP +G GTWRS E DGY AV  ALK GYRHID AA+Y NE  VG+A
Sbjct: 5   TNSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRA 64

Query: 66  IRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG 125
           IRDSG+PR++LF+TTKLWNTQ R+P+ AL+QSL+RLGL+YVDLYL+HWP+PL+T+RITDG
Sbjct: 65  IRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDG 124

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGNK 185
           NL + P KEDGKPDVD +W +VKTWE+MQ+LP T K R+VGVSNFS+  L+ LLA+ G K
Sbjct: 125 NLFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 186 LVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNADA 245
           ++PAV QVE HPLLPQ  L  FC E+NI +EAYSPLG  G+P++++P +K+IA +HNAD 
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 246 GNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDMS 305
             V++SWG++RG V LPKS TP R+ SN +   L+D++   INN+ K +G+KR N PD  
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 306 PF 307
            F
Sbjct: 305 HF 306

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  409 bits (1051), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 238/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL N+++T+KLNTG +IP +G GTWRS + +GY +V AALK GYRHID AAIYLNEE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVG+AI+DSGI REE+FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT 
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            +TDGN+L  P  EDG  DVDT EW+F+KTW+LMQELPKT K R+VGVSNFSINN+KELL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            SP NKLVPA  QVEIHPLLPQ  L  FCKE  I VEAYSP G   AP+L +  I  +A 
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +H  +   +++SW +QRG V L KS  PERVVSN + F L +++  +I +LSK  G+KR 
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 300 NAPDMSPFPLFE 311
                + FP+FE
Sbjct: 301 VNMKWASFPIFE 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 242/312 (77%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MS TL ++T T+ LNTG  IPQVGLGTW+SK+ D YK+V AALKAGY+HID AAIY NE+
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VG+AI+DSG+PREE+F+TTKLW+TQ   P +AL++SL+RLGL+YVDLYL+HWP  L T 
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I DG++LS P K DG   VD T W+F+KTWELMQELPKT K +++GVSNFSINNLK+LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           ASPGNKL PA  QVEIHPLLPQ  L +FCK   I +EAYSPLG   AP+L +P I +IA 
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++N   G+VV+SW  QRG V LPKS  P+R+ +N + F LS+E+  +INN+SK +G+KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 300 NAPDMSPFPLFE 311
             P+ SPF  F+
Sbjct: 301 VNPNWSPFEAFK 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  407 bits (1046), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 240/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL N+++++KLNTG +IP +G GTWRS E +GY +V AALKAGYRHID AAIYLNEE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVG+AI+DSG+PRE++FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT+
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            ITDGN+L  P  +DG  DVDT EW+F+KTW+LMQELPKT K ++VGVSNFSINN+K LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            SP NKLVPA  Q+EIHPLLPQ  L  FCKE  I VEAYSP G   AP+L++  I  +A 
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +H      +++SW +QRG V L KS  PER+VSN + F L +++   I+NLSK  G+KR 
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 300 NAPDMSPFPLFE 311
                S FP+F+
Sbjct: 301 VDMKWSSFPIFK 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 236/309 (76%), Gaps = 2/309 (0%)

Query: 3   ATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEV 62
           A L  NTST+KLNTG  IP +GLGTW+S E +GY A   ALKAGYRHID AAIY NEEE+
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           G+AIRDS IPR ELF+TTKLW TQ RNP EAL+QSL+RLGL+YVDLYLMHWPV LKT  I
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 TDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
            DGNLL  P +EDG  DVD E W+FVKTWELMQELPK +KAR++GVSNFSINNLKELL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPK-EKARAIGVSNFSINNLKELLNS 180

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241
            GNK+VPA  Q+EIHPLLPQ  L +FCKE  I +EAYSPLG   AP+L +  I +IA ++
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNA 301
             +AG +V+SW  QRG V LPKS  PER+  N  TFKLSDE+  +++N +K  G++R  +
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 302 PDMSPFPLF 310
           P+  PF  F
Sbjct: 301 PNWGPFKPF 309

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  405 bits (1042), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 239/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL ++T T+ LNTG  IPQVGLGTW+SK+ D YK+V AALK GYRHID AAIY NE+
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VG+AIRDSG+PRE++F+TTKLW TQ   P +AL+QSL RLGL+YVDLYLMHWPV L   
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I DGN+LS P K+DG   VD T W+F+KTWELMQELPKT KA++VGVSNFSINNLK+LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           AS GNKL PA  QVEIHPLLPQ  L DFC+   I +E YSPLG   AP+L +P+I +IA 
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++N    +VV+SW  QRG V LPKS  P+RV +N + F LSDE+  +IN +SK++G+KR 
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 300 NAPDMSPFPLFE 311
             P+ SPF  F+
Sbjct: 301 VHPNWSPFEAFK 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  404 bits (1037), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 238/312 (76%), Gaps = 2/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
           M +TL N+T+T KLNTG TIP VGLGTW+S  E +GY+AV  ALKAGYRHID AAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
           ++VGKAI DSGIPREE+F+TTKLW TQ R+P+ AL QSLERLGL+YVDLYLMHWPV  K 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 KRITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
             I DGN  + P   +G+ D+D T W+FVKTWELMQELPKT K R+VGVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238
           L+SPGNKLVPA  QVE HPLLPQ  L  FCKE  I +EAYSPLG   AP+L +P I +IA
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
            +HN     VV+SW VQ+G V LPKS   ER+ +N +TF+LS +EM S+NNLSK +G++R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 299 TNAPDMSPFPLF 310
              P+ +PF  F
Sbjct: 301 IVQPNWAPFVPF 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 235/312 (75%), Gaps = 2/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MSA L N T+TVKLNTG  IP +GLGTWRS+  DGY +V AA K GYRHID AAIY NE+
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VGKAI + G+ R ELF+TTKLW TQQR+P+ AL QSL+RLGL+YVDLYL+HWPV  KT 
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I DGNLL+ P K+DG+ D+D  EW+F+KTWELMQ L KT K +++G+SNFSINN+KELL
Sbjct: 121 TIKDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           A+P   + PA  QVE+HPLLPQ  L  FCKE  I +EAYSPLGG  APVL D  I +IA 
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           R+N DAG VV SW VQRG V LPKS    R++SNL+TF LSD++M  INNL K +G+ RT
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 300 NAPDMSPFPLFE 311
               +  FP+F+
Sbjct: 300 CDLGIKGFPMFQ 311

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  401 bits (1030), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/312 (60%), Positives = 241/312 (77%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MS  L N+++TVKLNTG  IPQ+GLGTWRS + + Y +V +A+K GYRHID AAIY NEE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
            VGKAIRDSG+PR ELF+TTKLW TQQRNP++AL+ SL+RLGL+YVDLYL+HWP+  KT 
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I D + L+ P  +DGK DVD  +W+FVKTWEL+QELP T KA++VGVSNFS+NNLKELL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           ASPGNKLVPA  QVE+HPLLPQ  L +F K   I +EAYSPLG +G+P+L +P+I ++A 
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++  +   V+++WG+QRG V LPKS  P+RV SN + F LS E++  I+ +SK +G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 300 NAPDMSPFPLFE 311
             PD   FP+FE
Sbjct: 301 VHPDWPSFPIFE 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 238/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M ATL ++T  + LNTG  IPQ+GLGTW+SKE D YKAV  ALK GYRHID AAIY NE+
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VG+AI+DSG+PREE+F+TTKLW TQ   P+ AL+QSL+RLGL+YVDLYLMHWP  L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I + ++LS P K+DG   VD T W+F+KTWELMQELPKT K ++VGVSNFSINNLK+LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           AS GNKL PA  QVEIHPLLPQ  L +FCK   I VEAYSPLG   AP+L +P+I +IA 
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++N   G+VV+SW VQRG V LPKS  P+R+ +N + F LS E+  +INN+SK +G+KR 
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 300 NAPDMSPFPLFE 311
             P+ SPF +F+
Sbjct: 301 VHPNWSPFEVFK 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 234/312 (75%), Gaps = 4/312 (1%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
           MSA  SN+T+T KLNTG TI  VGLGTW+S  E +GY+AV AALKAGYRHID AAIY NE
Sbjct: 12  MSA--SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
            +VGKAI DSG+PREE+F+TTKLW+TQ  +P   L  SL+RLGL+YVDLYLMHWPV L  
Sbjct: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129

Query: 120 KRITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
           + I DGN LS P   DGK DV+ + WD+VKTWELMQELPKT K R+VGVSNFSINNLK++
Sbjct: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238
           L+SPGNK+VPAV QVEIHPLLPQ  L ++C    I +EAYSPLG   AP+L +P++  +A
Sbjct: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249

Query: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
            +H      +V+SW VQRG + LPKS   ER+ +N +T KLSDEEM  INN+SK +G++R
Sbjct: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309

Query: 299 TNAPDMSPFPLF 310
              P   PF  F
Sbjct: 310 IVQPHWEPFVPF 321

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 230/309 (74%), Gaps = 1/309 (0%)

Query: 4   TLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG 63
           +L N+T+T+KLNTG  IP VGLGTWRS   DGY +V AALK GYRHID AAIY NE++VG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  KAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRIT 123
           +AI+DSG+PR+E+FITTKLW T+ RNP +AL+ SL+RLGL+YVDLYLMHWPV LK     
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182
           + +LL+ P K DGK D+D E WDF+KTWELMQELPKT K +++GVSNFSINNLK L  SP
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
               VPA  QVEIHPL PQ  L ++CK  NI +EAYSP G   APVL +P + ++A+++N
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
                +++SW VQRG V LPKS   ER+ +NL+   L DE+M +I NLSK +G+KR    
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 303 DMSPFPLFE 311
           D SPFP FE
Sbjct: 302 DWSPFPTFE 310

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/312 (59%), Positives = 236/312 (75%), Gaps = 2/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEG-DGYKAVTAALKAGYRHIDGAAIYLNE 59
           MSATLS NTS +KLNTG TI  +GLGTWRS    D Y +V AAL+AGYRHID AAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
            EVG+AIR+SG+PR E+F+TTKLW TQ + P+ AL+QSL+RLGL+YVDLYLMHWPV ++ 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 KRITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
           + + +G+ +  P   +GK D+D T+W+FVKTWELMQ+LP+T K R++GVSNFSINNLK+L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238
           LASPGNK+VPA  QVE+HPLLPQ  L DFC    I +EAYSPLG   AP+L +P+I +IA
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
            ++   A  VV+SW VQRG + LPKS   ER+ +NL TF L+ E+  ++NN+SK +G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 299 TNAPDMSPFPLF 310
              PD  PF  F
Sbjct: 301 IIDPDWEPFKPF 312

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/300 (59%), Positives = 232/300 (77%), Gaps = 1/300 (0%)

Query: 8   NTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR 67
           +TS  KLNTG +IP VGLGT+ S++  GYKAV  A+K GYRHID AA+Y NE+ VG+AIR
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAIR 66

Query: 68  DSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNL 127
           DSG+PREELF+TTK+WNTQ R P +ALE+SL RLGL+YVDL+LMHWP  L+T+RITDGN+
Sbjct: 67  DSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDGNM 126

Query: 128 LSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGNKLV 187
           ++ P +ED KPDVDTEW+++KTW LMQ+LP + K ++VGVSNFS+  L++LLA PG+K+V
Sbjct: 127 ITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSKVV 186

Query: 188 PAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNADAGN 247
           PA  QVE+HPLLPQ  L DFCK+ NI + AYSPLG   AP+LDDP+I +IA +H AD   
Sbjct: 187 PACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADPAQ 246

Query: 248 VVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDMSPF 307
           +++ W V+RG V LPKS TP R+ SNL+   L+D E+  IN + K +G+KR   P+   F
Sbjct: 247 IIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEWFDF 305

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 230/309 (74%), Gaps = 3/309 (0%)

Query: 4   TLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG 63
           TLSN+T+ V LN G  +P VGLGTW+SKE D YKAV AALKAGYRHID AAIY NEEEVG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  KAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI- 122
           +AI+DSG+ R E+F+TTKLW TQ R+P +AL QSLERLGL+YVDLYLMHWPVP+   +  
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 TDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
            D N L  P  EDG  D+D   WDF+KTWELMQ LPK+ K +S+GVSNFSINN+K+LLAS
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241
           PGNK VP V QVE+HPLLPQ+ L +FCK  NI VEAYSPLG  GAP+L+   I +++ + 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNA 301
                NVV SW +QR IV LPKS T  R++SNL+T +L  EE   +NN+S   G+KR+  
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 302 PDMSPFPLF 310
           P+ +PF  F
Sbjct: 301 PNWTPFIPF 309

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  383 bits (984), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 229/307 (74%), Gaps = 1/307 (0%)

Query: 6   SNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKA 65
           SN + ++KLNTG +IP VGLGTW+S E D Y AV +AL+ GYRHID AAIY NEE VGK 
Sbjct: 4   SNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKG 63

Query: 66  IRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG 125
           IRDSG+PREE+F+TTKLW TQQR+P+ AL+ SL+RLGL+YVDLYL+HWPVPL    ITDG
Sbjct: 64  IRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDG 123

Query: 126 NLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
           N L+ P   DGK D+D  EW+F+KTWE MQ LPK+ K +++GVSNFSI N++ LLA+  +
Sbjct: 124 NYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPD 183

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
            +VPA  Q+EIHP LPQ  L D+CK   I +EAYSPLG   + +L DP I+ IA ++NA+
Sbjct: 184 FIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAE 243

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDM 304
             N+++SWG  RG V LPKS  P+R+ +NL+   LS E++  IN L++S G KR  APD 
Sbjct: 244 PANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDF 303

Query: 305 SPFPLFE 311
           SPF +FE
Sbjct: 304 SPFAIFE 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 239/312 (76%), Gaps = 2/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEG-DGYKAVTAALKAGYRHIDGAAIYLNE 59
           M++TL N T+T+KLNTG ++P +GLGTWR+ +  +GY AV +AL+AGYRHID AAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
           E VG+AIR+SGIPR+E+F+TTKLW TQ R+P  AL+QSLERLGL+YVDLYLMHWPVP++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 KRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
           K     +LL  P + DG   V+++WDF+KTWELMQELPKT K R++GVSNFSINN+ +LL
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLL 179

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            SPGNK+VPA  QVE+HPLLPQ  L  FC+E  I VEAYSP G   AP+L +  I ++A 
Sbjct: 180 KSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAK 239

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +H+  A  V++SW ++RGI  LPKS   ERVVSN +TF L +++  +INN+SK +G+KR 
Sbjct: 240 KHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRV 299

Query: 300 NAPDMSPFPLFE 311
              D SPF +FE
Sbjct: 300 VNFDWSPFKIFE 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  375 bits (963), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 183/312 (58%), Positives = 224/312 (71%), Gaps = 1/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M A L N+ + V LN G  IP VGLGTW+S+E DGY +V  ALKAGYRHID AAIY NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVG+AI+DSG+PR+++FITTKLW T+ +NP+ ALE SL+RLGL+YVDLYLMHWPV L  +
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            I D + L  P   DG  DVD E WD++KTWEL+QELP T   RSVGVSNFSINNL+++L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           +SPGNKL PAV QVE+HPLLPQ+ L  +C    I++EAYSP G   AP L    I  IA 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           ++      V+ SW VQR IV LPKS   ERV+SN + F LS E++  I+ L+K  G+KR 
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 300 NAPDMSPFPLFE 311
           N PD  PFP+FE
Sbjct: 301 NKPDWDPFPVFE 312

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 168/307 (54%), Positives = 230/307 (74%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M+  L   T+T KLNTG  IP +GLGTWRS + +GY A  AA+KAGYRHID AA+ +NE+
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
            VG+AIRDSG+PREELF+TTKLW TQ R+P+ AL QSL+RLGL+YVDLY+MHWPV  +++
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
           ++   N +  P ++DG+PDVD  WD+VKTWELMQELP T K  ++GV+NFS++ LK+L+ 
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
           SPGNK+VPA  Q+E HP LPQ  +  FCK++NI +EAYSPLG  GAP+LD+P++++I+ +
Sbjct: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
            + +   ++VSWG+QRG   L KS TP R+ +NL TF + + ++  IN L++ RG KR +
Sbjct: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300

Query: 301 APDMSPF 307
            P    F
Sbjct: 301 NPTWFSF 307

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  371 bits (953), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 224/312 (71%), Gaps = 2/312 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           MS T  N   T  +     IP V LGTW++   + Y AV  ALKAGYRHIDGAAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           EVGKAIRDSGIPR+++F+TTKLW T+QRNP  AL+ SL+RLGL+YVDLYLMHWPV LK  
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            ITD +LL+ P    GK D+D E W+F+KTWELMQELP T KA+++GVSNFSINNL ELL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
           A+P  K +PA  Q EIHPLLPQ  L  +C++  I VEAY PLGG   P++ +P+I +IA 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +   +AG +++SWG+QRG V LPKS   ER+V+N +T  +  EE   +NNL+K  G +R+
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 300 NAPDMSPFPLFE 311
              D SPFP ++
Sbjct: 300 VNIDFSPFPTYQ 311

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  363 bits (933), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 175/313 (55%), Positives = 227/313 (72%), Gaps = 7/313 (2%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWR-SKEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
           MSA L N+T T+KLN G  IP VGLGTW+ + E D Y AV AAL AGYRHID AAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
            +VG+AIRDSG+PREE+F+TTKLWN Q   P+ AL++SL+RLGL+YVDLYLMHWPV L  
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 KRITDG--NLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177
             + +    L+  P   DG   V+T+W F+ TWELMQ+LPK K  RS+GVSNFS+NNLK+
Sbjct: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKLPKNK-VRSIGVSNFSVNNLKD 176

Query: 178 LLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQI 237
           LL +P   +VP + QVE+HPLLPQY L D+C+++ I+VEAYSPLG   AP+L +PI+  +
Sbjct: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDV 236

Query: 238 ADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQK 297
           A ++     +VV+SW VQR I+ LPKS   ERV +NL+TF L +E+  +I  +S+ RG++
Sbjct: 237 AKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGER 296

Query: 298 RTNAPDMSPFPLF 310
           R N P+  PF  F
Sbjct: 297 RINNPNFEPFKTF 309

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 233/313 (74%), Gaps = 2/313 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
           M+ TL  +T+T+KLNTG  IP++ LGTWRS    DGY +V AALKAGYRHID AAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119
           ++VGKAIRDSGIPREE+F+T+KLWNTQQ NP  AL+ +L RLGL+Y+DLYLMHWPV   T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 KRITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
           + +   + +  P  E+GKPD++ + W+FVKTWELMQELP T   ++VGVSNFSINNLKEL
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238
           L SPGNKL PA  Q+EIHPLLP++ L  FC+E  I +EAYSPLG   AP+L +P I +I+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
            + +     +++SW VQRG V L KST  ER+++N + F LS E+  +I NL+K +G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 299 TNAPDMSPFPLFE 311
              PD SPFPLF+
Sbjct: 301 VVDPDWSPFPLFK 313

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/311 (54%), Positives = 226/311 (72%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M+ TL N T T+ LN G  IP +GLGT+ SK+ + Y+AV  A KAGYRH+D AA Y NEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           +VGKA++D G+PR E+++TTK+W T+ R+P+ AL++SL+RLGLEY+DLYLMHWPV LKT 
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
            I DG L+  P   DG  DVD +W FV+ WE MQ+L K+ K +S+GVSNFSINN+KELLA
Sbjct: 121 TIKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLA 180

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
           +P   +VP V QVE+ PLLP   L +FC+  +I  +AY P GG  AP++ D  + +IA  
Sbjct: 181 APTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKG 240

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
           +  DAG V+ SW VQRG V LPKS    R++SNL+TF LSD +M  +NN+SK++G+KR N
Sbjct: 241 NGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLN 300

Query: 301 APDMSPFPLFE 311
             + SPFP+FE
Sbjct: 301 NVNFSPFPIFE 311

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 223/313 (71%), Gaps = 3/313 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M+ T S  T + KLNTG  +P +GLGTW+S E D Y AV +ALKAGY+HID AAIY NE 
Sbjct: 1   MTVT-STKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNER 59

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
            VGKAIRDSGIPR+ELFITTKLW+TQ R+P+ AL+ SLERLGL+YVDLYL+H+PV  KT 
Sbjct: 60  AVGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTD 119

Query: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
           RI DGN    P   +GK DVD  +WDFVKTW L+Q LP++ K ++VGVSNFSINNLK LL
Sbjct: 120 RIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLL 179

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
            S     VPAV QVEIHP LPQ  L DFCK  +I VEAYSPLG  G+ +L D  +++IA+
Sbjct: 180 ESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAE 239

Query: 240 R-HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
           +  +A    ++++WG+ RG   LPKS TP+R+ +N R   +  E++  + NL    G KR
Sbjct: 240 KXXDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKR 299

Query: 299 TNAPDMSPFPLFE 311
              PD SPFP+FE
Sbjct: 300 YLEPDWSPFPIFE 312

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 222/307 (72%), Gaps = 1/307 (0%)

Query: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60
           M+  L   T+T  LNTG  IP +GLGTWR  +  GYKA+ AALKAGYRHID AA+ +NE+
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
            +GKAIRDSG+ R+ELF+TTKLW+TQ R+P  AL+QSL+RLGLEYVDLY+MHWP+  +  
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
           +I   N +  P   +GKP VDT+WD+VKTWELMQ+LP T+K R++GV+NFS+  L  LL 
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLK 179

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
           SP NK++PA  Q+E HP LP   +  FC+E  I +EAYSPLGG G P++D+P+I++I+ +
Sbjct: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
            + +   +++SWG++RG   LPKS T  R+ SNL  F LSDE+   I+ +++ RG KRT+
Sbjct: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299

Query: 301 APDMSPF 307
            P    F
Sbjct: 300 NPPWFSF 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 214/307 (69%), Gaps = 3/307 (0%)

Query: 6   SNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKA 65
           S    ++KLNTG +IPQ+G GTW S   D Y AV  ALK GYRHID AA+Y NE  VGK 
Sbjct: 5   SGEFPSLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKG 64

Query: 66  IRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG 125
           IRDSGIPREE+F+TTKLWNTQQR+P  AL++SLERLGL+YVDL+L+HWPVPLK     + 
Sbjct: 65  IRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE- 123

Query: 126 NLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
           NLL  P     KP +DTE W F+KTWELMQ LPKT K R+VGVSNFSI NL++LL S  +
Sbjct: 124 NLLKYPTP-GIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPD 182

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
            LVPAV Q EIHP LPQ  L ++CK   I VEAY PLG   + +L DP I +IAD+++  
Sbjct: 183 VLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVK 242

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDM 304
             NV+++WG+ RG   LPKS TP R+ SN     LS E+   I  LS++ G KR   PD 
Sbjct: 243 PANVLINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDF 302

Query: 305 SPFPLFE 311
            P+PLFE
Sbjct: 303 EPYPLFE 309

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 221/304 (72%), Gaps = 1/304 (0%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD 68
           T  +++NTG  IP +GLGTW++ +GD Y+AV AAL++GYRHID AAIY NE  VG+AIRD
Sbjct: 3   TLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRD 62

Query: 69  SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLL 128
           SG+PRE++F+TTKLW TQQR+PQ AL  SLERLGL+YVDLYLMH+PV LKT  I DGN+L
Sbjct: 63  SGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVL 122

Query: 129 SSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGNKLV 187
           S P + DG  DVD + W FVKTW+LMQ+LPK+ K +++GVSNFSI N++E+L       V
Sbjct: 123 SIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSV 182

Query: 188 PAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNADAGN 247
           PA  Q+EIHP LPQ  L ++CK   I VEAYSPLG   + +L DP + ++A++H  +   
Sbjct: 183 PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQ 242

Query: 248 VVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDMSPF 307
           +++SWGV RG   LPKS   +RV SNL+  KLS  ++  I+ + +  G KR  +P  +PF
Sbjct: 243 ILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

Query: 308 PLFE 311
           P++E
Sbjct: 303 PMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 221/304 (72%), Gaps = 1/304 (0%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD 68
           T  +++NTG  IP +GLGTW++ +GD Y+AV AAL++GYRHID AAIY NE  VG+AIRD
Sbjct: 3   TLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRD 62

Query: 69  SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLL 128
           SG+PRE++F+TTKLW TQQR+PQ AL  SLERLGL+YVDLYLMH+PV LKT  I DGN+L
Sbjct: 63  SGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVL 122

Query: 129 SSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGNKLV 187
           S P + DG  DVD + W FVKTW+LMQ+LPK+ K +++GVSNFSI N++E+L       V
Sbjct: 123 SIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSV 182

Query: 188 PAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNADAGN 247
           PA  Q+EIHP LPQ  L ++CK   I VEAYSPLG   + +L DP + ++A++H  +   
Sbjct: 183 PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQ 242

Query: 248 VVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPDMSPF 307
           +++SWGV RG   LPKS   +RV SNL+  KLS  ++  I+ + +  G KR  +P  +PF
Sbjct: 243 ILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

Query: 308 PLFE 311
           P++E
Sbjct: 303 PMYE 306

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  340 bits (872), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 216/308 (70%), Gaps = 8/308 (2%)

Query: 12  VKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRDSG 70
           +KL+TG +IPQ+GLGTWRS    D Y +V AALK GYRHID AAIY NE +VGKAIRDSG
Sbjct: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70

Query: 71  IPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGN---- 126
           +PR E+F+T+KLW  Q  +P+ AL Q+L+RLGL+Y+DLYLMHWPV    + I D +    
Sbjct: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130

Query: 127 -LLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
             ++ P   +G  DV+ + W+F+KTWELMQ LP++ K ++VGVSNFSINNL +LLA+   
Sbjct: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
           K+VPA  Q+E+HPLL Q  L  +CKE NI VEAYSP G   AP+L D  I  IA + +  
Sbjct: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250

Query: 245 AGNVVVSWGVQR-GIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPD 303
            G VV+SW +QR G V LPKS   ER+++N +   L DE+  +INNL K +G+ R   PD
Sbjct: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310

Query: 304 MSPFPLFE 311
            SPFPLF+
Sbjct: 311 WSPFPLFK 318

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  326 bits (835), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 214/309 (69%)

Query: 3   ATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEV 62
           ATL  +T TV LNTG  IP  GLGTW+S + D   AV AALK GY+HID A+ Y NEE V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           GKA+++SGIPREELFITTK+WN QQR+P  AL+ SL++LG EYVDL LMHWPVP K    
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 TDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182
           +  +    P   DGK   D EWDFVKTW LMQ+L  T K +++GVSNFSINNL+ELL + 
Sbjct: 125 STLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAE 184

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
           G  +VPAV QVE+H  LPQ  L ++C++  I VEAYSPLG   AP+L D  + ++A+++ 
Sbjct: 185 GTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYG 244

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               +V++++   RGIV LPKS    R++SN   FK+ +E++  +N++ K  G +R   P
Sbjct: 245 VTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDP 304

Query: 303 DMSPFPLFE 311
           D SPFPLF+
Sbjct: 305 DFSPFPLFQ 313

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  220 bits (560), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 188/311 (60%), Gaps = 17/311 (5%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
            N G  +P  GLGT    E   +  +AV AA+KAGYRHID A  Y  EE VG+A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD--- 124
              + RE+L IT+K+W+T   +  ++L +SL RL ++YVDL+L HWP  L T+++ D   
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDPHG 130

Query: 125 -GNLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLA 180
              +   P  + G P  D + D+++T++ ++++      K+ R++GVSNF I  LK +L 
Sbjct: 131 VDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLK 190

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
               + VPA  QVE+HP LPQ  LC+FC EH I V AYSPLGG+GAP+L+ PI+K + ++
Sbjct: 191 E--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEK 248

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
           +NA   +++ S+ +++G + +P+S    R+ SNL    LS+E++  +N   +   ++  N
Sbjct: 249 YNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYIN 308

Query: 301 APDMSPFPLFE 311
               S  P F+
Sbjct: 309 GAVSSVIPGFK 319

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  219 bits (558), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 191/314 (60%), Gaps = 12/314 (3%)

Query: 7   NNTSTVKLNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNEEEVGK 64
           N      LN G  +P +GLGT    E      +AV AA+K+GYRHID A  Y  E+ VG+
Sbjct: 6   NTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGE 65

Query: 65  AIRD----SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           A+++      + RE++F+TTK+W T      E++ +SLE LGL++VDL L HWP+     
Sbjct: 66  ALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRL 125

Query: 121 RITDG--NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL--PKTKKARSVGVSNFSINNLK 176
              DG   +  +P  EDG P  + + D+++T++ +++L   K  + R++GVSN+ +  L+
Sbjct: 126 EDPDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLE 185

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQ 236
            LL     ++VPA+ QVE HP LPQ  L DFC +HNI++EAYSPLG   AP++D+ ++K+
Sbjct: 186 RLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKK 243

Query: 237 IADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQ 296
           IA ++     NV++++ +++G+V++P+S  P+ + SN++   LS E++ ++N       +
Sbjct: 244 IAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVENTK 303

Query: 297 KRTNAPDMSPFPLF 310
           +  + P  +  P F
Sbjct: 304 RIVDEPFAAAIPGF 317

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  216 bits (550), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 113/298 (37%), Positives = 185/298 (62%), Gaps = 14/298 (4%)

Query: 5   LSNNTST---VKLNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNE 59
           +++ TST     LN G  IP +GLGT   K+   +  +AV AA++AGYRHID A  Y  E
Sbjct: 1   MTHPTSTEIYFNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTE 60

Query: 60  EEVGKAIRD----SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPV 115
             +G+A+++    + I REELFITTK+W T   NP ++++QSL+ LG++YVDL L HWPV
Sbjct: 61  PYIGQALKELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPV 120

Query: 116 PLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSI 172
             +    + GN++  P  +DG    + + D++ T++ ++++   PK  + R++GVSN+ I
Sbjct: 121 CFQKVENSQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPI 180

Query: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP 232
             L+ L      K+ PA+ QVE+HP LPQ  L  FC +H I + AYSPLG  GAP L   
Sbjct: 181 EYLERLFKE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIK 238

Query: 233 IIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNL 290
            ++ +A ++  +  +++ S+ + +G V LP+S  P+R+ +N+   KL+D+++  ++ +
Sbjct: 239 SVQDLAKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQV 296

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  213 bits (543), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 109/287 (37%), Positives = 184/287 (64%), Gaps = 12/287 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  +P +GLGT    E      +AV AA+K+GYRHID A  Y  E+ +G+A+++   
Sbjct: 13  LNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKELFE 72

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
              I RE++FITTK+W T      E++ +SLE LG++YVDL L HWP+     +  +G  
Sbjct: 73  EGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRLQDPEGID 132

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQE--LPKTKKARSVGVSNFSINNLKELLASPG 183
            +  +P  EDG P  + + D+++T++ +++  L K  + RS+GVSN+ +  L+ LL    
Sbjct: 133 GICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERLLKE-- 190

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K+VPAV QVE+HP LPQ  L DFC +HNI++EA+SP G  G+P++ + +++++A +++ 
Sbjct: 191 CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVAQKYSC 250

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNL 290
              +V++++ +++G+VT+P+S  P+ + SN++   LS E++  +N  
Sbjct: 251 TPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKF 297

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  211 bits (538), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 185/312 (59%), Gaps = 18/312 (5%)

Query: 13  KLNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD-- 68
           KLN G TIP +G GT+  +E   +  +AV AA+KAGYRHID A +Y +E  VG+AI++  
Sbjct: 12  KLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMI 71

Query: 69  --SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD-- 124
               + R +LF+TTK+W     N +++L +SLE LGL+YVDL L HWP  L   R+ D  
Sbjct: 72  EEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWP--LCFPRVEDEK 129

Query: 125 ---GNLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKEL 178
                L++ P  ++GKP ++ + DF++T+  ++++   P   + R++GVSN++I  L+ L
Sbjct: 130 NGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEAL 189

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238
                 K+ P V QVEIHP LPQ  L  FC  H I + AYSPLG  GAP L  P++ Q+A
Sbjct: 190 FKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLA 247

Query: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298
           ++++    ++++S+ +++G   +P+S  P R+ S +     + EE+  ++N+      + 
Sbjct: 248 EKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIEEPARF 307

Query: 299 TNAPDMSPFPLF 310
            +A      P F
Sbjct: 308 VDAAFAQQIPGF 319

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  211 bits (538), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 182/308 (59%), Gaps = 13/308 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR---- 67
           LN G  IP +GLGT    E   +  +AV AA+KAGYRHID A  Y  E  VG+AI+    
Sbjct: 27  LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 68  DSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
           D  I RE+LFITTK+W         +L +SL+ LGLEYVDL L HWP+  +  +   G  
Sbjct: 87  DGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGIS 146

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L+ +P  + GK     + D+++T++ ++++   P   + R++GVSNFSI  L+ L+   
Sbjct: 147 GLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKE- 205

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             ++ P V QVE HP LPQ  L  FC  H+I + AYSPLG HGAP L  P++K++A+++N
Sbjct: 206 -CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAEKYN 264

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               ++++S+ +++G + +P+S  P R+ S++    L+ +E+  +N+  +    +  + P
Sbjct: 265 VTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKYPVRFIDEP 324

Query: 303 DMSPFPLF 310
             +  P F
Sbjct: 325 FAAILPEF 332

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  209 bits (532), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 174/293 (59%), Gaps = 11/293 (3%)

Query: 7   NNTSTVKLNTGYTIPQVGLGTW--RSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGK 64
           N      LN G  IP +GLGT   + +  +  KAV AA++AGYR ID A  Y  E  +G+
Sbjct: 6   NTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGE 65

Query: 65  AI----RDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
           A+    RD  I RE+LFITTK+W     +P  ++ +SL+ LG++YVD+ L HWP+  K  
Sbjct: 66  ALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKT 125

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKE 177
              +G ++  P  +DGK       D++ T++LM+++   PK  + R++GVSN+ I  L+ 
Sbjct: 126 YDENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLER 185

Query: 178 LLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQI 237
           ++     K+ P + QVE+HP LPQ  L DFC ++ I + AYSPLG  GAP    P++++ 
Sbjct: 186 VIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEY 243

Query: 238 ADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNL 290
           A +H     +++ S+ V++G V +P+S  PERV SN+    L+  EM S+++ 
Sbjct: 244 AKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDF 296

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  209 bits (532), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 178/286 (62%), Gaps = 13/286 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  IP VGLGT   K+      +AV AA+KAG+R ID A  Y  EE +G+A+++   
Sbjct: 13  LNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQELFA 72

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGN- 126
              + RE+LFITTK+W       +++L +SL+RL L+YVDL L HWP     K+  +G+ 
Sbjct: 73  EGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPEGSG 132

Query: 127 -LLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L++ P  EDG P  DT  D+++T++ ++ +       + R++GVSN+ I  L+ L    
Sbjct: 133 QLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERLFKE- 191

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K VPA+ QVE+HP LPQ  LCD+C +H I + +YSPLG +GAP L  P+++++A ++N
Sbjct: 192 -CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELASKYN 250

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSIN 288
           A+  +V+VS+ +++G + +P+S   ER+   L    L+ EE+  +N
Sbjct: 251 ANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLN 296

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  206 bits (525), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 183/308 (59%), Gaps = 13/308 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR---- 67
           LN G  IP +GLGT    E   +  +AV AA+KAGYRHID A  Y  E  VG+AI+    
Sbjct: 27  LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 68  DSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
           D  I RE+LFITTK+W         +L +SL+ LGL+YVDL+L HWP+  +  +   G  
Sbjct: 87  DGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEKVKDPKGLS 146

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L+ +P  + GK    +  D+++T++ ++++   P   + R++GVSNFSI  L+ L+   
Sbjct: 147 GLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERLIKE- 205

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             ++ P V QVE HP LPQ A+  FC  H+I + AYSPLG +GAP L  P++K++ +++N
Sbjct: 206 -CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLTEKYN 264

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               +V++S+ +++G + +P+S  P R+ S++    L+ +E+  +N+  +    +  + P
Sbjct: 265 LTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGEKYPVRFIDEP 324

Query: 303 DMSPFPLF 310
             +  P F
Sbjct: 325 FAAILPEF 332

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  204 bits (518), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 184/308 (59%), Gaps = 13/308 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  +P +GLGT    E   +  +AV AA+KAGYRHID A  Y  E  VG+AI++   
Sbjct: 27  LNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
              I RE+LFITTK+W       + +L +SL+ +GL+YVDL+L HWP+  +  +   G  
Sbjct: 87  EGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEKVKDPKGIS 146

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L+ +P  + G+  + +  D+++T++ ++++   P   + R++GVSNFSI  L+ L+   
Sbjct: 147 GLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLVKE- 205

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             ++ P V QVE HP LPQ  L  FC  H+I + AYSPLG +GAP L  P++K++ +++N
Sbjct: 206 -CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLVEKYN 264

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               +V++S+ +++G + +P+S  P R+ S++    L+ +E+  +N+  +    +  + P
Sbjct: 265 VTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEKYPVRFIDEP 324

Query: 303 DMSPFPLF 310
             +  P F
Sbjct: 325 FAASLPEF 332

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  202 bits (514), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 174/278 (62%), Gaps = 13/278 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  +P +GLGT    E   +  +AV AA+KAGYR+ID A  Y +E  VG+AI++   
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
              I RE+LFIT+K+W     + + +L++SL+ LG++Y+DL+L HWP+    +    G  
Sbjct: 73  EGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRREDPHGIN 132

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L  +P K DG PD + + D++ T++ M+ +   PK  + R++GVSNF +  LK +L   
Sbjct: 133 GLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRVLKEC 192

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K  P + QVE+HP LPQ+ L +FC +++I++ AYSPLG HGAP++  P+IK+++ ++ 
Sbjct: 193 PVK--PVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKEMSQKYK 250

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLS 280
           A   +++ S+ +++G   +P+S    R+ SN+    LS
Sbjct: 251 ASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  201 bits (511), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 179/308 (58%), Gaps = 13/308 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  IP +GLGT   +E   +  +AV AA+KAGYRHID A  Y  E  VG+AI++   
Sbjct: 27  LNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKELLE 86

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
              I RE+LFITTK+W         +L +SL+ LGL+YVDL L HWP+  +  +   G  
Sbjct: 87  EGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEKVKDPKGIS 146

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
            L+ +P  + GK    +  D+++T++ ++++       + R++GVSNFSI  L+ L+   
Sbjct: 147 GLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIKE- 205

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K+ P V QVE HP LPQ  L  FC  H+I + AYSPLG  GAP L  P++K++ +++N
Sbjct: 206 -CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEKYN 264

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               ++++S+ +++G + +P+S  P R+ SN+    L+ +E+  +N   +    +  + P
Sbjct: 265 VTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKYPVRFIDEP 324

Query: 303 DMSPFPLF 310
             +  P F
Sbjct: 325 FAAVLPEF 332

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  201 bits (510), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 178/308 (57%), Gaps = 13/308 (4%)

Query: 14  LNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LN G  IP +GLGT   +E   +  +AV AA+KAGYRHID A  Y  E  VG+AI++   
Sbjct: 27  LNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDG-- 125
              I RE+LFITTK+W         +L +SL+ LGL+YVDL L HWP+     +  +G  
Sbjct: 87  EGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEGIS 146

Query: 126 NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLASP 182
             +  P  + GK    +  D+++T++ ++++       + R++GVSNFSI  L+ L+   
Sbjct: 147 GYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIKE- 205

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K+ P V QVE HP LPQ  L  FC  H+I + AYSPLG  GAP L  P++K++ +++N
Sbjct: 206 -CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEKYN 264

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302
               ++++S+ +++G + +P+S  P R+ SN+    L+ +E+  +N   +    +  + P
Sbjct: 265 VTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKYPVRFMDVP 324

Query: 303 DMSPFPLF 310
            ++  P F
Sbjct: 325 SVAILPGF 332

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  198 bits (503), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 181/310 (58%), Gaps = 14/310 (4%)

Query: 13  KLNTGYTIPQVGLGTWRSKE--GDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD-- 68
           KLN G  +P +GLGT   +E   +  +AV AA+KAGYRHID A  Y  E  +G A+++  
Sbjct: 12  KLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELL 71

Query: 69  --SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPL-KTKRITDG 125
               + R +LFIT+K+W     +   +L +SL+ LGL+YVDLYL HWP+   K +   DG
Sbjct: 72  ENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKDG 131

Query: 126 --NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELLA 180
              L   P  +DG   +    D++ T++ M+++   PK  + R++GVSN+ +  L  LL 
Sbjct: 132 VNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRLLK 191

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
               K  PAV QVE+HP LPQ+ L +FC+ H+I++ AYSPLG  GAP+L  P++K+++++
Sbjct: 192 VCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELSEK 249

Query: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300
           +     +V++S+ +++G   +P+S  P R+   +    L++ E+  ++++ +    +  +
Sbjct: 250 YQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRKDSIRYID 309

Query: 301 APDMSPFPLF 310
                  P F
Sbjct: 310 GSFAKTIPGF 319

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  194 bits (492), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 181/301 (60%), Gaps = 13/301 (4%)

Query: 11  TVKLNTGYTIPQVGLGTW--RSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD 68
           +  LN G  +P +GLGT     + G   +AV AA+KAGYRHID A  Y +E  VG+AI++
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 69  ----SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD 124
                 I RE++FIT+K+W     + + +L +SLE LG++Y+DL+L HWP+    +  T 
Sbjct: 73  LMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVKQEDTH 132

Query: 125 G--NLLSSPAKEDGKPDVDTEWDFVKTWELMQEL---PKTKKARSVGVSNFSINNLKELL 179
           G   L  +P   +G+P  + + D+++T+  M+++   P   + RS+GVSNF +  L+  L
Sbjct: 133 GINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLERTL 192

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239
                K  PAV QVE+HP LPQ+ L  FC+ HNI +EAYSPLG H AP +   +++ +A+
Sbjct: 193 FECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQDLAE 250

Query: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299
           +++     ++ S+ +++G   + +S    R+ SN+    L++EE+ +++ L  ++ ++  
Sbjct: 251 KYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITKPKRFV 310

Query: 300 N 300
           N
Sbjct: 311 N 311

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  192 bits (488), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 179/290 (61%), Gaps = 11/290 (3%)

Query: 14  LNTGYTIPQVGLGTWRSKEG--DGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD--- 68
           LNTG  IP +GLGT    E       AV  A+K GYR ID A +Y +E  +G+A+++   
Sbjct: 13  LNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELFE 72

Query: 69  -SGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNL 127
              + RE+LFITTK+W       +++L++SL++L L+YVDL L HWP+    +    G L
Sbjct: 73  EGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHGKL 132

Query: 128 LSSPAK-EDGKPDVDTEWDFVKTWELMQELPK--TKKARSVGVSNFSINNLKELLASPGN 184
            S P   + G   +D + D++ TW+ ++++ K  + + R++GVSN+ +  L+ LL     
Sbjct: 133 KSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE--T 190

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
           ++VP + QVE+HPLLPQ  L ++C  H I +E++SPLG  G P L+ P++K+++ +++ +
Sbjct: 191 EVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYDCE 250

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSR 294
            G+V++++ V++G V +P+S    R++ N     LS+E++  ++ L + +
Sbjct: 251 PGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  185 bits (469), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 183/329 (55%), Gaps = 32/329 (9%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           + TVKLN G  +P VGLG W+         V  A+K GYR  DGA  Y NE+EVG+ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSGI-PREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLK---- 118
             D GI  RE+LF+ +KLWN+    +N ++AL+++L+ LGLEY+DL+ +H+P+  K    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177
            +R   G    + A+++ K  +  E    + T+  +++       +++GVSNF    L +
Sbjct: 125 EERYPPG--FYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHD 182

Query: 178 LLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHGA 226
           LLA  G K+ PA LQ+E HP L Q  L ++CK+  IQV AYS  G               
Sbjct: 183 LLA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKST 240

Query: 227 PVL-DDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT---FKLSDE 282
           P L +  ++K++A+ H      V++ W  QR +  +PKS+  ER+++NL+      LSDE
Sbjct: 241 PTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDE 300

Query: 283 EMGSINNLSKS-RGQKRTNAPDMSPFPLF 310
           E+  I++L+K  R     N  DM  FP+F
Sbjct: 301 ELQEISSLNKDIRFNDPFNWLDMK-FPVF 328

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  184 bits (466), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 177/330 (53%), Gaps = 32/330 (9%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           + TV LN G T+P VGLG W+       + V  A+K GYR  DGA  Y NE++VG  IR 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSGI-PREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLK---- 118
             D GI  RE+LF+ +KLWNT    ++ + AL+++L+ + LEY+DLY +H+P+  K    
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVPF 121

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWD--FVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            +R   G    +   ED K  + TE     + T+  M+EL      +S+G+SN++   ++
Sbjct: 122 EERYPPGFYTGA---EDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQ 178

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG------------GH 224
           + L   G ++ P  LQ+E HP L Q  L ++CK + IQV AYS  G             H
Sbjct: 179 DTLR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKH 236

Query: 225 GAPVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSD 281
             P+ D P+IK+IA  H      V++ W  QRGI  +PKS    R++ NL   +   L+ 
Sbjct: 237 TPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTP 296

Query: 282 EEMGSINNLSKSRGQKRTNAPDMSPFPLFE 311
           +++  I++L+K+     T    +S FP F 
Sbjct: 297 KDLEEISSLNKNLRFNDTWDWTISKFPSFH 326

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  182 bits (461), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 179/328 (54%), Gaps = 38/328 (11%)

Query: 14  LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR---DSG 70
           LN G  +PQVGLG W+         V  A+KAGYR  DGA  Y NE EVGK ++   D G
Sbjct: 7   LNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDDG 66

Query: 71  I-PREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNL 127
           I  R++LF+ +KLWN      + +  L+++L+ LGL+Y+DLY +H+P+  K   + +   
Sbjct: 67  IVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER-- 124

Query: 128 LSSPAKEDGKPD----VDTEWD--FVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
              P    GK D    + TE +   + T+  ++E  +    +S+G+SNF+   + ++L  
Sbjct: 125 -YPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR- 182

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGA------------PVL 229
            G  + P  LQ+E HP L Q  L ++CK H++QV  YS  G                P+ 
Sbjct: 183 -GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 230 DDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLR---TFKLSDEEMGS 286
           D P+IK+IA++HN     V++ W  QRG+  +PKS+  +R++SNL       L++E++ S
Sbjct: 242 DHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 287 INNLSKSRGQKRTNAP---DMSPFPLFE 311
           I+ L+++    R N P   + S FP+F 
Sbjct: 302 ISGLNQNL---RFNDPWDWNNSKFPIFH 326

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  181 bits (460), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 174/330 (52%), Gaps = 32/330 (9%)

Query: 8   NTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR 67
           N  T+KLN G  +P VGLG W+       + V  A+K GYR +DGA  Y NE EVG+ IR
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIR 88

Query: 68  ---DSG-IPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKR 121
              D G + REELF+ +KLWN   R  +  +AL+++L  LGL+Y+DL+ +H+P+  K   
Sbjct: 89  RAIDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVP 148

Query: 122 ITD---GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
           + +     L +  A E            ++T+  +++L    + R++G+SNF    +++L
Sbjct: 149 LEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDL 208

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG------------GHGA 226
           L   G ++ PA LQ+E HP L Q  L  + K   + V  YS LG             + A
Sbjct: 209 LR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAA 266

Query: 227 PVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT---FKLSDEE 283
           P+L   ++ +IA+RH A    V++ W  QR I  +PKS+  ER+ +NLR      L+D+E
Sbjct: 267 PLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDE 326

Query: 284 MGSINNLSKSRGQKRTNAP---DMSPFPLF 310
           +  +++L+      R N P      P P F
Sbjct: 327 LRELSSLNCG---LRFNDPWDWSAQPLPTF 353

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  176 bits (447), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 172/314 (54%), Gaps = 34/314 (10%)

Query: 8   NTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG---- 63
           +T T  LN G  +P VGLG W+         V  A+K GYR  DGA  Y NE+E+G    
Sbjct: 3   DTRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIK 62

Query: 64  KAIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKR 121
           +AI +  + RE+LFI +KLW       + + AL+++L  LGL+YVDLY +H+P+P+K   
Sbjct: 63  QAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVP 122

Query: 122 ITDGNLLSSP-----AKEDGKPDVDTEWD--FVKTWELMQELPKTKKARSVGVSNFSINN 174
           + +      P      +ED + ++ +E     + T+  M++L      +S+G+SNF    
Sbjct: 123 LEE----KYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACL 178

Query: 175 LKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-------GHGA- 226
           +++LL   G ++ P  LQVE+HP L Q  L  + +  +IQV AYS  G       G+ A 
Sbjct: 179 IQDLLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAA 236

Query: 227 ----PVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKL 279
               P+L+  I+  IA +H+     V++ W  QRGI  +PKS+  ER+++NL   +   L
Sbjct: 237 KDVTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTL 296

Query: 280 SDEEMGSINNLSKS 293
           SD EM  I +L+K+
Sbjct: 297 SDSEMSDIFSLNKN 310

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  176 bits (446), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/334 (34%), Positives = 182/334 (54%), Gaps = 39/334 (11%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           ++ V LN G  +P VGLG W+       + +  A+K GYR  DGA  Y NE+EVG+ I+ 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-IPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLK---- 118
             D G + RE+LFI +KLWN      + +  L+++L+ LGL+YVDLY +H+P+  K    
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWD--FVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            +R   G       KED    + TE +   + T+  M++L      +S+G+SN++   + 
Sbjct: 122 DERYPPG---MYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVA 178

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGA---------- 226
           + L   G ++ P  LQ+E HP L Q  L ++CK H++QV AYS  G              
Sbjct: 179 DTLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKN 236

Query: 227 --PVLDDPIIKQIADRHNA-DAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLS 280
             P+ D P IK+IAD++ A     V++ W  QRG+  +PKS+  ER++ NL   +   L+
Sbjct: 237 TPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLA 296

Query: 281 DEEMGSINNLSKSRGQKRTNAP---DMSPFPLFE 311
           +E++  I+ L+++    R N P   + S FP+F+
Sbjct: 297 EEDLREISALNQNL---RFNDPWDWNNSKFPIFQ 327

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 169/329 (51%), Gaps = 32/329 (9%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           +S   LN G  +P VGLG W+       + V  A+K GYR  DGA  Y NE+EVG+ IR 
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 68  ---DSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
              +  + R +LFI +KLWNT     + + A++++L  LGL+Y+DLY +H+P+  K   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 TDGNLLSSPAKEDGKPDVD------TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            +      P    GK D         +  ++ T+  M+ L +    +S+GVSN     L+
Sbjct: 122 EEK---YPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQ 178

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGA---------- 226
           ++L   G K+ P  LQ+E HP L Q  L D+CK   I V AYS  G              
Sbjct: 179 DVLM--GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKED 236

Query: 227 --PVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLR---TFKLSD 281
              + D P+IK+IA ++N     V++ W  Q G+  +PKS+  ER++ NL    T  LS+
Sbjct: 237 TPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSN 296

Query: 282 EEMGSINNLSKSRGQKRTNAPDMSPFPLF 310
           EE+  I+N++++     T   +   FP F
Sbjct: 297 EELVEISNINRNIRFNDTWGWNNMGFPTF 325

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  173 bits (438), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 176/332 (53%), Gaps = 38/332 (11%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           +S V LN G  +P VGLG W+       + V  A+K GYR  DGA  Y NE+EVG+ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-IPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
             D G + RE++F+ +KLWN+     + + AL+++L  +GL+Y+DL+ +H+P+  K    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 TDGNLLSSPAKEDGKPD------VDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            +      P    GK D       +     + T+  +++  +    +S+G+SNFS + ++
Sbjct: 122 EEK---YPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQ 178

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPI--- 233
           +LL     K+ P  LQVE HP L Q  L ++CK++ IQV AYS  G      L+ P+   
Sbjct: 179 DLLRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKN 236

Query: 234 ---------IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSD 281
                    IKQIA+ HN     V++ W  QRGI  +PKS+  ER+  NL       L+ 
Sbjct: 237 TPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTH 296

Query: 282 EEMGSINNLSKSRGQKRTNAP-DM--SPFPLF 310
           +E+ +I+ L+K+    R N P D     FP+F
Sbjct: 297 KELEAISKLNKNL---RLNDPWDWLDGKFPIF 325

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  172 bits (435), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/333 (34%), Positives = 178/333 (53%), Gaps = 40/333 (12%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
           +  + LN G  +P VGLG W+         V  A+K GYR  DGA  Y NE+EVG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           AI +  + REELF+ +KLWN+    ++ + AL+++L  + L+Y+DLY +H+P+  K    
Sbjct: 62  AISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPF 121

Query: 123 TDGNLLSSPA-----KEDGKPDVDTE--WDFVKTWELMQELPKTKKARSVGVSNFSINNL 175
            +      PA     KED +  + +E     + T+  M++L      +S+G+SNF+   +
Sbjct: 122 EE----KYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALI 177

Query: 176 KELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHG---------- 225
           ++LL S   K+ P  LQ+E HP L Q  L ++CK ++IQV AYS  G             
Sbjct: 178 QDLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKAL 235

Query: 226 -APVL-DDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLS 280
            A VL +  +IK IA  H+ +   V++ W  QRGI  +PKS+  ER++ NL       LS
Sbjct: 236 DAKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLS 295

Query: 281 DEEMGSINNLSKSRGQKRTNAP---DMSPFPLF 310
           ++E+ +I++L+      R N P   +   FP+F
Sbjct: 296 EQELSTISDLNIGL---RFNDPWDWNNMKFPIF 325

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  171 bits (433), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 178/333 (53%), Gaps = 37/333 (11%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
            S V LN G  +P VGLG W+       + +  A+  GYR  DGA  Y NE+EVG    +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIRDSGIPREELFITTKLWNT--QQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           AI+D  + REELF+ +KLWN+    +N + AL+++L  +GL+Y+DL+ +H+P+ LK    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 TDG---NLLSSPAKEDGKPDVDTE--WDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177
            +     L +  A  D K  V +E     + T+  ++E  +    +S+GVSNFS + + +
Sbjct: 122 EEKYPPGLYTGEA--DAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLD 179

Query: 178 LLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHG------------ 225
           LL   G ++ PA LQ+E+HP L Q     + +   IQV AYS  G               
Sbjct: 180 LLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKAT 237

Query: 226 APVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSDE 282
            P+ +  ++K+IA +HN     V++ W  Q+ +  +PKS+  ER+  NL   +   L+ +
Sbjct: 238 PPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGD 297

Query: 283 EMGSINNLSKSRGQKRTNAP----DMSPFPLFE 311
           E+  I+ L+K+    R N P    + +PFP+F+
Sbjct: 298 EIKEISGLNKNL---RFNDPFTWSEKTPFPIFD 327

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  170 bits (430), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 114/336 (33%), Positives = 175/336 (52%), Gaps = 38/336 (11%)

Query: 5   LSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG- 63
           ++  + TVKLN G  +P VGLG W+         V  A+K GYR  DGA  Y NE+EVG 
Sbjct: 1   MTYTSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 64  ---KAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
              KAI +  + RE+LF+ +KLWN+    +N ++AL+++LE + LEY+DL+ +H+P+  K
Sbjct: 61  GIHKAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFK 120

Query: 119 ----TKRITDGNLLSSPAKEDGKPDVDT--EWDFVKTWELMQELPKTKKARSVGVSNFSI 172
                ++   G    +   ED K  V +  +   + T+  ++E  K    +S+G+SNF  
Sbjct: 121 YVPFEEKYPPGFYTGA---EDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRG 177

Query: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP 232
             + +LLA  G  + P  LQ+E HP L Q  L ++C +  IQV AYS  G      LD  
Sbjct: 178 ILIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSE 235

Query: 233 I------------IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT---F 277
           +            I++IA  H   +  V++ W  QR I  +PKS+  ER++ NL+     
Sbjct: 236 LAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKL 295

Query: 278 KLSDEEMGSINNLSKSRGQKRTNAPDM---SPFPLF 310
            L++ E+  I+ L+K     R N P       FP+F
Sbjct: 296 TLTEAELQEISALNKDI---RFNDPFTWLGMKFPVF 328

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  169 bits (427), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/336 (33%), Positives = 177/336 (52%), Gaps = 38/336 (11%)

Query: 5   LSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG- 63
           +S  + TV LN G  +P +GLG W+         V  A+K GYR  DGA  Y NE+EVG 
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 64  ---KAIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
              KAI +  + RE+LF+ +KLWN+     N + AL+++L+ +GL+Y+DL+ +H+P+  K
Sbjct: 61  GIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFK 120

Query: 119 ----TKRITDGNLLSSPAKEDGKPDVDTEWD--FVKTWELMQELPKTKKARSVGVSNFSI 172
                ++   G    +   ED K  V ++ D   + T+  +++       +S+G+SNF+ 
Sbjct: 121 FVPFEEKYPPGFYTGA---EDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNG 177

Query: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP 232
           + +++LL   G ++ P  LQ+E HP L Q  L  +CK   IQV AYS  G      LD  
Sbjct: 178 SLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSE 235

Query: 233 I------------IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLR---TF 277
           +            +K IA+ H      V++ W  QRG+  +PKS+  ER++ NL    + 
Sbjct: 236 LAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSL 295

Query: 278 KLSDEEMGSINNLSKSRGQKRTNAPDM---SPFPLF 310
            LSD+E+ +I+ L+K     R N P     S FP F
Sbjct: 296 TLSDKELKAISALNKDI---RFNDPWTWLNSEFPTF 328

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  168 bits (425), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 173/340 (50%), Gaps = 53/340 (15%)

Query: 10  STVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----KA 65
           S V LN G  +P VGLG W+       + V  A+K GYR  DGA  Y NE EVG    KA
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 66  IRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRIT 123
           I +  + R +LF+ +KLWN+     + + AL+++L+ LGL+Y+DLY +H+P+  K     
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKF---- 118

Query: 124 DGNLLSSPAKEDGKPDVDTEWD-------------FVKTWELMQELPKTKKARSVGVSNF 170
                  P +E   P   T  D              + T+  ++E       +S+G+SNF
Sbjct: 119 ------VPFEEKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNF 172

Query: 171 SINNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-------- 222
           +   +++LL   G ++ P  LQ+E HP L Q  L ++CK   IQV AYS  G        
Sbjct: 173 NGVLVQDLLN--GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELD 230

Query: 223 ---GHGAP-VLDDPIIKQIADRHNADA-GNVVVSWGVQRGIVTLPKSTTPERVVSNLR-- 275
                  P +L+ PIIK+IA  H +     V++ W  QRGI  +PKST  ER++ NL   
Sbjct: 231 SQLAKSTPSLLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVE 290

Query: 276 -TFKLSDEEMGSINNLSKSRGQKRTNAP---DMSPFPLFE 311
            +  L++EE+  I++L+K+    R N P     S FP F 
Sbjct: 291 DSITLTEEELNEISSLNKN---IRFNDPWEWLNSKFPTFH 327

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  166 bits (421), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 155/290 (53%), Gaps = 37/290 (12%)

Query: 11  TVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI---- 66
           T KL++ Y IP V LGT+     +  + V  AL  GYRH D A +Y NEEEV + I    
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 67  -RDSGIPREELFITTKLWNTQ--QRNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRI 122
            R     R+E+F TTKLWN+Q   +N + A+ + ++++  L+Y+DL LMH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 TDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182
                        G P +  E     TW  MQE       +S+GVSNF I +LKEL    
Sbjct: 121 -------------GGPQIREE-----TWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWD 162

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
           G K  P V Q+EI P L +  L DFCK   + VEAY+PL  HG  +    +IK   + +N
Sbjct: 163 GLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL-THGYKINHPDLIKISNELNN 221

Query: 243 A-DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
             + G +++ W +Q G V LPK+ T  R+ SNL    F+L++++M  +++
Sbjct: 222 TKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  167 bits (423), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 106/330 (32%), Positives = 177/330 (53%), Gaps = 33/330 (10%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
           +S V LN G  +P VGLG W+         +  A+K GYR  DGA  Y NE+EVG    K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           AI +  + R+++F+T+KLWN      + + AL+++L+ +GL+Y+DLY +H+P+  K    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGN--LLSSPAKEDGKPDV-DTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            +       + A++D +  + +     + T+  ++        +S+G+SNF  + +++LL
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHGAPV 228
              G ++ P  LQ+E HP L Q  L D+CK H+IQV AYS  G               P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 229 L-DDPIIKQIADRH-NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSDEE 283
           L ++ ++K++++ H  +    V++ W  QRGI  +PKS+  ER++ NL   +   L+D+E
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 284 MGSINNLSKSRGQKRTNAPDM---SPFPLF 310
           +  I++L+      R N P       FP+F
Sbjct: 300 LKEISSLN---ANIRFNDPWTWLDGKFPIF 326

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  167 bits (422), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 168/309 (54%), Gaps = 29/309 (9%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
           +S V LN G  +P VGLG W+  +      +  A+K GYR  DGA  Y NE+EVG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKT--- 119
           AI +  + R+++F+ +KLWN      + + AL+++L  +GL+Y+DLY +H+P+  K    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 120 -KRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
            ++   G    +  +E G    +     + T+  +++       +S+G+SNF  + +++L
Sbjct: 122 EEKYPPGFYTGTEDEEKGHI-TEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDL 180

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLD-------- 230
           L   G ++ P  LQ+E HP L Q  L +FCK H+IQV AYS  G      +D        
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQ 238

Query: 231 ----DPIIKQIADRHN-ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSDE 282
               + +IK++++ H  +    V++ W  QRGI  +PKS+  ER++ NL   + F L+++
Sbjct: 239 TLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQ 298

Query: 283 EMGSINNLS 291
           E+  I+ L+
Sbjct: 299 ELKKISALN 307

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  166 bits (420), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 164/308 (53%), Gaps = 27/308 (8%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
           +S V LN G  +P VGLG W+  +      +  A+K GYR  DGA  Y NE+EVG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           AI +  + R+++F+ +KLWN      + + AL+++L  +GL+Y+DLY +H+P+  K    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDG---NLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            +       +    E      +     + T+  ++E       +S+GVSNF  + +++LL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHGAPV 228
              G ++ P  LQ+E HP L Q  L +FCK H+IQV AYS  G               P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 229 L-DDPIIKQIADRH-NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSDEE 283
           L ++ +IK+++  H  +    V++ W  QRGI  +PKS+  ER++ NL   + F L+++E
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 284 MGSINNLS 291
           +  I+ L+
Sbjct: 300 LKDISALN 307

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  164 bits (416), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 152/283 (53%), Gaps = 38/283 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRDSGIP 72
           KL+ GY+IP VGLGT+          V  ALKAGYRH D A +Y NEEEVG+ I    + 
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 73  ------REELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
                 RE +F TTKLWN+Q       +A++  L+++  LEY+DL L+H P+     R+ 
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLRL- 128

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                   +TW+ MQE       +S+GVSN+ ++++ ELL    
Sbjct: 129 ------------------------ETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQY 164

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P L +  L D+CK ++I VE YSPL  HG   L+D  +K++A+    
Sbjct: 165 LKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL-THGYK-LNDQDLKKVANETGK 222

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEM 284
           + G V++ W +Q G + LPK+ T  R+ +NL    F L+ ++M
Sbjct: 223 NVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFNLTSDQM 265

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 161/314 (51%), Gaps = 34/314 (10%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----K 64
           T+ + LN G  +P VGLG W+         V  A+K GYR  DGAA Y NE+EVG    K
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIRDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
           A+ +  + R +LFI +KLWNT     + + AL+++L  LGL+Y+DLY +H+P+  K    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 TDGNLLSSPAKEDGKPDVDT------EWDFVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            +      P    G  D            ++ T+  M++L      +S+GVSN   + L+
Sbjct: 122 EEK---YPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQ 178

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHG 225
           ++L   G ++ PA LQ+E HP L Q  L  FCK  NI V +YS  G              
Sbjct: 179 DVLM--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAED 236

Query: 226 APVL-DDPIIKQIADRHNADA--GNVVVSWGVQRGIVTLPKSTTPERVVSNLRT---FKL 279
            P L D P+IK+IA  H  D     V++ W  QR I  +PKS+  ER++ NL       L
Sbjct: 237 TPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTL 296

Query: 280 SDEEMGSINNLSKS 293
           ++ E+  I+ L+K+
Sbjct: 297 TEAELLEISALNKN 310

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  165 bits (417), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 171/333 (51%), Gaps = 35/333 (10%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           +  V LN G  +P VGLG W+         V  A+K GYR  DGA  Y NE+EVG+ IR 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSGI-PREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLK---T 119
             D GI  REELF+ +KLWN+    +N + AL+++L+ + L+Y+DL+ +H+P+ LK    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 120 KRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
           K      L +    E      +     + T+  +++L      +S+G+SNFS + + +LL
Sbjct: 122 KEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHG------------AP 227
              G ++ P  LQ+E HP L Q  L  + K   +QV AYS  G                P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 228 VLDDPIIKQIADRHNADA--GNVVVSWGVQRGIVTLPKSTTPERVVSNLRT---FKLSDE 282
           + ++P I +IA  H  +     V++ W  Q  +  +PKS+  ER+  NL       L+D+
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 283 EMGSINNLSKSRGQKRTNAP----DMSPFPLFE 311
           E+  I+ L+K+    R N P    D +PFP+F+
Sbjct: 300 ELKEISALNKNI---RFNDPYTWNDKNPFPIFD 329

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  163 bits (412), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 155/283 (54%), Gaps = 38/283 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI------ 66
           KL++GYT+P +GLGT+        + V  ALK GYRH+D A +Y NE EVG+ I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 67  RDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
             S   RE++F  TKLWN+Q    N + A+++  E++ GL Y+DL L+H P+    KR+ 
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRL- 129

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                   +T++ MQE       RS+GVSN+ ++++ ELL    
Sbjct: 130 ------------------------ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNE 165

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P L +  L D+CK   + VEAY+PL  HG  + + P + ++A     
Sbjct: 166 LKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYKI-NHPNVLRVAKEAGC 223

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTF--KLSDEEM 284
           ++G V++ W +Q G V LPK+ + +R+ SNL  +  +L+ E+M
Sbjct: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQM 266

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  164 bits (414), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 164/308 (53%), Gaps = 27/308 (8%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIR- 67
           +S V LN G  +P VGLG W+  +      +  A+K GYR  DGA  Y NE+EVG+ IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 68  ---DSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122
              +  + R+++F+ +KLWN      + + AL+++L  +GL+Y+DLY +H+P+  K    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDG---NLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
            +       +    E      +     + T+  ++E       +S+G+SNF  + +++LL
Sbjct: 122 EEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLL 181

Query: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHGAPV 228
              G ++ P  LQ+E HP L Q  L +FC+ HNIQV AYS  G               P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 229 L-DDPIIKQIADRH-NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL---RTFKLSDEE 283
           L ++ +IK+I+  H  +    V++ W  QRGI  +PKS+  ER++ NL   + F L+++E
Sbjct: 240 LFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 284 MGSINNLS 291
           +  I+ L+
Sbjct: 300 LKEISALN 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  161 bits (407), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 146/278 (52%), Gaps = 36/278 (12%)

Query: 11  TVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD-- 68
           + KL++GYTIP VGLGT+          V  AL+ GYRH D A +Y NE EVG+ I+   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKR 121
               +   R ++F TTKLW++Q      ++A++  L+ +  L Y+DL L+H P+  K  R
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKKLR 127

Query: 122 ITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
           +                         +T+E MQE     K RS+GVSN+   +++ELL  
Sbjct: 128 L-------------------------ETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNW 162

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241
              K  P V Q+EI P   +  L DFCK+  I VEAY+PL  HG   L DP + ++A+  
Sbjct: 163 EKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL-THGTK-LKDPDLVKVANEV 220

Query: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKL 279
             D G  ++ W +Q+G + LPK+ +  R+ SNL  F  
Sbjct: 221 GCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  162 bits (409), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 159/310 (51%), Gaps = 32/310 (10%)

Query: 11  TVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----KAI 66
           TV LN G  +P VGLG W+         +  A+K GYR  DGA  Y NE+EVG    +AI
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 67  RDSGIPREELFITTKLWNTQQR--NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD 124
           ++  + RE+L + +KLWN+     N   ALE++L  L L+YVD++ +H+P+  K     +
Sbjct: 67  KEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDE 126

Query: 125 GNLLSSPAKEDGKPD------VDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
                 P    GK D       + +   + TW  +++L    K +S+G+SNFS   +++L
Sbjct: 127 K---YPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDL 183

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-----------GHGAP 227
           L   G ++ P  LQ+E HP L Q  L  + K   IQV AYS  G               P
Sbjct: 184 LR--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTP 241

Query: 228 VL-DDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLR---TFKLSDEE 283
            L +   IK IA +H      V++ W  Q GI  +PKS+  ER++ NLR      L+D+E
Sbjct: 242 TLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDE 301

Query: 284 MGSINNLSKS 293
           +  I+ L+++
Sbjct: 302 LKQISGLNQN 311

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  160 bits (405), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 153/289 (52%), Gaps = 37/289 (12%)

Query: 11  TVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI---- 66
           + KL +G+ IP +GLGT+     +    V AAL+ GYRH+D A +Y NE EV +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -RDSGIPREELFITTKLWNTQ--QRNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKRI 122
            R   + RE++F TTKLWN+Q      + A+ + +E +G L Y+DL LMH   P+  K++
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMH--SPIGGKQV 123

Query: 123 TDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182
             G                       TW+ MQE       RS+GVS++   +L++L    
Sbjct: 124 RRG-----------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWS 160

Query: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242
             K  PAV Q+EI P + +  L D+CK   I VEAYSPL  HG   LDDP + ++A+   
Sbjct: 161 ELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL-THGYK-LDDPDLLKVAEETG 218

Query: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTF--KLSDEEMGSINN 289
            + G V++ W +Q G V LPK+ T  R+  NL  F  +LS E M  +++
Sbjct: 219 KNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 156/288 (54%), Gaps = 38/288 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD---- 68
           KL++GY +P +GLGT+     +  + V  ALK+GYRH+D A +Y NE EVG+ I+     
Sbjct: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77

Query: 69  --SGIPREELFITTKLWNTQQ--RNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKRIT 123
                 R+++F TTKLWN+Q    N + A+++ +E++  L Y+DL L+H P+    +R+ 
Sbjct: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRL- 136

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                   +T++ MQE       RS+GVSN+  +++ ELL    
Sbjct: 137 ------------------------ETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKE 172

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P + +  L D+CK   + VEA+SPL  HG   L  P +  +A     
Sbjct: 173 LKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGYK-LKHPDVLLVAKETGT 230

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
           DAG V++ W +Q G V LPKS + ER+  N++   F+LS E++  ++ 
Sbjct: 231 DAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  155 bits (392), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 147/288 (51%), Gaps = 38/288 (13%)

Query: 11  TVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD-- 68
           T  L  G  +P +GLG +   +    + V  ALK GYRH D A  Y NE EVG+ I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGIPREELFITTKLWNTQQ--RNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKR 121
               S   R+++F  TKLWN+Q      + A++Q L+++  L Y+DL L+H P     KR
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 ITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
           +                          T+E MQE       +S+GVSN+  ++L+EL A 
Sbjct: 125 LA-------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQELYAM 159

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241
           P  K  P V Q+E+ P LP+  L D+CK   + ++AYSPLG      ++DP I  +A + 
Sbjct: 160 PNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLG--CGDRVNDPYIASLATQK 217

Query: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTF--KLSDEEMGSI 287
           N     ++++W + +G   LPK+   +R+ SNL ++   L+ EE+ +I
Sbjct: 218 NCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEELTNI 265

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 153/283 (54%), Gaps = 38/283 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD---- 68
           KL++GY +P +GLGT+     +  + V  ALKAGYRH+D A +Y NE EVG+ +      
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 69  --SGIPREELFITTKLWNTQQ--RNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKRIT 123
                 R ++F TTKLWN+Q    N + A+++ L+++  L Y+D+ L+H P+    +R+ 
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRL- 129

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                   +T++ MQE       RS+GVSN+  +++ ELLA   
Sbjct: 130 ------------------------ETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEE 165

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P + +  L D+CK   + VEA+SPL  HG  +   P + ++A+    
Sbjct: 166 LKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL-THGYKI-KHPNVVRVAEEVGR 223

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEM 284
           + G V++ W +Q G V LPKS + ER+  NL    F+LS E++
Sbjct: 224 NTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQI 266

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 151/288 (52%), Gaps = 39/288 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI-----R 67
           +L+ G  IP VGLG ++  E      V  AL+ GYR  D A  Y NE+ V + I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGIPREELFITTKLWNTQQRN---PQEALEQSLERLG-LEYVDLYLMHWPVPLKTKRIT 123
             G  RE+++ TTK+ NTQ       +++LE+SL   G L Y+DL L+H P+  +T+R+ 
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                    TW+ ++E     + RS+GVSN+   +L ELL   G
Sbjct: 133 -------------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEG 167

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K+ P V QVEI+P L +  L  +C+E+NI V+A+SPL       LDDPI++++A +++ 
Sbjct: 168 LKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDK 225

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
               ++V W +Q G + LPK+   ER+  N     F+LS E M  + +
Sbjct: 226 GVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  154 bits (388), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 153/288 (53%), Gaps = 38/288 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD---- 68
           K + GY +P + LGT+        + V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
                 RE++F TTKLWN+Q   +  + A++Q L  + GL+Y+DL L+H P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
           +G+ L                  ++TW+ MQE       +S+GVSN+   ++ ELL    
Sbjct: 119 EGSKLR-----------------LETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQ 161

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P + +  L D+CK  N+ VEA++PL  HG   + DP + ++    + 
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL-CHGYK-MTDPDLLKVCKEVDR 219

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNL--RTFKLSDEEMGSINN 289
           + G V++ W +Q G + LPK+ T +R+ SNL    F+LSD++M  +++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  153 bits (387), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 153/288 (53%), Gaps = 38/288 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI-----R 67
           KL+ G+ IP + LGT+        + V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSG-IPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
           D G   REE+F TTKLWN+Q   +  + A+ Q L  + GL+Y+DL L+H P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
           +G+ L                  ++TW  MQE       +S+GVSN+   ++ ELL  P 
Sbjct: 119 EGSKLR-----------------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPE 161

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P + +  L D+CK   + VEA++PL  HG   + +P + ++    + 
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL-CHGYK-MTNPDLLKVCKEVDR 219

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNL--RTFKLSDEEMGSINN 289
           + G V++ W +Q G + LPK+ T +R+  NL    F+LSDE+M  +++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 148/274 (54%), Gaps = 36/274 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD---- 68
           +L  G  IP + LGT+        K VT ALK GYRH D A +Y NE EVG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
             +   RE++F TTKLWN+Q      + A+++ ++++ GL Y+D+ L+H P+  + +R+ 
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRL- 130

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
                                   +TW+ MQE       +S+GVSN+  ++++ELL    
Sbjct: 131 ------------------------ETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDE 166

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            K  P V Q+EI P + +  L D+CK  N+ VEAY+P+  HG   ++DP +++I+     
Sbjct: 167 LKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPM-AHGYK-MNDPGLREISKETGM 224

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTF 277
           + G +++ W +Q G + LPK+ T  R+ SNL  +
Sbjct: 225 NPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  148 bits (373), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 150/288 (52%), Gaps = 38/288 (13%)

Query: 13  KLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD---- 68
           KL+ G  IP + LGT+        + V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRIT 123
                 R ++F TTKLWN+Q   R  + A++Q L  + GLEY+DL L+H P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 124 DGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG 183
           +G+ L                  ++TW  MQE       +S+GVSN+   ++ ELL    
Sbjct: 119 EGSKLR-----------------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSE 161

Query: 184 NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNA 243
            +  P V Q+EI P + +  L D+CK   + VEA++PL  HG   + +P +  +    + 
Sbjct: 162 LRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL-CHGYK-MTNPDLLIVCKEVDR 219

Query: 244 DAGNVVVSWGVQRGIVTLPKSTTPERVVSNL--RTFKLSDEEMGSINN 289
           + G V++ W +Q G + LPK+ T +R+  NL   +F+LSDE+M ++++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  147 bits (370), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 150/287 (52%), Gaps = 38/287 (13%)

Query: 14  LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI------R 67
           L+ GY IP + LGT+        + V   +K GYRH D A +Y NE+EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRITD 124
                RE++F TTKLWN+Q   +  + A++Q L  + GL+Y+DL L+H P+        +
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL--------E 119

Query: 125 GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
           G+ L                  ++TW+ MQE       +S+GVSN+   ++ ELL  P  
Sbjct: 120 GSKLR-----------------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDL 162

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
              P V Q+EI P + +  L D+CK   + VEA++PL  HG   + +P + ++    + +
Sbjct: 163 TYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL-CHGYK-MTNPDLLKVCKEVDRN 220

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
            G V++ W +Q G + LPK+ T +R+  NL    F+L D++M  +++
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDFELLDKQMKILDH 267

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  145 bits (366), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 150/287 (52%), Gaps = 38/287 (13%)

Query: 14  LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD----- 68
            N G  IP + LGT+   +    K V  ALKAGYRH D A +Y NE +VG+ I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 69  -SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRITD 124
                R ++F TTKLWN+Q      Q A+++ L ++ GL+Y+D+ L+H P+  +TKR+  
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL-- 127

Query: 125 GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
                                  +TW  MQE  ++   +++GVSN+   +++ELL     
Sbjct: 128 -----------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERL 164

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
            + P V Q+EI P + +  L D+CK   + VEA++PL  HG  + D  +++ ++      
Sbjct: 165 TIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLVR-VSKEVGRS 222

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
              V++ W +Q G + LPK+ T +R+  NL    F+L+ E+M  I++
Sbjct: 223 TVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 154/293 (52%), Gaps = 39/293 (13%)

Query: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI-- 66
           ++T  L  G  IP + LG + + + +    V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---RDSGIPREELFITTKLW--NTQQRNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTK 120
                  + R E+F TTK+   N      ++++ +SLE +  +EY+DL L+H P+    +
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
           R+                          TW+ +QE     K R++GVSN+SI +L+EL  
Sbjct: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160

Query: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240
             G K+ P V Q E++P L +  LC++C++  + +EA+SPL         DP ++++   
Sbjct: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLT--RGQKFSDPQLQELIKT 218

Query: 241 H--NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
              N     +++ W +Q G + LPKS+  +R +SNL+   F++SD++M ++ +
Sbjct: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  141 bits (356), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 146/286 (51%), Gaps = 39/286 (13%)

Query: 1   MSATLSNNTST-VKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
           M+ T+  N  T  KLN G  IP +G G +   + D    V +ALK GYRHID A +Y N+
Sbjct: 1   MAHTIDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQ 60

Query: 60  EEVGKAIR----DSGIPREELFITTKLWNTQ------QRNPQEALEQSLERLGLEYVDLY 109
           +E  + +R    ++G  RE ++ TTKLW++Q      ++  QE      E +G  YVDL 
Sbjct: 61  KEAAQGVRKYLDETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIG--YVDLL 118

Query: 110 LMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSN 169
           L+H P     +R+    +L    +E G                     K  + +S+GVSN
Sbjct: 119 LLHSPRGGAKRRLETWAILEQAVQEPG--------------------SKALEIKSIGVSN 158

Query: 170 FSINNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLG-GHGAPV 228
           F +++L+ELL     K+ P + Q+E+HP LP+  L  + KE +I  EAYSPL  G+    
Sbjct: 159 FGVDHLEELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLTQGYR--- 213

Query: 229 LDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL 274
           L DP +  +  +   +   +++ W   +G V L KS+ PER+  NL
Sbjct: 214 LQDPELLALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNL 259

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  142 bits (357), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 161/302 (53%), Gaps = 50/302 (16%)

Query: 14  LNTGYTIPQV---GLGT--WRSKEGDG------YKAVTAALKA--GYRHIDGAAIYLNEE 60
           L+ G  IP V   G GT  ++S+E D          V   L    G  HID A IY    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
           E+G A++D+  PR+E+FIT K    +Q   NP+ ALE SL++LG++YVDLYL+H      
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLH------ 122

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
                      SP  ++ K DV+  W +      ++EL K+ KA+++GVSNF++ +L++L
Sbjct: 123 -----------SPIIKESKLDVEANWKY------LEELYKSGKAKNIGVSNFAVKDLEKL 165

Query: 179 LASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGG-HGAPVLDDPI-- 233
           LA    K  P V Q+E  P L      + +F +++ I +EAYSPLG     P   D +  
Sbjct: 166 LAVAEVK--PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPF 223

Query: 234 ---IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMGSIN 288
              I +++ ++N     +++SW  +RGI+ +  S+  ER+    ++ +F L++EE+  I 
Sbjct: 224 YQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKIT 283

Query: 289 NL 290
            L
Sbjct: 284 QL 285

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  141 bits (355), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 150/287 (52%), Gaps = 38/287 (13%)

Query: 14  LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD----- 68
           L+ G  IP + LGT+   +      V  ALK GYRH D A +Y NE +VG+ I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGIPREELFITTKLWNTQQ--RNPQEALEQSLERL-GLEYVDLYLMHWPVPLKTKRITD 124
                RE++F TTKLWN+Q   +  ++A+++ L+++  L Y+DL L+H P+    KR+  
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRL-- 126

Query: 125 GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
                                  +T++ MQE       +S+GVSN+  ++L+ELL+  G 
Sbjct: 127 -----------------------ETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGL 163

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
           K  P V Q+EI P   +  L  +C+   I VE Y+PL  HG   L DP + ++A+    +
Sbjct: 164 KYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL-THGYK-LKDPQLVKVAEEVGKN 221

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
            G V++ W +Q G + LPK++  +R+  NL    FKL++ ++ +  +
Sbjct: 222 TGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEH 268

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  140 bits (354), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 157/301 (52%), Gaps = 46/301 (15%)

Query: 5   LSNNTSTVK-LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE-- 61
           +S   ST K L  G  IP +G GT+ + +      V AA K GYRH+D A +Y NE E  
Sbjct: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60

Query: 62  --VGKAIRDS-GIPREELFITTKL------WNTQQRNPQEALEQSLERLGLEYVDLYLMH 112
             V K +++S  + R+++F TTK+      +   +++  E+LE + E   LEYVDL+L+H
Sbjct: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFLIH 117

Query: 113 WPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSI 172
            P     KR+                          T++ +QE  K  K +++GVS++SI
Sbjct: 118 NPCAETEKRLG-------------------------TYKALQEFYKAGKIKAIGVSSYSI 152

Query: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP 232
            +L+EL +  G ++ P V Q E++P L +  L  +CKE ++ +EA+SP+    +    DP
Sbjct: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPIT--RSKRFSDP 210

Query: 233 IIKQIADRH--NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSIN 288
           +++++            +++ W +Q G V LPKS   +R  SNL    F++S E+M ++ 
Sbjct: 211 VVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270

Query: 289 N 289
           +
Sbjct: 271 H 271

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  140 bits (354), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 140/278 (50%), Gaps = 36/278 (12%)

Query: 7   NNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE----V 62
           N  +  KLN G  +P +G G +     +  + V  AL+ GYRHID A +Y N+++    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLE------YVDLYLMHWPVP 116
            + + ++G PREE++ TTKLWNTQQ   ++A  ++LE +  +      YVDL L+H P+ 
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQ--GRDATPRALEEIAADVKEFIGYVDLLLLHSPLT 125

Query: 117 LKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLK 176
              +R+    +L    +E     ++                     R++GVSNF + +L+
Sbjct: 126 DAQRRLETWAVLERAVQEPASSALEI--------------------RAIGVSNFGVRHLQ 165

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQ 236
           ELL     K  P V Q+E+HP LP+  L  F +E+ I  EAYSPL       L DP +  
Sbjct: 166 ELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPLT--QGVRLQDPELLA 221

Query: 237 IADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNL 274
           +  +     G +++ W   +G   L KS  P+R+  NL
Sbjct: 222 LEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNL 259

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  140 bits (353), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 152/305 (49%), Gaps = 51/305 (16%)

Query: 12  VKLNTGYTIPQV---GLGT-W-RSKEGDGYKAVTAALKAGYR-------HIDGAAIYLNE 59
            KLN G+ +P V   G GT W +  E D   + T   +  Y        H+D A  Y+  
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  EEVGKAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPL 117
            EVG+A+ ++  PR+E+FIT K W   +   NP   LE  L+RLGLEYVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPFIS 126

Query: 118 KTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177
           K    T+G  L                   + W +M+EL  + KA+++GVSNF+  +L+ 
Sbjct: 127 KE---TNGFSLE------------------EAWGMMEELYHSGKAKNIGVSNFAKEDLER 165

Query: 178 LLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLG--------GHGAP 227
           +L     K+ P V Q+E +  L      + +FCK+++IQ+ AYSPLG        G+  P
Sbjct: 166 VLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQP 223

Query: 228 VLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMG 285
                 I ++A  +N   G V++ W  +RG+V +  S   ER+     +  F L D+E+ 
Sbjct: 224 FYS--YINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVT 281

Query: 286 SINNL 290
            I  L
Sbjct: 282 EITKL 286

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  139 bits (349), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 162/316 (51%), Gaps = 50/316 (15%)

Query: 5   LSNNTSTVKLN-TGYTIPQVGLGT---WRSKEGDGYKA----------VTAALKAGYRHI 50
           +++   T++L  +G  IP +G G+   WR  +  G K           VT+A+ AG+ HI
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 51  DGAAIYLNEEEVGKAIRDSGIPREELFITTKL--WNTQQRN---PQEALEQSLERLGLEY 105
           D A  Y    EVG+ +++SG+PR++L+IT K   W+   R    P E+L  SLE++ + Y
Sbjct: 61  DAAEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSY 120

Query: 106 VDLYLMHWP-VPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARS 164
           VDLYL+H P + ++T  I                      D  + W  M+E+     A++
Sbjct: 121 VDLYLLHVPFITVQTAGI----------------------DLKEAWRQMEEIYDRGLAKN 158

Query: 165 VGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG 222
           +GVSNF + +L E +   G K +P V Q+E +  L Q +  +  +CK+H+I VE YSPL 
Sbjct: 159 IGVSNFDVESL-EYITKIG-KYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLV 216

Query: 223 --GHGAPVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVS--NLRTFK 278
               G P   D ++  +A++++     +++ W  Q G+V +  S    RV    N+  F+
Sbjct: 217 PLTKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFE 276

Query: 279 LSDEEMGSINNLSKSR 294
           L+ E+  SI  + + +
Sbjct: 277 LTAEDFDSITKIGREK 292

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  136 bits (342), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 165/316 (52%), Gaps = 47/316 (14%)

Query: 5   LSNNTSTVKLNTGYTIPQV---GLGT--WRSKEGDGY-----KAVTAALKA-GYRHIDGA 53
           +S  TS + LN G  IP +   G GT  ++    D Y     K +  AL+  G  HID A
Sbjct: 1   MSYQTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCA 60

Query: 54  AIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLM 111
            +Y    EVG+A+R+S  PR+E+FIT K    ++   NP+E L+ +LE++GLEYVDLYL+
Sbjct: 61  EMYQTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLL 120

Query: 112 HWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFV--KTWELMQELPKTKKARSVGVSN 169
           H+P       I D  L                +DF   + W++M++L     A+++GVSN
Sbjct: 121 HFP-------IIDPKL----------------YDFTLEEAWKMMEDLYNEGLAKNIGVSN 157

Query: 170 FSINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAP 227
           F + +L++L  S    + P + Q+E +  L      + D+C ++NIQ+EA+ PL      
Sbjct: 158 FRVEDLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREV 215

Query: 228 VLDDPI---IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDE 282
              D +   +KQ+A +++     +++ W  QR ++ +  S+ PERV    ++ +F+L+ +
Sbjct: 216 NEKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQD 275

Query: 283 EMGSINNLSKSRGQKR 298
           E+  I  L       R
Sbjct: 276 EVEFITKLGSQHDTIR 291

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  136 bits (342), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 157/304 (51%), Gaps = 56/304 (18%)

Query: 14  LNTGYTIPQV---GLGT--WRSKEGDGY--KAVTAALKA-----GYRHIDGAAIYLNEEE 61
           LN G  IP +   G GT  ++++E D    + +   LK      G  HID A IY    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
           V  A+R+S  PR+E+FIT K ++TQ +   +P   L  SL+ LGL+YVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
              I +G+ L                   + W+ M++L K+ KA+++GVSNF + +L+++
Sbjct: 126 ---IKNGSTLE------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDLEKI 164

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG--------GHGAPV 228
           L     K  P + Q+E +  L   +  +  FCKE+NIQ+EAY+PLG            P 
Sbjct: 165 LKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPF 222

Query: 229 LDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMGS 286
            D   I +++ ++N     +++ W  +RGI+ +  S+ P+R+    NL +F L   E+  
Sbjct: 223 YD--YIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDK 280

Query: 287 INNL 290
           I  L
Sbjct: 281 ITEL 284

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  135 bits (339), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 154/306 (50%), Gaps = 56/306 (18%)

Query: 14  LNTGYTIPQV---GLGT-WRSKEGDGY-------KAVTAALKA-GYRHIDGAAIYLNEEE 61
           LN G  IP +   G GT W  + G  +       + +  AL   G  HID A  Y    E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 62  VGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
           + KA+++S  PR E+FIT K ++TQ +   +P E L   L+ LGL+YVDLYL+H P    
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPF--- 125

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
                              P+        K W+ M+ L K  KA+S+GVSNFS+ N++E+
Sbjct: 126 -----------------FDPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEI 168

Query: 179 LASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAPVLDDP---- 232
           L   G K  P V Q+E +  L      + ++C+++NIQ+EAYSPLG    P+   P    
Sbjct: 169 LKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPENSN 222

Query: 233 ------IIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVV--SNLRTFKLSDEEM 284
                  I ++A ++      ++++W   RGI+ +  S+  +R++   N+ +F L+ +E+
Sbjct: 223 ELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEV 282

Query: 285 GSINNL 290
            ++  L
Sbjct: 283 DTLTKL 288

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 157/292 (53%), Gaps = 39/292 (13%)

Query: 10  STVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE----VGKA 65
           +T  L  G  +P +GLG +++ + +    V  ALK GYR +D A +Y NE E    + K 
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 66  IRDS-GIPREELFITTKLWNTQQ--RNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKR 121
           + +S  + R ++F TTK+    Q   + ++++E+SL R+  L+Y+DL+L+H P+  K KR
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 122 ITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181
           +                          TW+  QE  +T K +++GVSN+ I +L+E+   
Sbjct: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP-IIKQIADR 240
            G K+ P V Q E++P L +  L ++C +  + ++AYSPL    A  L DP ++K + D 
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLT--RARRLQDPELVKLVEDS 219

Query: 241 H-NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
           +    +  ++V+W +Q G V L K+   +R+  N+++  F+LS  ++  + +
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 161/310 (51%), Gaps = 53/310 (17%)

Query: 8   NTSTVKLNTGYTIPQV---GLGT--WRSKEGDG------YKAVTAALKA-GYRHIDGAAI 55
           N   + LN G  IP +   G GT  ++ +E D        + +  ALK  G  HID A I
Sbjct: 4   NQQFITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEI 63

Query: 56  YLNEEEVGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLYLMH 112
           Y    EVGKA+  +  PR E+F+T K ++TQ +   +P   L+ +L+++G +YVDLYL+H
Sbjct: 64  YRTYPEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLH 122

Query: 113 WPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSI 172
            P   K    T+G  L                   + W+ M++L ++ KA+++GVSNF++
Sbjct: 123 SPFVSKE---TNGFTLE------------------EAWKDMEQLYRSGKAKNIGVSNFAM 161

Query: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLG-------- 222
            +L+ +L     ++ P V Q+E  P L      +  FC+E++I +EAYSPLG        
Sbjct: 162 KDLERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTK 219

Query: 223 GHGAPVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLS 280
               P  +   +K++++++      + + W  +RG++ +  S+ P+R+    NL +F L+
Sbjct: 220 DESLPFFE--YVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLT 277

Query: 281 DEEMGSINNL 290
           DEE+  I  L
Sbjct: 278 DEEVNQITEL 287

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 161/311 (51%), Gaps = 49/311 (15%)

Query: 5   LSNNTSTVKLNTGYTIPQV---GLGT--WRSKEGDG------YKAVTAALKA-GYRHIDG 52
           +S +   + LN G  IP +   G GT  +++ E D        + +  AL+  G  HID 
Sbjct: 1   MSFHQKFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDA 60

Query: 53  AAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLY 109
           A IY    EVGKA+  +  PR+E+F+T K ++TQ +   +P   LE SL+++G +YVDLY
Sbjct: 61  AEIYRTYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLY 119

Query: 110 LMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSN 169
           L+H P      +  +G  L                   + W+ M++L K  KA+++GVSN
Sbjct: 120 LLHSPF---VSKEANGFTLE------------------EAWKDMEQLYKAGKAKNIGVSN 158

Query: 170 FSINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAP 227
           F++ +L+++L     K  P V Q+E  P L      +  FC+++NI +EAYSPL      
Sbjct: 159 FAVKDLEKILKIAEVK--PQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKK 216

Query: 228 VLDD------PIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKL 279
              D        +K++++++      +++ W  +RG++ +  S+ P+R+    NL +F L
Sbjct: 217 TAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDL 276

Query: 280 SDEEMGSINNL 290
           +DEE+  I  L
Sbjct: 277 TDEEVDEITEL 287

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  133 bits (335), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 158/310 (50%), Gaps = 50/310 (16%)

Query: 11  TVKL-NTGYTIPQVGLGT---WRSKEGDGYKA----------VTAALKAGYRHIDGAAIY 56
           TV+L  +G  +P +G G+   WR  + +G K           V+ A+KAG+ HID A  Y
Sbjct: 7   TVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAY 66

Query: 57  LNEEEVGKAIRDSGIPREELFITTKL----WNTQQ-RNPQEALEQSLERLGLEYVDLYLM 111
               EVG  I +SG+PRE+L++T K     W  ++ + P E+LE SL ++ ++YVDLYL+
Sbjct: 67  KTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLV 126

Query: 112 HWP-VPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNF 170
           H P +  +T  I                      D  + W  M+E+     A+++GVSNF
Sbjct: 127 HVPFINPETAGI----------------------DLKEAWRQMEEIYDRGWAKNIGVSNF 164

Query: 171 SINNLKELLASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG--GHGA 226
            + +L E + + G K  P V Q+E    + Q +  +  +CK+H I +E YSPL     G 
Sbjct: 165 DVESL-EYIRTIG-KYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGK 222

Query: 227 PVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEM 284
           P   D I+  +A ++      +++ W VQ G++ +  S   +R+  +L    F+LS E+ 
Sbjct: 223 PGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDF 282

Query: 285 GSINNLSKSR 294
            SI  + K++
Sbjct: 283 TSITEVGKTK 292

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  133 bits (334), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 99/310 (31%), Positives = 153/310 (49%), Gaps = 47/310 (15%)

Query: 5   LSNNTSTVKLNTGYTIPQV---GLGT-WRSKEGDGY-------KAVTAALKA-GYRHIDG 52
           +S+N + V LN G+ +P V   G GT W  K+   +       + +  AL   G  HID 
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 53  AAIYLNEEEVGKAIRDSGIPREELFITTK--LWNTQQRNPQEALEQSLERLGLEYVDLYL 110
           A +Y    E+  A+R +  PR E+FIT K  L     ++P   LE SL+   L+YVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 111 MHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNF 170
           +H P                 AKE  KP +  E      W  M++L K  KA+++GVSNF
Sbjct: 121 LHSPFV---------------AKE--KPGLTLE----GAWRQMEQLYKDGKAKNIGVSNF 159

Query: 171 SINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAPV 228
           S+ +LK +L+    ++ P V Q+E HP L      +  FC++ NI++EA++PLG      
Sbjct: 160 SVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKT 217

Query: 229 LDD------PIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLS 280
            +D        I  ++ ++      +++ W  +RG++ +  S   +R+    NL  F L 
Sbjct: 218 QEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLE 277

Query: 281 DEEMGSINNL 290
           DEE+  I  L
Sbjct: 278 DEEVTKITRL 287

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  132 bits (332), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 142/287 (49%), Gaps = 44/287 (15%)

Query: 17  GYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRD------SG 70
           G  IP + LG +          V  ALK GYRH D A +Y NE+EVG+ I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 71  IPREELFITTKLWNTQ------QRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITD 124
             RE++F TTKLWN+Q      +R   E + +  E   L Y+DL L+H P          
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKE---LGYIDLLLIHSP---------- 118

Query: 125 GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184
              LS P +             ++T++ MQE       +S+GVSN+   +++EL      
Sbjct: 119 ---LSGPRRR------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKL 163

Query: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244
           K  P   Q+EI P   +  L  +C+   + VEA+SPL  HG   L +P +  +A +   D
Sbjct: 164 KHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL-THGYK-LKEPGLVSLAKKLGRD 221

Query: 245 AGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289
            G V++ W +QRG++ LPK+  P R+ SNL    F+L+ E++  +++
Sbjct: 222 TGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  132 bits (332), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/311 (30%), Positives = 160/311 (51%), Gaps = 49/311 (15%)

Query: 5   LSNNTSTVKLNTGYTIPQV---GLGT--WRSKEGDG------YKAVTAALKA-GYRHIDG 52
           +S +     LN G  IP +   G GT  ++++E D        + +  ALK  G  HID 
Sbjct: 1   MSFHQQFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDA 60

Query: 53  AAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLY 109
           A IY    EVGKA+  +  PR  +F+T K ++ Q +   +P + L+ +L+++G +YVDLY
Sbjct: 61  AEIYRTYPEVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLY 119

Query: 110 LMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSN 169
           L+H   P  +K +   +L                    + W+ M++L K+ KA+++GVSN
Sbjct: 120 LLH--SPFVSKEVNGLSL-------------------EEAWKDMEQLYKSGKAKNIGVSN 158

Query: 170 FSINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAP 227
           F++ +L+ +L     K  P V Q+E  P L      +  FC+EH+I VEAYSPLG     
Sbjct: 159 FAVEDLQRILKVAEVK--PQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKK 216

Query: 228 VLDD------PIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKL 279
              D        +K++++++      +++ W  +RG++ +  S+ P+R+    NL +F L
Sbjct: 217 TAQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDL 276

Query: 280 SDEEMGSINNL 290
           + EE+  I  L
Sbjct: 277 TAEEVDKITEL 287

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 152/312 (48%), Gaps = 54/312 (17%)

Query: 11  TVKLNTGYT-IPQVGLGT---WRSKEGDG----------YKAVTAALKAGYRHIDGAAIY 56
           T+++   +T IP +G GT   WR  + +G             +  A+  G+ HID A  Y
Sbjct: 8   TIEIKETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFY 67

Query: 57  LNEEEVGKAIRDSGIPREELFITTKL----WN-TQQRNPQEALEQSLERLGLEYVDLYLM 111
           L  EEVG+A+R S +PR++LFIT K     W       P +A ++ LE LG++Y DLY++
Sbjct: 68  LTHEEVGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYML 127

Query: 112 HWPVPLKTKRITDGNLLSSPAKEDGKPDVDTE---WDFVKTWELMQELPKTKKARSVGVS 168
           H                        +PD+  E    D  + W  ++EL +   A+++GVS
Sbjct: 128 H------------------------RPDITKENAGIDLQEAWRQVEELYEAGIAKAIGVS 163

Query: 169 NFSINNLKELLASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG--GH 224
           NF +  LK++ +    + +P V QVE HP L   +  + ++C+  +I VEAYSPL     
Sbjct: 164 NFPLETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAPLFR 221

Query: 225 GAPVLDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDE 282
             P   D I+  +  ++      +V+ W + RGIV L  S+  ER+   L T  F+L   
Sbjct: 222 ARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKS 281

Query: 283 EMGSINNLSKSR 294
           ++  IN +   +
Sbjct: 282 DVELINEVGSKK 293

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  130 bits (327), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 139/260 (53%), Gaps = 39/260 (15%)

Query: 46  GYRHIDGAAIYLNEEEVGKAIRDSG--IPREELFITTKLWNTQQR---NPQEALEQSLER 100
           G  HID A +Y    EVGKA+R+S    PR+E+FIT K ++TQ +   NP   L   L++
Sbjct: 55  GIVHIDAAEVYRTYPEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKK 113

Query: 101 LGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTK 160
           LGL+YVDLYL+H P   K K   +G  +                   + W+ M++L K  
Sbjct: 114 LGLDYVDLYLLHSPFISKEK---NGFTME------------------EAWKYMEDLYKAG 152

Query: 161 KARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAY 218
           K +++GVSNFS+ +L+ +L S   K  P V Q+E +  L      + +FC+E++IQV AY
Sbjct: 153 KVKNIGVSNFSMADLQRILKSCEVK--PQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAY 210

Query: 219 SPLGGHGAPVLD------DPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV-- 270
           +PLG       +         +KQ+A++++     +++ W  +RGI+ +  S+  +R+  
Sbjct: 211 TPLGPLQRKSKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKD 270

Query: 271 VSNLRTFKLSDEEMGSINNL 290
              L TF L+D E+  I  L
Sbjct: 271 AQYLFTFDLTDSEVEKITQL 290

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  130 bits (327), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 148/304 (48%), Gaps = 49/304 (16%)

Query: 16  TGYTIPQVGLGT---WRSKEGDG----------YKAVTAALKAGYRHIDGAAIYLNEEEV 62
           +G  +P +G G+   WR  +  G             VT A++ G+ HID A  Y   +EV
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GKAIRDSGIPREELFITTKL--WNTQQRN---PQEALEQSLERLGLEYVDLYLMHWP-VP 116
           G  I ++ +PRE L+IT K   W+ + R    P E+L  SL+ + L+YVDLY++H P + 
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVPNIT 133

Query: 117 LKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLK 176
            KT  I                      D  + W  M+E+   K AR++GVSNF + +L+
Sbjct: 134 TKTAGI----------------------DLKEAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 177 ELLASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG--GHGAPVLDDP 232
            + +    K  P V Q+E    + Q +  +  +C+E+NI VE YSPL     G P   D 
Sbjct: 172 YIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLDE 229

Query: 233 IIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVS--NLRTFKLSDEEMGSINNL 290
           I+  IA ++      V++ W  Q GIV +  +   ER+    N+  F+LS E+   I N+
Sbjct: 230 ILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITNV 289

Query: 291 SKSR 294
            + +
Sbjct: 290 GREK 293

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  125 bits (315), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 150/304 (49%), Gaps = 53/304 (17%)

Query: 14  LNTGYTIPQV---GLGT-WRSKEGDGYKAVTAALKA--------GYRHIDGAAIYLNEEE 61
           LN G  IP V   G GT W  KE        A +K         G  H+D A +Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
             +A++++  PR E+F+T K ++ Q++   +P+E L+  L+R GLEYVDLYL+H P   K
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK 128

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
            K   +G  +                   + W  ++EL    KA+++GVSNF + +L+++
Sbjct: 129 EK---NGFTIE------------------EAWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 179 LASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLG--------GHGAPV 228
           L     K+ P V Q+E    L      +  F ++H+IQ+EAY+PLG            P 
Sbjct: 168 LKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPF 225

Query: 229 LDDPIIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMGS 286
            D   IK++ ++++     +++ W  +RGI+ +  S  P+R+    NL  F L+ +E+  
Sbjct: 226 YD--YIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDE 283

Query: 287 INNL 290
           I  L
Sbjct: 284 ITKL 287

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 132/258 (51%), Gaps = 36/258 (13%)

Query: 46  GYRHIDGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLG 102
           G  HID A +Y    EV KA++ +   R+E+FIT K ++   +   NP   L +SL+ L 
Sbjct: 54  GIIHIDAAEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELE 113

Query: 103 LEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKA 162
           L+YVDLYL+H P   K                         +   + W+ M++L K  KA
Sbjct: 114 LDYVDLYLLHSPFITKE---------------------SCGYTMEEAWKQMEKLYKDGKA 152

Query: 163 RSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSP 220
           +++GVSNFS+++LK +L     ++ P + Q+E +  L      +  FC++H+I VEAYSP
Sbjct: 153 KNIGVSNFSVDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSP 210

Query: 221 LGG-HGAPVLDDP-----IIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VS 272
           LG     P   DP      I+++A ++    G V++ W  +R I+ +  S   ER+    
Sbjct: 211 LGPLRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQ 270

Query: 273 NLRTFKLSDEEMGSINNL 290
           +L +F L+ EE+  I  L
Sbjct: 271 DLFSFDLTSEEVEKITKL 288

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/313 (31%), Positives = 150/313 (47%), Gaps = 56/313 (17%)

Query: 5   LSNNTSTVKLNTGYTIPQV---GLGTWRSKEGDGY--------KAVTAALKAGYRHIDGA 53
           +S N     LN G  I  V   G GT    E   +        +A  A    G  H+D A
Sbjct: 1   MSLNQQFFTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAA 60

Query: 54  AIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLM 111
             Y    E+ KA+++S  PR E+FIT K     +   NP EAL  +L+ LGL+YVDLY++
Sbjct: 61  EYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVL 120

Query: 112 HWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFS 171
           H+P                P  +D    ++T W        M+ L K  KA+++GVSNFS
Sbjct: 121 HFPE-------------FDPEYKD--LSIETAW--------MELLYKEGKAKNIGVSNFS 157

Query: 172 INNLKELLASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAPVL 229
           I +L+ ++     K  P V Q+E +  L      +  +C+++  Q+EAYSPL    AP+ 
Sbjct: 158 IEHLERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQ 211

Query: 230 DDP----------IIKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVS--NLRTF 277
             P           I +++ ++      +++ W  +RGIV +  S+  ER+V+  NL +F
Sbjct: 212 RKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSF 271

Query: 278 KLSDEEMGSINNL 290
            L+DEE+  I  L
Sbjct: 272 DLTDEEVDKITKL 284

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  121 bits (303), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 150/299 (50%), Gaps = 45/299 (15%)

Query: 14  LNTGYTIPQVGL----GTW---RSKEGDGYKAVTAALKA-----GYRHIDGAAIYLNEEE 61
           LN G  IP V +     TW      E +  K +   +K      G  H+D A  Y   +E
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 62  VGKAIRDSGIPREELFITTKLWNTQQRNPQ--EALEQSLERLGLEYVDLYLMHWPVPLKT 119
           +G+A+R+S  PR+E+FIT K   T + +    E  E  ++++G++YVDLYL+H       
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIH------- 141

Query: 120 KRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179
                     SP  E  K  V  E    + W+ +++L +  KA+++GVSNF + +L+ +L
Sbjct: 142 ----------SPLIEKEKNGVTLE----EVWKDLEKLYEAGKAKNIGVSNFRVEDLQRIL 187

Query: 180 ASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGGHGAPVLDD----PI 233
                K+ P V Q+E H  L      +  F +++NIQ+EAY+PLG       D       
Sbjct: 188 KVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYNY 245

Query: 234 IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMGSINNL 290
           ++++A ++      V++ W  +R ++ +  S+ P+R+    +L +F L+DEE+  I  L
Sbjct: 246 VEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKITEL 304

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  120 bits (300), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 151/302 (50%), Gaps = 49/302 (16%)

Query: 14  LNTGYTIPQV---GLGT-WRSKEGDGYK-------AVTAALKA-GYRHIDGAAIYLNEEE 61
           LN G  IP V   G GT W   E +  K        V  AL   G  HID A IY    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGKAIRDSGIPREELFITTKLWNTQQR---NPQEALEQSLERLGLEYVDLYLMHWPVPLK 118
           +GKA+R++  PR E++IT K ++T  +   NP    E  L+ LG++Y+DLYL+H P    
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF--- 125

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
              IT+G                  +   + W+ ++EL K+ KA+++GVSNF+  +L+ +
Sbjct: 126 ---ITEGR---------------NGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERI 167

Query: 179 LASPGNKLVPAVLQVEIHPLLPQY--ALCDFCKEHNIQVEAYSPLGG-HGAPVLDDPI-- 233
           L     ++ P V Q+E    L      + +F KE++I +EAYSPLG     P   D +  
Sbjct: 168 LKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLPF 225

Query: 234 ---IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV--VSNLRTFKLSDEEMGSIN 288
              I ++A+++      V++ W  +RG++ +  S+ P RV    ++ TF L+  E+  I 
Sbjct: 226 YKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKIT 285

Query: 289 NL 290
            L
Sbjct: 286 EL 287

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  109 bits (272), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 95/310 (30%), Positives = 151/310 (48%), Gaps = 47/310 (15%)

Query: 14  LNTGYTIPQ---VGLGT-WRSKEG--DGYKAVTAALKA-----GYRHIDGAAIYLNEEEV 62
           LN G +IP    VG+G  W    G  DG K +   LK      G+ HI  A  Y N   +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 63  GKAIRDSGIPREELFITTKLWNTQQ--RNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
             A++ S  PR E++IT K  +  +   +P EALE+SL+RLG +YVDLYL+H P      
Sbjct: 71  SAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNPC----- 125

Query: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180
                 L SSP        +  E    K W+ M+ L KT K +++GVSNF I +L+ L  
Sbjct: 126 ------LDSSPN------GISLE----KAWKQMELLYKTGKVKNIGVSNFRIEDLERLKD 169

Query: 181 SPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLG---GHGAPVLDDPIIK 235
           +   ++ P V ++E H  L      + ++ K H++ +  YSPL          +D P  +
Sbjct: 170 A---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFYR 226

Query: 236 QI---ADRHNADAGNVVVSWGVQRGIVTLPKSTTPE--RVVSNLRTFKLSDEEMGSINNL 290
            I   A+++N     +++ W    G++ +  +T  +  +  S++ +F+L+ EE+  I  L
Sbjct: 227 YIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMITEL 286

Query: 291 SKSRGQKRTN 300
            K     R +
Sbjct: 287 GKKHKPHRKH 296

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 5/91 (5%)

Query: 1  MSATLSNNTST-VKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNE 59
          M+ T+  N  T  KLN G  IP +G G +   + D    V +ALK GYRHID A +Y N+
Sbjct: 1  MTHTIDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQ 60

Query: 60 EEVGKAIR----DSGIPREELFITTKLWNTQ 86
          +E  + +R    ++G  RE ++ TTKLW++Q
Sbjct: 61 KEAAQGVRKYLDETGEARENIWFTTKLWDSQ 91

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 97/235 (41%), Gaps = 55/235 (23%)

Query: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEAL--EQSLERLGLEYVDLYLMHWPVPLK 118
           EVG+A+  +  P+ E+F+T K     + +   A+  + +L+++ +EYVD++ +H P   K
Sbjct: 21  EVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVEYVDMHFLHSPFVFK 80

Query: 119 TKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178
                  N+L+                 +K       L ++ KA + G S+ ++  L+ +
Sbjct: 81  -----QANVLN-----------------LKDAMHTDHLRRSNKANNRGASSVNVEELRRV 118

Query: 179 LASPGNKLVPAVLQVEIHPLLPQYA--LCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQ 236
           L +   +  P V Q+++   L      +   C+E++I +  YS L         DP+   
Sbjct: 119 LKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL---------DPL--- 164

Query: 237 IADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLS 291
              R NA                + P S TPE  V N  +        GS N LS
Sbjct: 165 --QRKNARND-------------SQPFSNTPENRVKNTTSSGFRSSYAGSANMLS 204

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 85/202 (42%), Gaps = 63/202 (31%)

Query: 42  ALKAGYRHIDGAAIYLNEEEV-GKAIRD--SGIPREELFITTKL-------WNTQQRNPQ 91
           A+  G   ID +  Y   E + GKA+++     PREE FI TK+       +N  + N +
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  EALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEW-DFVKTW 150
            ++++S ERL  +Y+DL  +H                            D E+ ++ K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKIW 141

Query: 151 ELMQELPKTKK---ARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQYALCD- 206
           E ++EL K K     R +G+S + ++ L  L  S     VP     EI PL    + C+ 
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPLDAVLSYCNL 194

Query: 207 -------------FCKEHNIQV 215
                        F KE NI+V
Sbjct: 195 TLQSVVLEKEGDRFFKESNIKV 216

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 81/193 (41%), Gaps = 39/193 (20%)

Query: 39  VTAALKAGYRHIDGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQ-----QRNPQEA 93
           +   LKAG + ID A IY + E   KAI +  +P +   I TK          + N  ++
Sbjct: 21  IVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTKASGFSGGCLTRDNINKS 76

Query: 94  LEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELM 153
           +E+SL  LG+  V+ +L+H P                          D E    +T + +
Sbjct: 77  IEESLSLLGVPSVETFLLHSP--------------------------DPEIPLEETLDAI 110

Query: 154 QELPKTKKARSVGVSNFSINNLKEL--LASPGNKLVPAVLQVEIHPLLPQYA--LCDFCK 209
             L +  K    G+SNFS  ++K +   A   + ++P V Q   + L       L    K
Sbjct: 111 NSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALSRAIVNDLFPLLK 170

Query: 210 EHNIQVEAYSPLG 222
           E +I + AYSP+ 
Sbjct: 171 ELHISLYAYSPIA 183

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 39/182 (21%)

Query: 51  DGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQ-----RNPQEALEQSLERLGLEY 105
           D A IY   E   K+I D GI  ++L I TK  + ++         E+++QS + L ++ 
Sbjct: 38  DTARIYPGSE---KSIGDLGIA-DDLVIDTKARSFEEGALTRDGIFESIKQSFDELKVDS 93

Query: 106 VDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSV 165
           V++Y +H P P+            +P +E              T + + EL K  K +  
Sbjct: 94  VEIYYLHAPDPI------------TPIEE--------------TIDAINELYKQGKFKKF 127

Query: 166 GVSNFSINNLKEL--LASPGNKLVPAVLQVEIHPLLP--QYALCDFCKEHNIQVEAYSPL 221
           G+SN++ +++K++   A   N ++P V Q   +      +  L    +++ I   AYSP+
Sbjct: 128 GLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSPI 187

Query: 222 GG 223
            G
Sbjct: 188 AG 189

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 130/329 (39%), Gaps = 67/329 (20%)

Query: 15  NTGYTIPQVGLGT----------WRSKE-GDGYKAVTAALKAGYRHIDGAAIY---LNEE 60
           NTG  I     GT          W  +E  D YK +  A   G R  D A  Y   L+E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  EVGKAIRDSGIPREELFITTKLW----NTQQRNPQEALEQSLERLGLEYVDLYLMHWPVP 116
            +G  ++   IPRE + I TK++    +T + NP + L  + E L L  V+         
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVN------QKG 124

Query: 117 LKTKRITDGNLLSSPAKEDGKPDV------DTEWDFVKTWELMQELPKTKKARSVGVSNF 170
           L  K I +    +S  +     DV      D E  F +T   + ++ +   AR +G S+ 
Sbjct: 125 LSRKHILEA-AKNSVRRLGTYIDVYQIHRCDHETPFEETMRALNDVVEQGYARYIGASSM 183

Query: 171 SINNLKE--LLASPG--NKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPL--GGH 224
                 E   +A     +K V       +     +  +  FCK++N+ +  +SPL  G  
Sbjct: 184 LGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQMGFL 243

Query: 225 GAPVLD-------DPIIK-------------------QIADRHNADAGNVVVSWGVQRG- 257
             P+ +       D +IK                   ++A++ N     V ++W  ++  
Sbjct: 244 ARPITEKSVRQTTDLVIKAMSLDKFSEADKEIIDRVNKLANKKNLKMATVTLAWLFKKNA 303

Query: 258 --IVTLPKSTTPERVVSNLRTFKLSDEEM 284
             IV L K +  +  +  L+  +L++EE+
Sbjct: 304 FPIVGLNKESRIDDALEALKV-ELTEEEV 331

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 70/176 (39%), Gaps = 57/176 (32%)

Query: 18  YTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG----KAIRDSGIPR 73
           Y +P +GL             V  AL+AG   ID +  Y   EE+      A+RD   PR
Sbjct: 52  YEVPTLGL-------------VRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEH-PR 97

Query: 74  EELFITTKL-------WNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGN 126
           E  FI TK+       ++    + + ++ +S  RL  EY+DL  +H              
Sbjct: 98  ETYFICTKVGREGPSDFDYSAAHVRASVHRSCARLHTEYLDLVYLH-------------- 143

Query: 127 LLSSPAKEDGKPDVDTEW-DFVKTWELMQELPKTKK---ARSVGVSNFSINNLKEL 178
                         D E+ +    WE +QEL + K     R  G+S + +  L+E+
Sbjct: 144 --------------DIEFVEAAGIWEALQELRRLKDEGVIRFFGISGYPVELLQEV 185

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 41/143 (28%)

Query: 42  ALKAGYRHIDGAAIYLNEEEV-GKAIRD--SGIPREELFITTKL-------WNTQQRNPQ 91
           A++ G R ID +  Y + E++ GKA+      IPRE  FI TK+       ++  + + +
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 92  EALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWE 151
            ++ +S ERL  +Y+D+  +H                          DV    +FV+T +
Sbjct: 112 SSVLRSCERLRTDYLDVVFLH--------------------------DV----EFVETAQ 141

Query: 152 LMQELPKTKKARSVGV-SNFSIN 173
           +++ L + +K +  GV  NF I+
Sbjct: 142 VLEALKELRKLKDEGVLHNFGIS 164

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 82/196 (41%), Gaps = 39/196 (19%)

Query: 37  KAVTAALKAGYRHIDGAAIYLNEEEVGKAIRDSGIPREELFITTKL-----WNTQQRNPQ 91
           K V    K     +D A IY   EE   AI    +P+    I TK          + +  
Sbjct: 24  KFVDVLEKYKVEELDTARIYPGSEE---AIGKFELPKS-FIIDTKARGFGEGTLTKESIN 79

Query: 92  EALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWE 151
           E++E+S   LG+E V+++ +H P P            ++P +E              T +
Sbjct: 80  ESIEESFGLLGVESVEIFYLHCPDP------------ATPLEE--------------TLD 113

Query: 152 LMQELPKTKKARSVGVSNFSINNLKELLASPGNK--LVPAVLQVEIHPL--LPQYALCDF 207
            +  L K  K +  GVSNFS  +++++ +    K  ++P V Q   + +    + +L   
Sbjct: 114 AIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPV 173

Query: 208 CKEHNIQVEAYSPLGG 223
            +E  +   AYSP+ G
Sbjct: 174 LRELGLSFYAYSPIAG 189

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 116/307 (37%), Gaps = 91/307 (29%)

Query: 42  ALKAGYRHIDGAAIY---LNEEEVGKAIRDSGIPREELFITTKLW--------------N 84
           A   G R  D A +Y   ++E  +G+ +R   IPRE + I TK++               
Sbjct: 49  AYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTK 108

Query: 85  TQQRNPQ-------------EALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSP 131
           T++ N Q              A++ S++RLG  Y+D+Y +H                   
Sbjct: 109 TEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH------------------- 148

Query: 132 AKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL--LASPG--NKLV 187
                    D E  F +T   + ++ +    R +G S+       E+  +A     +K V
Sbjct: 149 -------RCDHETPFEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKFV 201

Query: 188 PAVLQVEIHPLLPQYALCDFCKEHNIQVEAYS---------PLGGHGAPVLDDPI----- 233
                  +     +  +  FCK H I +  +S         PLG H      D +     
Sbjct: 202 NMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIARK 261

Query: 234 --------------IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTF-- 277
                         ++++A + N    ++ + W +Q+G + +   ++ ERV   ++T   
Sbjct: 262 LNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLTT 321

Query: 278 KLSDEEM 284
           KL++++M
Sbjct: 322 KLTEDDM 328

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 40/195 (20%)

Query: 39  VTAAL-KAGYRHIDGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQ-----QRNPQE 92
           ++A L KAG + ID A IY + E++   I +  +P     I TK          + N  +
Sbjct: 25  ISAILEKAGVKDIDTARIYPDSEKI---IGELQLPNR-FTIHTKASGFSGGCLTKDNINK 80

Query: 93  ALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWEL 152
           ++E+SL  LG+  V+ + +H P P             +P +E              T   
Sbjct: 81  SIEESLSLLGVPSVETFFLHSPDP------------ETPIEE--------------TLGA 114

Query: 153 MQELPKTKKARSVGVSNFSINNLKEL--LASPGNKLVPAVLQVEIHPL--LPQYALCDFC 208
           +  L +  K +  G+SNF+  ++K +   A   N ++P V Q   +      +  L    
Sbjct: 115 INSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLL 174

Query: 209 KEHNIQVEAYSPLGG 223
           +E +    AYSP+ G
Sbjct: 175 RELHFSFYAYSPIAG 189

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 91/225 (40%), Gaps = 39/225 (17%)

Query: 22  QVGLGTWRSKEGDGYKAVTAALKAGY----RHIDGAAIY---LNEEEVGKAIRDSGIPRE 74
           Q G   W     D    +   LK  Y    R  D A +Y   L+E  +G+ ++   IPRE
Sbjct: 25  QYGSKEWSEWVEDDKTKIFGILKHCYDRGMRTFDTANVYSNGLSETLLGEFLKHYNIPRE 84

Query: 75  ELFITTKL-WNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAK 133
            + I +KL + T  +   E L++  E L L +V++             ++  N+++S AK
Sbjct: 85  TVVIMSKLNFATDDKVSFETLKERSEELNLHFVNM-----------SGLSRKNIMAS-AK 132

Query: 134 ED-------------GKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL-L 179
           E               + D DT ++  +T   + +L ++   R +G S+       E+  
Sbjct: 133 ESVRRLGTYIDVLQIHRADRDTPYE--ETMRALNDLVESGITRYIGASSMLATEFAEMQF 190

Query: 180 ASPGNKLVPAVLQVEIHPLL---PQYALCDFCKEHNIQVEAYSPL 221
            +        +     + LL    +  L  F K HNI +  +SPL
Sbjct: 191 TAEKYGWFKFINSQSCYNLLYREDERELMPFAKRHNIALTPWSPL 235

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 113/298 (37%), Gaps = 42/298 (14%)

Query: 36  YKAVTAALKAGYRHIDGAAIYLNEEE---VGKAIRDSGIPREELFITTKLWNTQQRNPQE 92
           +K +  A   G R  D A +Y N E    +G+ +++  IPRE + I TKL+     N   
Sbjct: 43  FKILKYAYDKGLRTYDTANVYSNGESEIILGEFLKNYKIPRETVIIMTKLYFPTNDNADY 102

Query: 93  ALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNL-LSSPAKEDGKPDVDTEWDFVKTWE 151
            +        L  V++  +     + + R +   L   +   +  + D DT   F +T  
Sbjct: 103 DIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGTYADIIQIHRADPDTP--FEETMR 160

Query: 152 LMQELPKTKKARSVGVSNFSINNLKEL-LASPGNKLVPAVLQVEIHPLL---PQYALCDF 207
            + ++      R +G S+       E+   +  N     +     + LL    +  L  F
Sbjct: 161 ALNDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPF 220

Query: 208 CKEHNIQVEAYSPL--GGHGAPV-----------------------LDDPII---KQIAD 239
            K HNI +  +SPL  G    PV                        D+ II   ++IA 
Sbjct: 221 AKRHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAK 280

Query: 240 RHNADAGNVVVSWGVQRG---IVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSR 294
           + N     V + W +Q+G   IV + K    +  ++ L    L+ +EM  +    K R
Sbjct: 281 KRNTKMATVALYWVIQKGCFPIVGMSKIDRIDEAIAALE-INLTKDEMTYLEEPYKPR 337

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 74/190 (38%), Gaps = 48/190 (25%)

Query: 148 KTWELMQELPKTKKARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQY---AL 204
           +T++ + E  K  K   + +S  +   ++ +    G  LV   ++VE+     +     +
Sbjct: 145 ETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGEYLV--CVEVELSMFSAEILSNGI 202

Query: 205 CDFCKEHNIQVEAYSPLG-------------------------------GHGAPV---LD 230
            D C E  + + AYSPLG                                H   +   L+
Sbjct: 203 VDTCNELGLPIVAYSPLGRGLLTGALAKSSDIPAGDFRIQLKRFQDDAFAHNKSLVEFLE 262

Query: 231 DPIIKQIADRHNADAGNVVVSW--GVQRG-----IVTLPKSTTPERVVSNLRTFKLSDEE 283
           + II + +D  N     V + W   + +      I+ +P  TT ++V SN    +LSDEE
Sbjct: 263 NEIIAKRSD--NVTLPQVAIGWIRAISKNYPNTKIIPIPSGTTVDKVTSNYSFIELSDEE 320

Query: 284 MGSINNLSKS 293
           +  I+   +S
Sbjct: 321 LAKIDKFLQS 330

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 63/147 (42%), Gaps = 44/147 (29%)

Query: 9   TSTVKL-NTGYTIPQ--VGLGTWRSKE---------GDGYKAVTAALKAGYRHIDGAAIY 56
           T  VK  NTG  I    VG  ++ SK+          + +K +  A  +G R  D A  Y
Sbjct: 4   TQQVKFGNTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGY 63

Query: 57  LNEEE---VGKAIRDSGIPREELFITTKLW----------------NTQQR----NPQ-- 91
            N +    +G+ +++  IPRE + I TK+W                N  Q+    N Q  
Sbjct: 64  SNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGL 123

Query: 92  ------EALEQSLERLGLEYVDLYLMH 112
                 EA + S+ RLG  Y+D+Y +H
Sbjct: 124 SRKHIIEACKNSVRRLGT-YIDVYQIH 149

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 113/298 (37%), Gaps = 55/298 (18%)

Query: 32  EGDGYKAVTAALKAGYRHIDGAAIY---LNEEEVGKAIRDSGIPREELFITTKLWNTQQR 88
           E + +K +      G R  D A  Y   L+E  VGK ++   I RE + I TK++     
Sbjct: 39  EEEIFKVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVFFP--- 95

Query: 89  NPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDV------DT 142
              E L+ S  + G++      +     L  K I DG +  S  +     DV      DT
Sbjct: 96  -VDETLDLSHSK-GMDEATQLTVANQRGLSRKHILDG-VAKSVERLGTYIDVLQIHRFDT 152

Query: 143 EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL-LASPGNKLVPAVLQVEIHPLL-- 199
           E    +T + + ++     AR +G S+       EL   +  +     +     + LL  
Sbjct: 153 ETPVNETMKALNDVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQSCYNLLYR 212

Query: 200 -PQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPI------------------------- 233
             +  L  F K HNI +  +SP   +   VL  P+                         
Sbjct: 213 EDERELIPFAKRHNIGLIPWSP---NARGVLTRPLGTQTLRHSTDFGLKRISAFDLQPHE 269

Query: 234 ------IKQIADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEE 283
                 + +IA++       V ++W + +G   +   ++ ERV   ++   FKL++EE
Sbjct: 270 EEIVRRVGEIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEE 327

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 42/148 (28%)

Query: 47  YRHIDGAAIYLNEEE-VGKAIRDSGIPREELFITTKL-------WNTQQRNPQEALEQSL 98
           +  +D +  Y + E  VG+A+R+  IPR E+++ TK+       ++  + N + ++ +S+
Sbjct: 41  FNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVMRSV 100

Query: 99  ERLGLE--YVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWD----FVKTWEL 152
           ERL  E  Y+D+  +H                            D E+      +   + 
Sbjct: 101 ERLVGEGGYLDVVYLH----------------------------DVEFQPQEACLAALDE 132

Query: 153 MQELPKTKKARSVGVSNFSINNLKELLA 180
           +Q+L +    R+VGVS + ++ L  L++
Sbjct: 133 LQKLKRAGIVRNVGVSGYPLSKLYSLVS 160

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 65/321 (20%), Positives = 115/321 (35%), Gaps = 55/321 (17%)

Query: 15  NTGYTIPQVGLG-------TW----RSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE-- 61
           NTG  +  + +G       TW    +  + + +K +  A   G R  D A +Y N +   
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 62  -VGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120
            +G+ +R   IPRE + I TKL      N     +     + L  V++  +       + 
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 121 RITD---GNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177
           R +    G  +       G PD      F +T   + ++      R VG S        E
Sbjct: 131 RASVKRLGTYIDILQIHRGDPDT----PFEETMGALNDVVIEGLTRYVGASLMLATEFAE 186

Query: 178 L-LASPGNKLVPAVLQVEIHPLL---PQYALCDFCKEHNIQVEAYS---------PLGGH 224
           +   +  +     V     + L+    +  L  F K HNI +  +S         PLG  
Sbjct: 187 MQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTE 246

Query: 225 GAPVLDDPIIK-------------------QIADRHNADAGNVVVSWGVQRGIVTLPKST 265
                 D +IK                   +++ + N     + ++W +Q+G   +   +
Sbjct: 247 TTRSNSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFS 306

Query: 266 TPERVVSNLRTF--KLSDEEM 284
           + ERV   +      L++EEM
Sbjct: 307 SIERVEEAIDALDVNLTEEEM 327

>SAKL0F03696g Chr6 complement(292000..293034) [1035 bp, 344 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W Hypothetical ORF
          Length = 344

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%)

Query: 258 IVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKS 293
           ++ +P  TT ++VV N+  F+LSD E+  IN+  K+
Sbjct: 297 LIPIPGGTTVDKVVENMSEFELSDSELNQINDFLKN 332

>NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON} 
          Length = 339

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 110/291 (37%), Gaps = 49/291 (16%)

Query: 36  YKAVTAALKAGYRHIDGAAIYLN---EEEVGKAIRDSGIPREELFITTKLWNT--QQRNP 90
           ++ +      G R  D A  Y N   E  +G+ +R   I RE + I TK++    +  + 
Sbjct: 43  FRLLKYCYDQGLRTFDTADQYSNGQSERILGEFLRFYNIKRETVVIMTKIFFEVDETLDV 102

Query: 91  QEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDV------DTEW 144
            ++++ + + + L  V+         L  K I  G + +S  +     DV      D E 
Sbjct: 103 PQSIKTANDEIKLAVVN------QRGLSRKHIIAG-VSNSCDRLGTYIDVLQIHRYDPET 155

Query: 145 DFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPG----NKLVPAVLQVEIHPLLP 200
              +T   + ++  + + R +G S        E     G    +K V    Q  +     
Sbjct: 156 PMEETMRALNDVINSGEVRYIGASRMLATQFAEYQFIAGKNGWHKFVNWQSQYNLLYRED 215

Query: 201 QYALCDFCKEHNIQVEAYSPLG---------------GHGAPVL------DDPII---KQ 236
           +  +  F K HNI +  YSP                 G G P L      D  I+   +Q
Sbjct: 216 EREVIPFAKRHNIALTPYSPNAKGILTRPWGSSTERTGKGDPRLKMLMKCDREIVERVRQ 275

Query: 237 IADRHNADAGNVVVSWGVQRGIVTLPKSTTPERV---VSNLRTFKLSDEEM 284
           +ADR N     + +SW + +G   +    +  RV   V  L+   LS E++
Sbjct: 276 LADRKNVSMAQISLSWILHKGCYPIIGVNSIPRVQEAVVALQELSLSSEDI 326

>AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR127W
          Length = 341

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 70/180 (38%), Gaps = 44/180 (24%)

Query: 151 ELMQELPKTKKARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPL---LPQYALCDF 207
           E + E  K  K  ++G+S  +   ++ +    G  L  A ++VE   L   +    L   
Sbjct: 145 EAVVEYVKAGKIGAIGLSEVTAEQVRAISRDYGEYL--ACVEVEFSMLSRDILHNGLAQT 202

Query: 208 CKEHNIQVEAYSPLG--------------------------GH--------GAPVLDDPI 233
           C E  I +  YSPL                           GH         A  L + I
Sbjct: 203 CAELGIPILCYSPLARGLLTNAISTPDDVPAGDLRRLLARFGHDALANNLQAATFLQEHI 262

Query: 234 IKQIADRHNADAGNV--VVSW-GVQRG--IVTLPKSTTPERVVSNLRTFKLSDEEMGSIN 288
           IK  A      A  +  + SW G  +G   + +P +TTP+RV  +L   +L+ EE+ SIN
Sbjct: 263 IKPRAPPPPLPAVALAWIRSWSGTHKGTHFLPIPGATTPQRVEESLSICELTPEELDSIN 322

>Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 10/84 (11%)

Query: 39  VTAALKAGYRHIDGAAIYLNEEEV-GKAIRD--SGIPREELFITTKL-------WNTQQR 88
           +  A   G   ID +  Y   E + GKA+R+  +  PR   FI TK+       +N  + 
Sbjct: 54  IKYAFWHGINAIDTSPYYGPSEILYGKALRNLKNEFPRNTYFICTKVGRIGADEFNYSKE 113

Query: 89  NPQEALEQSLERLGLEYVDLYLMH 112
             + ++ +S ERL   Y+DL  +H
Sbjct: 114 FVRFSVHRSCERLNTTYLDLVYLH 137

>KLLA0C13343g Chr3 complement(1139922..1140554) [633 bp, 210 aa]
           {ON} highly similar to uniprot|P50946 Saccharomyces
           cerevisiae YNL099C OCA1 Putative protein tyrosine
           phosphatase required for cell cycle arrest in response
           to oxidative damage of DNA
          Length = 210

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 180 ASPGNKLVPAVLQVEIHPLL------PQYALCDFCKEHNIQVE--AYSPLGG 223
             P N   P +L +++  ++      PQ AL +FC +HNIQ++  A +P GG
Sbjct: 56  GQPSNVNFPFLLNLKLKTIIWLANEEPQDALLEFCDDHNIQLQFAAINPDGG 107

>NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.604
           YMR041C
          Length = 333

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 42  ALKAGYRHIDGAAIYLNEE-EVGKAIRD--SGIPREELFITTKL-------WNTQQRNPQ 91
           A   G   ID +  Y + E  +GKA+++     PRE   I TK+       ++  + + +
Sbjct: 34  AFTNGVNAIDTSPYYGDSEILIGKALKELSDEFPRESYSICTKVGRISLDSFDYSKEHVE 93

Query: 92  EALEQSLERLGLEYVDLYLMH 112
            ++ +S ERL   Y+DL  +H
Sbjct: 94  FSVRRSCERLNTTYLDLVYLH 114

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 73/346 (21%), Positives = 124/346 (35%), Gaps = 104/346 (30%)

Query: 15  NTGYTIPQVGLGT-------WRSKEGDGYKAVTAALKAGY----RHIDGAAIY---LNEE 60
           NTG  I  + +G        W     D    +   LK  Y    R  D A  Y   L+E+
Sbjct: 12  NTGLKISPIIVGCMSYGSKNWAEWVEDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEK 71

Query: 61  EVGKAIRDSGIPREELFITTKLW-----------NTQQRNPQE----------------A 93
            +G+ +    I RE + I TK++           NT     QE                 
Sbjct: 72  LLGEFLVKYNIKRETVVIMTKIFFPFDETLNLKSNTPLSELQELDVVNQRGLSRKHILDG 131

Query: 94  LEQSLERLGLEYVDLYLMHWPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELM 153
           +E+++ RLG  Y+D+  +H   P             +P KE              T + +
Sbjct: 132 VEKAIARLG-TYIDVLQIHRFDP------------ETPIKE--------------TMKAL 164

Query: 154 QELPKTKKARSVGVSNFSINNLKEL--LASPGN--KLVPAVLQVEIHPLLPQYALCDFCK 209
            ++ ++   R +G S+       E+  +A   N  + V A     +     +  L  FCK
Sbjct: 165 NDVIESGHVRYIGASSMLATQFAEMQFIADKYNWFQFVNAQSMYNLVYREDERELIPFCK 224

Query: 210 EHNIQVEAYSP--LGGHGAP---------------------VLDDPI-----IKQIADRH 241
            HNI +  +SP   G    P                     VL+  I     ++++A++ 
Sbjct: 225 RHNIALTPWSPNHRGFLTRPIGTKSLRSESDRFTINKLRDNVLESDIKIVKRVEELAEKK 284

Query: 242 NADAGNVVVSWGVQRG---IVTLPKSTTPERVVSNLRTFKLSDEEM 284
                 +  +W V +G   I+ L K+   +  +S L +   +DEE+
Sbjct: 285 GVSMAAISTAWVVSKGCQPIIGLSKTERVDDAISAL-SVTFTDEEL 329

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 44/112 (39%), Gaps = 32/112 (28%)

Query: 204 LCDFCKEHNIQVEAYS---------PLGGHGAPVLDDPIIK------------------- 235
           L  FCK HNI +  +S         P+G       +DP +K                   
Sbjct: 195 LIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKLEKSDIEIINRVE 254

Query: 236 QIADRHNADAGNVVVSWGVQRG---IVTLPKSTTPERVVSNLRTFKLSDEEM 284
           ++A +       +  +W + +G   IV + K++  +  +  L+  K +DEE+
Sbjct: 255 ELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIKALKV-KFTDEEL 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,913,287
Number of extensions: 1537705
Number of successful extensions: 3630
Number of sequences better than 10.0: 145
Number of HSP's gapped: 3328
Number of HSP's successfully gapped: 145
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)