Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E019005.435ON76276239150.0
ZYRO0F10054g5.435ON6607168791e-107
NCAS0F033905.435ON8618057054e-80
Skud_4.6385.435ON8438066746e-76
NDAI0B056805.435ON8566886441e-71
YDR369C (XRS2)5.435ON8547216441e-71
SAKL0G02552g5.435ON8348066211e-68
CAGL0A02838g5.435ON8287936158e-68
KAFR0E038305.435ON8457316062e-66
Smik_4.6355.435ON8637975762e-62
Kwal_55.214225.435ON7827835194e-55
KNAG0C049005.435ON7697714727e-49
KLTH0F16038g5.435ON7927764649e-48
Suva_2.5415.435ON8693944127e-41
TBLA0A028205.435ON9254094064e-40
Ecym_47615.435ON7987953592e-34
TPHA0J025905.435ON7757603314e-31
Kpol_1016.55.435ON8123753272e-30
AER402C5.435ON8694062433e-20
KLLA0E02201g5.435ON8354611914e-14
KNAG0K015903.224ON100783761.9
KNAG0F025706.109ON15181712.9
KAFR0A047006.109ON15381703.9
SAKL0H17028g8.262ON550321724.7
TBLA0H022005.174ON1485104725.4
Suva_4.2703.224ON96189725.9
Skud_2.1503.224ON96389726.2
YBR038W (CHS2)3.224ON96389716.6
SAKL0A07260g6.109ON16981696.7
Ecym_30776.109ON17081696.8
Skud_7.2226.109ON17081687.2
Smik_2.1563.224ON96489717.2
AAR156C6.109ON17081687.5
KLTH0H06732g6.109ON16081687.8
Smik_7.2226.109ON17181688.1
TDEL0G036106.109ON16981688.2
Suva_7.2136.109ON17381688.2
NDAI0I016506.109ON17681688.5
YGL058W (RAD6)6.109ON17281688.9
NCAS0D032206.109ON17181679.7
Smik_8.1305.325ON129586610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01900
         (762 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...  1512   0.0  
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   343   e-107
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   276   4e-80
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   264   6e-76
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   252   1e-71
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   252   1e-71
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   243   1e-68
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   241   8e-68
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   238   2e-66
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   226   2e-62
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   204   4e-55
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   186   7e-49
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   183   9e-48
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   163   7e-41
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   160   4e-40
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   142   2e-34
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   132   4e-31
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   130   2e-30
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    98   3e-20
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    78   4e-14
KNAG0K01590 Chr11 complement(329918..332941) [3024 bp, 1007 aa] ...    34   1.9  
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    32   2.9  
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    32   3.9  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...    32   4.7  
TBLA0H02200 Chr8 complement(531667..536124) [4458 bp, 1485 aa] {...    32   5.4  
Suva_4.270 Chr4 (477714..480599) [2886 bp, 961 aa] {ON} YBR038W ...    32   5.9  
Skud_2.150 Chr2 (281578..284469) [2892 bp, 963 aa] {ON} YBR038W ...    32   6.2  
YBR038W Chr2 (311898..314789) [2892 bp, 963 aa] {ON}  CHS2Chitin...    32   6.6  
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    31   6.7  
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    31   6.8  
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    31   7.2  
Smik_2.156 Chr2 (292824..295718) [2895 bp, 964 aa] {ON} YBR038W ...    32   7.2  
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    31   7.5  
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    31   7.8  
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    31   8.1  
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    31   8.2  
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    31   8.2  
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      31   8.5  
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    31   8.9  
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      30   9.7  
Smik_8.130 Chr8 (195390..195779) [390 bp, 129 aa] {ON} YHR059W (...    30   10.0 

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score = 1512 bits (3915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/762 (96%), Positives = 739/762 (96%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
           LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180
           QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT
Sbjct: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180

Query: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE 240
           NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE
Sbjct: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE 240

Query: 241 RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDLVNAVSHNT 300
           RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDLVNAVSHNT
Sbjct: 241 RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDLVNAVSHNT 300

Query: 301 VKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRR 360
           VKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRR
Sbjct: 301 VKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRR 360

Query: 361 YNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQINVPENDASQESS 420
           YNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQINVPENDASQESS
Sbjct: 361 YNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQINVPENDASQESS 420

Query: 421 AFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQA 480
           AFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQA
Sbjct: 421 AFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQA 480

Query: 481 NLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQV 540
           NLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQV
Sbjct: 481 NLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQV 540

Query: 541 DTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAK 600
           DTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAK
Sbjct: 541 DTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAK 600

Query: 601 YKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQFSVP 660
           YKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQFSVP
Sbjct: 601 YKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQFSVP 660

Query: 661 QVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVVLAARESIRPEEAVQLVDXXX 720
           QVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVVLAARESIRPEEAVQLVD   
Sbjct: 661 QVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVVLAARESIRPEEAVQLVDPSP 720

Query: 721 XXXXXXXXXXGKRKRENRRSPYXXXXXXXXXXPKFKFSRRLK 762
                     GKRKRENRRSPY          PKFKFSRRLK
Sbjct: 721 RRSRSLPYSPGKRKRENRRSPYDDDDDEDDDEPKFKFSRRLK 762

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  343 bits (879), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 254/716 (35%), Positives = 386/716 (53%), Gaps = 109/716 (15%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y Y+LEDG ++ VS CL   +T++IGRSSKN LNIKNDKSISR H+S+ WD + +
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
            ++LINQG++TA   KYLK+GES+ F + +     +++ELGTKP+K+++ W D ++ +P 
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGT---VLVELGTKPLKMQLQWMDSIWMVPQ 117

Query: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180
                   L+ +GI V +  + +R+  I++ ++  ++ + L+GL+    + N +FL  V+
Sbjct: 118 GSRSDHSALEELGIEVLSSEL-SRANLIVIDEQQNYS-RWLYGLVKRIPLMNLEFLNVVS 175

Query: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE 240
             +S   T F+  W + I N+  + Y  +      +L+  +F  +  D  T      A+E
Sbjct: 176 QKVSGHETEFDSIW-TKIMNDGSLRY-KSWEVQAQVLQNLEFLTVGKDEDTSL----AIE 229

Query: 241 RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI----KLHTLVDLVNAV 296
              G+   V + E+L + +K++    ++++LK+  T   P +++    K  T+ D+V A+
Sbjct: 230 AAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLT---PAEELAPLGKTFTVQDVVEAI 286

Query: 297 SHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPV 356
             + V +L  G          VIG         EV+           PE  V P EKP  
Sbjct: 287 LKDEVNSLKNG----------VIG---------EVAKR---------PEAEV-PMEKPVT 317

Query: 357 KRRRYN--RVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQINVPEND 414
           K+RR N  RVKPLD L FFAGGD S +E + E ST  +N   S   ++    ++  P+ +
Sbjct: 318 KKRRLNRPRVKPLDILSFFAGGD-SMKESQGE-STMKLN---SQEEESKDPRKLEDPKEE 372

Query: 415 ASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIE----MNH 470
            S+ES      QP +         + + PG    ++E + A+++ K + + +E    +  
Sbjct: 373 -SKESKEV--LQPEV--PKEFNEYSKEEPG--QKSYEESKADENEKSLEETVEPTLQVTE 425

Query: 471 PESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREV 530
           P     +E+ N        RP  RK TL D++         + S   ++ +I+D K+ EV
Sbjct: 426 PPPTSAAEKPN------NARP-HRKPTLSDYRK------GESPSQNDMIQMIQDTKNHEV 472

Query: 531 KRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKN 590
           KRL ST++QV  +ELTEDAINQLG+L +V  ND+L+RR+       S N   P W+ RKN
Sbjct: 473 KRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHN---PNWNNRKN 529

Query: 591 FKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYT-----KESSKEMQD 645
           FKNFVKV  KY  Q      REGSSD IRN  +LLTRQYVP++ YT     K++ +++ D
Sbjct: 530 FKNFVKVWPKYGGQ--DSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYD 587

Query: 646 FPEASEQTSRQFSVPQVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQNDVVL 701
           FPE   +     SVPQV                   P  N LFV+DEDDSQ DV L
Sbjct: 588 FPEPQPEAQ---SVPQV-----------------EAPGPNNLFVMDEDDSQ-DVAL 622

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  276 bits (705), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 248/805 (30%), Positives = 373/805 (46%), Gaps = 156/805 (19%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MW+L+Y Y+LEDG+ +++S C+ K   ++IGRS+KN L+IKNDKSISR H+S+ W+    
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
            I +INQG+LT  G +YL VG+S+ F         + I+LGTKP+ V + +    + +P+
Sbjct: 61  -IHIINQGKLTYIGEQYLDVGQSLTFGNV----NSLSIKLGTKPVMVHLEFYSSNWLIPN 115

Query: 121 QLSQFIDTLDHVGIGVKADT-VDNRSTTIIVTDKIKFAYKC-LFGLINGAVIRNSQFLVE 178
            L+QF +TL   G+ V     VD ++   ++ D+I  +    L+G +    ++  QF   
Sbjct: 116 GLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFST 175

Query: 179 VTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQE- 237
              ILS     F+ SW  L Q  S  L+ +    H + LK  +  L  + VI + +  E 
Sbjct: 176 ACEILSSNDNDFDNSWHRL-QETSNTLFCS----HYISLKD-RSRLFENYVILILFDNET 229

Query: 238 ----------ALERGNG---ELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI 284
                     AL  G     +   +  ++  ++ LK   +T+  I L    + K P D++
Sbjct: 230 NKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKP--TTNQHICLVKFGSFKSPNDQL 287

Query: 285 ---KLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLT-----KTEVSSSQS 336
              +   L D++ A+  + +  L+  +P  E      + S  P +T     KT +  S  
Sbjct: 288 PDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDV-SLIPEITYPSDRKTNIQPSHH 346

Query: 337 LSNKEHTPEHTVT----PAE----KPPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQE 386
             +  H  +  V     P E     P VK+RR NR  VKPLDSL FFAGG          
Sbjct: 347 TVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGG---------- 396

Query: 387 ISTQPVNPAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLK----NS-----AKP 437
            S +  +PA  +TA+ +              ES+  DKF+ N  L     NS     ++P
Sbjct: 397 ASPKIGSPAVQETAQAT------------KDESAESDKFRTNNGLTQPSGNSQPLIHSEP 444

Query: 438 LTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRP------ 491
           + +    +A +   I         + Q       E  +Q++ + +  V  TP P      
Sbjct: 445 IVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGN 504

Query: 492 -TARKKTLQ---------DFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVD 541
              R  T Q         + K   N   NS    +  V  I++ K+REV RLKST+V++D
Sbjct: 505 GVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRLKSTMVEID 564

Query: 542 TDELTEDAINQLGDLAIVQPNDSLIRRQKI----------DSAETSRNDQHPPWDGRKNF 591
           TDELTE AINQLG L IV+PN SLIR++            DS +T+R      W  RKNF
Sbjct: 565 TDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTARE-----WSRRKNF 619

Query: 592 KNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYT---------KESSKE 642
           K FVK+  KY    M ++    ++D IRN+ +L+TR YVP K +T          E   E
Sbjct: 620 KKFVKIYPKY----MKKDTESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPNDDEDMYE 675

Query: 643 MQDFP-EASEQTSRQFSVPQVIDD-----------------------------PEDAEPF 672
             D+  E  E      ++P V++D                              ++ + F
Sbjct: 676 HHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDDEGQSF 735

Query: 673 TFTRHTSG---TPANNGLFVVDEDD 694
           +F R  +    T ANNGLFVVDEDD
Sbjct: 736 SFRRSMANAKKTTANNGLFVVDEDD 760

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  264 bits (674), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 239/806 (29%), Positives = 378/806 (46%), Gaps = 143/806 (17%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MW+++Y   +EDG I  +S CL   +++SIGRSSKN L IKNDKSISR HI+  W+    
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  L------IRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPII-----IELGTKPIKVEV 109
           L      + LINQG+LT+   K+LKVGE      K  I  P +     IELGT P  +EV
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGE------KFIIYAPEVSNLTTIELGTSPFHIEV 114

Query: 110 VWQDVVFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTD---KIKFAYKCLFGLIN 166
            W   ++++PS L++F  TL   GI  ++ ++D+    ++++D         + L+ L+N
Sbjct: 115 AWVSEIWNIPSHLTEFRTTLSQFGISTES-SIDDGPINLMISDFPSSDDNGMRELYALVN 173

Query: 167 GAVIRNSQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFY 223
              ++  + LV+V   L   S     F+E W  ++ +  + ++  N     +  K  K  
Sbjct: 174 AIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVF--NFDASVLSSKFMKLN 231

Query: 224 LIASDVITMAYVQEALE---RG-NGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKI 279
            I   V+T    +  L    RG N +L+  +N + L + +     +   ++L +  T K 
Sbjct: 232 RII--VLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTS--TNKT 287

Query: 280 PGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSN 339
              +I+       +N +  + ++  L  +   ++ P ++       +++ + +SS++L  
Sbjct: 288 ENGQIQC-----TINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTL-- 340

Query: 340 KEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG----------DYSTEE---PEQE 386
             HTPE  V PA     +R    RV+PLDSL FFAGG          D++  E   P   
Sbjct: 341 --HTPEIEVGPAILK-KRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLG 397

Query: 387 ISTQPVNPAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKN------------- 433
           + T   +P      +TS     N+ + D + E     K    IV+ +             
Sbjct: 398 LKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSE 457

Query: 434 ----SAKPLTIDSPG-----------DAHNTHEINTANQH------VKDIAQQIEMNHPE 472
                  PLT+  PG            AH   +   A  +       +DI Q +E NH  
Sbjct: 458 DKPPRLSPLTVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEP 517

Query: 473 SEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKR 532
            EQ  E+ + + V+   R +  K+ LQ  KS  N P          V+ I++ K+REV+R
Sbjct: 518 PEQSQEKNSYSQVD---RKSPVKELLQKRKS--NTP-------LSFVEAIQETKNREVER 565

Query: 533 LKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHP--------P 584
            KST+VQ++ DEL+E+ INQL +LAIV+PN+ L+R+ +I    + R              
Sbjct: 566 FKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQE 625

Query: 585 WDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKES----- 639
           W  RKNFK F+KV  K+K Q  G      +SDFIR++ +L+TR YVP + Y+K +     
Sbjct: 626 WHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATEC 685

Query: 640 -SKEMQDFPEASE-----------------------QTSRQFSVPQVIDDPEDAEPFTFT 675
             KE +D     E                       +T   F + + I D  + + F+F+
Sbjct: 686 NGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQGPRTQNTF-INEDISDEGNQQSFSFS 744

Query: 676 RHTS-GTPANNGLFVVDEDDSQNDVV 700
           RH+    PA N LFV  EDD +N++V
Sbjct: 745 RHSDIAQPAKNKLFVT-EDDDKNNMV 769

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  252 bits (644), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 219/688 (31%), Positives = 346/688 (50%), Gaps = 66/688 (9%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y Y LEDG I++VS CL +   +SIGRSSKNPL+IKNDKSISR HI++ W+   +
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
           L  L+NQG+LT+   +YL + ES+ F   +  +E + + LGT P+ V++ WQ +   +P+
Sbjct: 61  L-HLVNQGKLTSVKERYLAIDESLIF-NVVDTKE-LDVHLGTNPVIVQIRWQPMNLYIPN 117

Query: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180
              QF   L   GI V +D +   S    V       Y  L  L  G  +  SQ+L EV+
Sbjct: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177

Query: 181 NILSKPTTTFEESWDSLIQNESYMLYPN-NLGPHEVILKGYKFYLIASDVITMA------ 233
           N+L     TF+     +   ES  L P+ +L  +        F++I  +  +++      
Sbjct: 178 NMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKS 237

Query: 234 -YVQEALERGNGELIVVENTEQLLDRLKQENSTD--DLIVLKAEETTKIPGDKIKLHTLV 290
             ++++L+   GE  ++++  +L + + +  ST   +++++  E+  K      +   + 
Sbjct: 238 FILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVK 297

Query: 291 DLVNAVSHNTVKTLLGGV----------PPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNK 340
           D+ ++   N  K L   +          P +      ++   +P +       S S  N 
Sbjct: 298 DIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNL 357

Query: 341 EHTPEHTVTPAEKPPVKRRRY--NRVKPLDSLMFFAGGDYSTEEPEQEIST----QPVNP 394
           +HTP   VT      VK+RR    RVKPL+SL FF GG  +T  P +  ST    + + P
Sbjct: 358 KHTPPEPVTTH---IVKKRRLARKRVKPLESLDFFVGGS-TTGTPFETSSTTLQQEIIEP 413

Query: 395 AASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINT 454
              D A   +  QI   + + S    A D +      +     LT  +  D H    +  
Sbjct: 414 KVPDVAPI-LNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTY-ATIDKH----MQE 467

Query: 455 ANQHVKDI-AQQIEMN-HPESEQQSEQANLNMVETTPRPTARKKTLQDFKST------VN 506
             Q + DI +Q I+++ H  S +Q +++N +  E +P  T +    +D K +      + 
Sbjct: 468 PTQQIDDIPSQHIDISPHGNSNEQEKRSNSS--EKSPMITQQVNDEKDEKISNAKALKIG 525

Query: 507 NPDNSASSTE----GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPN 562
             ++S   +E     +V+ I+D K+REV RL+S++  VD +ELTEDAIN+  +LAIV+ N
Sbjct: 526 KREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESN 585

Query: 563 DSLIRR-QKIDSAETSRND--QHPPWD-------GRKNFKNFVKVQAKYKEQRMGENYRE 612
            SLIRR +  D+   S N   +H   D       GR+NFK FVKV  KY + +   N   
Sbjct: 586 ASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNER 645

Query: 613 ---GSSDFIRNSGYLLTRQYVPSKIYTK 637
              G+SDFIRN+ +L+TR YVP K Y+K
Sbjct: 646 GDNGASDFIRNNAFLITRNYVPLKQYSK 673

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  252 bits (644), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 213/721 (29%), Positives = 354/721 (49%), Gaps = 117/721 (16%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWD---- 56
           MW+++Y   LEDG+I  +S CL   +T+SIGRSSKNPL IKNDKSISR HI+  W+    
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 57  SEVK--LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114
           S++K   + L+N+G+LT+   K++KVGE+        + +  IIELGT PI++E  W + 
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINAS-DVLKSTIIELGTTPIRIEFEWINE 119

Query: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKF---AYKCLFGLINGAVIR 171
           V+++P  L+QF   L   GI  +  ++++    ++++D  K    + + L+ L++   ++
Sbjct: 120 VWNIPPHLTQFRTMLSEYGISTEI-SINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178

Query: 172 NSQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKF--YLIA 226
            S+FL+E+ N L   SK    F+E W+ +I N  Y ++  +  P+ ++ K  +     + 
Sbjct: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVF--DFDPNILLSKFMRLNNIRVL 236

Query: 227 SDVITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKL 286
           + + +   +   L   N  L   +N + L   +    ++ + ++L    T K    KI L
Sbjct: 237 TTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTT--TDKKENGKI-L 293

Query: 287 HTLVDLVNAVSHNTVKTLL----GGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEH 342
            T+  ++ ++   T+  ++         ++ G  D I     T+ KT             
Sbjct: 294 CTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKT-----------SR 342

Query: 343 TPEHTVTPAEKPPVKRRRYN--RVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTA 400
            PE   +P      K+R+ N  RV PLDSL FFAGG  +    E    T          +
Sbjct: 343 APEVEASPVVS---KKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAES 399

Query: 401 KTSITTQINVPENDASQESSAFDKFQPNIVLKNSAKPLTID--------SPG----DAHN 448
           KT I++  N+ E D        +K  P   L+N+ KP T D        SPG     + N
Sbjct: 400 KTVISSP-NIAEAD--------EKHAP--FLQNALKP-TEDIGKKSGHSSPGAIIVSSPN 447

Query: 449 THEINTANQHVKDIAQQIEMNHP----------------------------ESEQQSEQA 480
              +NT+   +    Q  ++  P                            +  + ++  
Sbjct: 448 LGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAEVTKNF 507

Query: 481 NLNMVETTPRPTARKKTLQDFKSTVNNP--DNSASSTEGL------------VDLIKDAK 526
            +N  +   +P+   + L ++   +++P  +N  S  + L            V+ I++ K
Sbjct: 508 RVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETK 567

Query: 527 SREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSA--ETSRNDQ--- 581
           +REVKR+KST+V++  +EL+E+AINQL +LAIV+P+++L+R+   DS   +TSR  +   
Sbjct: 568 NREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKS-FDSEGNKTSRTTEKWE 626

Query: 582 ----HPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTK 637
                P W  RKNFK FVKV+ K K  +        SSDFIRN+ +L+TR YVP K Y+K
Sbjct: 627 NSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSK 686

Query: 638 E 638
           +
Sbjct: 687 K 687

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  243 bits (621), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 240/806 (29%), Positives = 347/806 (43%), Gaps = 139/806 (17%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y Y+ EDG    +S CL +   + IGRS+K+PL+IKNDKSISR HI +  + E +
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
           L  L+N G+LT    + L V +S++F  K  +R    +ELG KPI   + WQD V+ +  
Sbjct: 61  L-NLLNTGKLTTLNAEVLMVDQSLNFHPKGQLR----LELGIKPIIATIEWQDQVWKVSH 115

Query: 121 QL---SQFI-DTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFL 176
            L   S F     +  GI V   T+  R+   I+         CLF L+ G  I    FL
Sbjct: 116 DLLYNSMFKRQEFNSYGISVTT-TMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFL 174

Query: 177 VEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQ 236
            +  + L    T ++  W +L+Q   +M++P N      I +     ++AS  I   + +
Sbjct: 175 SDFQSHLYMTPTDYDGIWKNLLQ--KHMVFP-NFTTCVSIFQNISI-IVASKSIYNLF-K 229

Query: 237 EALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDK------------- 283
             +E   GEL+  EN E+    +++   + D+I+LK      +  DK             
Sbjct: 230 YTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKL 289

Query: 284 -----------IKLHTLVDLVNAVSHNTVKTLLGGVP-------------PMEAGPGDVI 319
                       KLH + DLV+AV     + LL  +P             P      D  
Sbjct: 290 EELKAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEF 349

Query: 320 GSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGGD 377
            +  P            L N     +  +   +K PVKR+R NR  V+PLDSL FFAGG+
Sbjct: 350 ITPVPDKVSETAPFKGQLENSTARNDFEIM-EQKIPVKRKRTNRSKVRPLDSLDFFAGGN 408

Query: 378 YSTE----EPEQEISTQPVNPAAS----DTAKTSITTQINVP--------------ENDA 415
              +    +  QE     V    S    D  K  +  + NV               EN  
Sbjct: 409 IQAKNEGIQKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEPPRKKPRRKPVKSLENLM 468

Query: 416 SQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNH----P 471
            +E +  ++    I  K +        PG            Q   +      MN     P
Sbjct: 469 IREKTQAEQHNKEIGKKPTGNECANKKPGSED-------KKQKEPEAVPPYAMNEISIIP 521

Query: 472 ESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEG-------LVDLIKD 524
           E   Q EQ+N       PR    +       +    P N+  + EG       LV+ I+D
Sbjct: 522 ERPGQLEQSNNTASANRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQD 581

Query: 525 AKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIR----RQKIDSAETSRND 580
            KSREV RLK+TL+Q+D +ELTE+AIN L +LAIV+  D LIR    R    S++T    
Sbjct: 582 TKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKD-LIRKNSERGHCISSDTCL-- 638

Query: 581 QHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESS 640
               W+GRKNFK F+KVQ + + QR  E +     + ++NS +L+TR+YVP K +     
Sbjct: 639 ----WEGRKNFKKFIKVQPR-RSQR--ETFDSDGKNIVKNSAFLITREYVPLKKFDPNEK 691

Query: 641 KEMQD--FPEASEQTSRQFSVPQVID------DPEDAEPFTFTRHTSGTP---------- 682
           +++ D  F   S       + P+ ID      D E+   F F R  S  P          
Sbjct: 692 EQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTL 751

Query: 683 ------------ANNGLFVVDEDDSQ 696
                       + N LFV DEDD Q
Sbjct: 752 TNGDIEMKETSRSENRLFVTDEDDFQ 777

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  241 bits (615), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 230/793 (29%), Positives = 376/793 (47%), Gaps = 107/793 (13%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MW+L+Y+Y  E G +++VS C+ +   ++IGRSSKN L IKNDKSISR H+S+ W S   
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
            I L N G+LT +  KYL   E + +         I + LG  P+K+ +   D +FD+P+
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSAD---ETQIEMLLGVAPVKIILSRIDELFDIPN 117

Query: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180
            LSQF +TL+ +GI +  D  +  ST++I      F Y+ LF   N   I +S  L E+ 
Sbjct: 118 SLSQFRETLETLGIQISVDNANVNSTSLITVG--DFGYRELFAACNDINIYSSGLLTEIC 175

Query: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIAS-DVITMAYVQEAL 239
           N L      F+  W S+  +    L    L      ++G  F+L+   D   ++Y++  L
Sbjct: 176 NKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFL 235

Query: 240 ERGNGELI-VVENTEQLLDRLKQENSTDDL-IVLKAEETTKIPGDKIKLHTLVDLVNAVS 297
            + + E+   +   + LL RL      D++ IV+  E+   +P D +++H+  D+   + 
Sbjct: 236 LKLSVEIHDSIHKNDDLL-RLISSKQADEIPIVISNEKIKYLPEDTLQIHS-DDIYKFIE 293

Query: 298 HNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVK 357
              +         ME  P   I   +   T   +   +SL+N   T + T T  E    K
Sbjct: 294 SGDLYRNAIRYQSMERKP---IYDLEDETTNAIIPQKRSLAN---TSQPTDTSLESTKKK 347

Query: 358 RRRYNRVKPLDSLMFFAGG---------DYSTEEPEQEISTQPVNPAASDTAKTSITTQI 408
           R R ++V+PL+SL FFAGG         +Y+  +    + ++    +AS T +  I  Q 
Sbjct: 348 RVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQS 407

Query: 409 NVPENDASQESSAFDKFQPNIVLKNSAKPLT-------------------------IDSP 443
           +       + +   D  +P IV ++ A+ ++                         I   
Sbjct: 408 HTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHEN 467

Query: 444 GDAHNTHEINTANQHVKDIAQQI----EMNHPESEQQSE--QANLNMVETTP------RP 491
              +N++  N +   V++   Q      M + +S  ++E  + N   + +T       RP
Sbjct: 468 TMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRP 527

Query: 492 TARKKTLQDFKSTVNNPDNSASSTE-GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAI 550
             + +TL   +   N+P  +    +  +V L++  K  EVKRL ST+V+++  ELTE+AI
Sbjct: 528 NLKSQTLNSLED--NDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAI 585

Query: 551 NQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENY 610
           N+L DL +V+P   LIR +   SA  +   Q   W  RKNFK FVK+  KYK +   ++ 
Sbjct: 586 NKLNDLVLVEPVADLIRTKSDISANNTTQQQ---WKNRKNFKKFVKICPKYKSE---QSS 639

Query: 611 REGSSDFIRNSGYLLTRQYVPSK---IYTKESSKEMQDF-------PEASEQTSRQFSV- 659
            E  S  IR SG +LTR+++ +K   +    S  +  DF       P+A++  S    + 
Sbjct: 640 IESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQIL 699

Query: 660 PQVIDDPEDAEPFTFTRHTSGTPANNG--------------LFVVDED--DSQNDV--VL 701
           P++ D+ E++  F+FTR    T   NG              LFVVD+D  DSQ DV  +L
Sbjct: 700 PEIGDENENS--FSFTR----TAIGNGNNNSANEINNSNQQLFVVDDDFEDSQ-DVGHLL 752

Query: 702 AARESIRPEEAVQ 714
              ++  P + +Q
Sbjct: 753 NKADTTEPPQQLQ 765

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  238 bits (606), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 214/731 (29%), Positives = 341/731 (46%), Gaps = 113/731 (15%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y  ELEDGT+R+VS CL K + +SIGRSSKNPL IKNDKSISR HI++ WD   +
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  ----LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVF 116
               ++ ++NQG+LTA    Y+K  ES  F+++ +    ++++LGTKP+ V + W  + +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETY--STVVVKLGTKPVVVRISWTPIFW 118

Query: 117 DLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLI-NGAVIRNSQF 175
           DL     QF  +++ +GI  +  + + R  ++++ D+     + +F L+     +     
Sbjct: 119 DLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVL 178

Query: 176 LVEVTNI-LSKPTTTFEESWDSLIQNES-YMLYPNNLGPHEVILKGY---KFYLIAS-DV 229
           L EV N+ L+   T F+E W  L ++ S Y +YP        IL+ +   +FY + S   
Sbjct: 179 LSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISH 238

Query: 230 ITMAYVQEALERGNGELIVVENTEQLLDRLKQEN-STDDLIVLKAEETTKIPGDKIKLHT 288
             + Y++  +    G     +  + L+  +K  N +    I LK E+        IK++ 
Sbjct: 239 DDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIYA 298

Query: 289 LVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHT-PEHT 347
           + ++V A+     K L     P   G  +   S +   T +    ++      H  P++T
Sbjct: 299 IKEIVQAILDGNFKNL-----PTHIGRSNT--SRKRNFTDSISHYNEDAQRNSHVHPDNT 351

Query: 348 VT---------------------PAEKP------PVKRRRYNR--VKPLDSLMFFAGGD- 377
            T                       E P      P KRRR  R  VKPLDSL FFAGG  
Sbjct: 352 STLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAGGST 411

Query: 378 --------------------YSTEEPEQEISTQPVNPAASD-----------TAKTSITT 406
                                S E+P +  S   VN A  D           TA  S+++
Sbjct: 412 NPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQSLSS 471

Query: 407 QINVPENDASQESSAF------DKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVK 460
           Q   P  + S ++         D+   N  +K    PL   SP D      I   + +  
Sbjct: 472 Q---PTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSP-DVDTNLLIQPIDSN-S 526

Query: 461 DIAQQIEMNHP-ESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLV 519
           +++Q  E N P ES + ++ ++  + E      +RK      K  V+    S S     +
Sbjct: 527 NVSQ--ETNVPKESMEDNDNSSNTLSEVNRNILSRKSESGPHKFDVSLTKRSKSPA-AFI 583

Query: 520 DLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRN 579
           + ++  K+REVKR+++ +V V   EL+E+AIN+L +L IV+ N +LIR ++ D  + S N
Sbjct: 584 EAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKND-SVN 642

Query: 580 DQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIY-TKE 638
           D    W GR+NFK F KV  ++++            D +RN+ +L+ R YV  K Y  K 
Sbjct: 643 DM---WKGRRNFKKFNKVWPQHRD----------GYDSLRNNAFLIIRNYVELKPYDGKR 689

Query: 639 SSKEMQDFPEA 649
           +  +  DF E 
Sbjct: 690 NDNDSSDFHEG 700

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  226 bits (576), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 231/797 (28%), Positives = 357/797 (44%), Gaps = 123/797 (15%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVW----- 55
           MW+++Y   LEDGTI  +S CL   +++SIGRSSKNPL IK+DKSISR HI++ W     
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 56  -DSEVKLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114
            DS    + LINQG+LT+   K++KVGE+   E  L +     IELG  PI++EV W++ 
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEA-LGVSNSTFIELGATPIRIEVEWKNQ 119

Query: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKF---AYKCLFGLINGAVIR 171
           V+++PS L+QF   L   GI  +  +++   T I+++D         + L  L     ++
Sbjct: 120 VWNIPSHLAQFRTALSQFGISTET-SINEVPTNIMISDYPSSDDNVIRELCALAENIPLK 178

Query: 172 NSQFLVEVTN-ILSKPTT--TFEESWDSLIQNESYMLYPNNLGPHEVILKGYKF--YLIA 226
            SQ LV++ N +LS   T  TF+E W+ ++++  Y ++  N  P  +  K  K     I 
Sbjct: 179 KSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDAN--PDLLFSKFMKLSDITIL 236

Query: 227 SDVITMAYVQEALERGNGELIVVENTEQL---LDRLKQENSTDDLIVLKAEETTKIPGDK 283
           + +    Y+   L R N +L    +   L   +D LK       L  +  +E  +I    
Sbjct: 237 TTISNEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQI---- 292

Query: 284 IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHT 343
             L T   L+ ++  +T+ +++         P +      P     ++SS+  +    HT
Sbjct: 293 --LCTTKCLLTSLIKDTLASVINTKSVSFEAPNN----ETPVRDPEKLSSASKI---HHT 343

Query: 344 PEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG-DYSTEEPEQEISTQPVNPAASDTAKT 402
            E   +P      +R    RV PLDSL FFAGG +       ++I+    +    D+   
Sbjct: 344 IETEASPVIL-KKRRLNRRRVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSV 402

Query: 403 SITTQINVPENDASQESSAFDKFQPNIVLK---NSAKPLTIDSPGDAHNTHEINTANQHV 459
             +  I   E   S  S    K   +I  +   NS   + + SP     +  + T+ + +
Sbjct: 403 ISSPIIGRAEEKHSLISQDTQKVAGDIEKENGHNSTGAIIVSSP----ESDAVRTSKRFL 458

Query: 460 KDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASST-EG- 517
               QQ   N    + Q + A+    ET    +  +       S   +P +S + T EG 
Sbjct: 459 DISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGS 518

Query: 518 ------------------------------------LVDLIKDAKSREVKRLKSTLVQVD 541
                                                V  I+  K REVKR+KST+V+++
Sbjct: 519 HELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELE 578

Query: 542 TDELTEDAINQLGDLAIVQPNDSLIR-----RQKIDSAETSRNDQ---HPPWDGRKNFKN 593
            DEL+E+AINQL  LAIV+ N+ L+R     R    S+ T +         W  RKNFK 
Sbjct: 579 DDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKT 638

Query: 594 FVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYT---------KESSKEMQ 644
           FVK   K+K Q+ G       SDFIR + +L+TR YVP K Y+         KE S +M 
Sbjct: 639 FVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMH 698

Query: 645 DFPEASE--------------------QTSRQFSVPQVIDDPEDAEPFTFTRHTSGTP-A 683
              E  +                    QT R F      D+ E+ + F+F+R +   P A
Sbjct: 699 ALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFISEDSSDNGEE-DSFSFSRGSDAAPNA 757

Query: 684 NNG---LFVVDEDDSQN 697
             G   LF+ D++ + N
Sbjct: 758 QPGTIKLFITDDNGNDN 774

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  204 bits (519), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 208/783 (26%), Positives = 338/783 (43%), Gaps = 111/783 (14%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y Y   +G    VS CL +   +SIGRS+KNPL IK+DKSISRNH+ +  D    
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  LI-RLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119
           ++ R++  G+LT   GK +K G+ + F       E ++ E+G  PIK  VV Q   + +P
Sbjct: 61  VVLRVV--GKLTKVSGKSVKAGQHLQFTAD----EEVLFEMGASPIKATVVKQQSFWKIP 114

Query: 120 SQLSQFIDTLDHVG-IGVKADTVDNRSTTI-IVTDKIKFAYKCLFGLINGAVIRNSQFLV 177
             LS       H+    ++     + +T+I I+ D  K    CLF LI    I    F+ 
Sbjct: 115 HDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIG 174

Query: 178 EVTNILSKPTTTFEESWDSL-IQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQ 236
           +    ++     F+  WD + ++N  +  Y     P   I      + + ++    A  +
Sbjct: 175 DFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTI------HFLVTNRRAFAIFK 228

Query: 237 EALERGNGELIVVENTEQLLDRLKQENSTDDLIV-------------------LKAEET- 276
             ++ G+G L + ++   L   +K + ++D++I+                   L  +E  
Sbjct: 229 HIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAK 288

Query: 277 ---TKIPGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSS 333
               K      ++H + D+V AV  +  + LL  VP         + S  PT    E ++
Sbjct: 289 LLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRN------LPSKAPTGFPLEEAT 342

Query: 334 SQSLSNKEHTPEHTVTPAEKPPVKRRRYNR-VKPLDSLMFFAGGDYSTEEPEQEISTQPV 392
           ++S+     TP        KP  KR+R NR V PLDSL FF GG  S  E +Q  +  P 
Sbjct: 343 NKSVIKSADTP--------KPSNKRKRTNRQVVPLDSLAFFGGG--SAAESKQNPTEVPE 392

Query: 393 NPAASDTAKTSITTQINVPENDASQESSAFDKFQ----PNIVLKNSAKPLTIDSPGDAH- 447
           +    +T++ + T      E + S + +     +    PN+  +   +P+       A  
Sbjct: 393 SERGHETSQNTTT---EFAEGEPSPKKARIGALRKPDIPNVSEERVKEPVVQTRSKRASE 449

Query: 448 ---NTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQD---F 501
              +T  +  AN        Q    H   E  +   N   +E+ P P  +  +L +    
Sbjct: 450 RSADTSILVQANPKRSRKTLQASEGHTILENDNNSLN---IESGPLPKTKSTSLGNEAAQ 506

Query: 502 KSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQP 561
                     A         +K+ KS EV RL+  +V V ++ELTE+AIN+L  LA+V+ 
Sbjct: 507 AQADAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVET 566

Query: 562 NDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNS 621
            D  + R   + A   ++     W GRKNFK FVK+       R   N  + +++ +RN 
Sbjct: 567 KD--LMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWP----SRSSRNSPDSATNALRNR 620

Query: 622 GYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQF-----SVPQVID------DPEDAE 670
            +L+TR+YVP + Y  +++    D    + Q   Q      S+P V        + +D  
Sbjct: 621 AHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATCPSIPPVSSTTILGVEVDDEP 680

Query: 671 PFTF------------------TRHTSGTPANNG---LFVVDEDDSQNDVVLAARESIRP 709
            F F                   +HTS    +N    LFV DE+DSQ D V    ++++ 
Sbjct: 681 AFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFVFDEEDSQRDHVDTYTDAVQS 740

Query: 710 EEA 712
             A
Sbjct: 741 RSA 743

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  186 bits (472), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 205/771 (26%), Positives = 345/771 (44%), Gaps = 141/771 (18%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSK-NPLNIKNDKSISRNHISVVWDSEV 59
           MWIL+Y+YE ED     VS CL + + +SIGRSSK N L IKNDKSISR HIS  W S  
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSH- 59

Query: 60  KLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119
             + ++N G+LT     +LK  E+      +   +   I++G+ P+ V +VW+DV  D+ 
Sbjct: 60  DYVDIVNDGKLTYINDAFLKPKETTRI--SISASKETNIKVGSAPVIVNLVWEDVFIDM- 116

Query: 120 SQLSQFIDTLDHVGIGVKADT-----VDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQ 174
           + +S    +L  +GI     T      D   T  I   +IK+ ++ L  LI GA   N  
Sbjct: 117 TPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQ-LIALIRGA---NRL 172

Query: 175 FLVEVTNILSKP-------TTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIAS 227
           +  ++ +++++         ++F+E W+  + +  Y  YP N        + +      +
Sbjct: 173 YKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYP-NFKVDRNSFRDFTIIYFDN 231

Query: 228 DVITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEE-TTKIPG----D 282
           +   ++ V+  +E   G L+   N E          +  ++++L++E      P     +
Sbjct: 232 NDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILN 291

Query: 283 KIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTK--TEVSSSQSLSNK 340
           KI + +      AV+ N V TL+                H+    +  T+++  +    K
Sbjct: 292 KIDICSTGSFFKAVTENNVSTLV----------------HRELFLRRYTDITQKEMRRPK 335

Query: 341 EHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQE----ISTQPVNP 394
           E   +  V      P+K+RR NR  V+PL+ L FFAGGD +T   +       +T+ V+ 
Sbjct: 336 EPVEDTAV------PLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSDDGLAATKAVDE 389

Query: 395 A-ASDTAKTSITTQINVPENDASQESSAFD-KFQPNIVLKNSAKPLTIDSPGDAHNTHEI 452
              SD    S     N   N+  Q++ A   K  P  +L+ +A  L+ + P    ++H +
Sbjct: 390 TEVSDKMHGSGDVLSNSTNNN--QDTVATQGKISP--ILEMNA--LSAEVPKGDESSHVV 443

Query: 453 NTANQHVKD--IAQQIEMNHPESE-----QQSEQANLNMVETTPR--------------- 490
                + KD  +   +E+N    E     +++ Q+++N    TP+               
Sbjct: 444 EPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKEPVAEMEDELEEVDE 503

Query: 491 ---PTARKKTLQDFKSTVNNPDNSASS---------------TEGLVDLIKDAKSREVKR 532
              PT  K + +   S +  P++ A S               +  LV+ I+  K  E +R
Sbjct: 504 VDEPTHLKASRE--ASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNETRR 561

Query: 533 LKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETS-RNDQHPPWDGRKNF 591
           L+ TL  VD  ELT++AI    ++AIV+P  +++R++     E+S R+D       R NF
Sbjct: 562 LQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIRSD-------RPNF 614

Query: 592 KNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSKEMQDFPEASE 651
           K F+KV  K ++           +D +RN+ YL+TR YVP K Y +   K   +F    E
Sbjct: 615 KKFMKVWPKARK----------GNDSLRNNAYLITRDYVPMKAYNRNEPKVFDEF----E 660

Query: 652 QTSRQFSVPQVIDDP--------EDAEPFTFTRHTSGTPANNGLFVVDEDD 694
             ++   +P +I+ P         D  P    +  S     N LFV ++ D
Sbjct: 661 NVTKAGILPDIIEPPIQPSQSLNHDTPPLLDDKAVS----ENELFVAEDSD 707

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  183 bits (464), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 193/776 (24%), Positives = 337/776 (43%), Gaps = 114/776 (14%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWIL+Y Y  E G+  RVS CL K   + +GRS K+PL IK DKSISR H+ +      K
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
           L  ++N G+LT  GG  +K+ + ++F       + + +E+G  P+K  V ++  ++ +P 
Sbjct: 61  L-EVLNAGKLTKIGGDNVKMDQMLEFGAD----QSVALEMGAGPVKGTVTYEPAIWKIPH 115

Query: 121 QLSQFIDTLDHVG---IGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLV 177
            L+      +H+    I V  +++ ++++  I+ +  K    CLF L+    I    F+ 
Sbjct: 116 DLAITESLKNHLSLYDIQV-TNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIG 174

Query: 178 EVTNILSKPTTTFEESWDSL-IQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQ 236
           +  +  +     F+  W+ + ++N  ++     L   +   KG  F  + ++  T A  +
Sbjct: 175 DFVSQFADTQIDFDAKWEQITLKNAPFL----ELQTKDAAFKGLNF--VVTNQKTFAIYK 228

Query: 237 EALERGNGELIVVENTEQLLDRLKQENSTDDLIVL--KAEETTKIPGDK----------- 283
             ++ G+G L +  +   L   ++++  ++++++L    EE   +  ++           
Sbjct: 229 SIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKL 288

Query: 284 ---------IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSS 334
                     K   + D+V+AV  N + +LL  VP  +A   +  G          ++ S
Sbjct: 289 LKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGG--------SIAGS 340

Query: 335 QSLSNKEHTPEHTVTPAEKPPVKRRRYNR-VKPLDSLMFFAGGDYSTEEPEQEISTQPVN 393
           Q L++        V  A     KR+R NR ++PL+SL FF GG   +++ EQ +ST    
Sbjct: 341 QVLAD-------IVADAPNLRNKRKRANRQIQPLNSLAFFGGGSSLSQKLEQ-VST---- 388

Query: 394 PAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAH------ 447
           PA     +  +   + V  N      S   + + N +        T  S    H      
Sbjct: 389 PAKEQNLE--LQEGLGVHTNPEVHPLSKKPREEKNTLHSAGNNSTTTFSETPIHQEDVQI 446

Query: 448 NTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNN 507
            +  +N +  H   I+++ E  H +   ++   +     T   P+  K  L+  ++  N 
Sbjct: 447 GSEPLNHSAAH-SVISKEDESTHTDERNKTLVNSAKDARTVTFPSIHKNELKSSRTLSNE 505

Query: 508 P----DNSASSTE--------GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGD 555
                + S + TE         L+   ++AK  EV RLK  +  V ++ELTE+AIN+L +
Sbjct: 506 AKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDN 565

Query: 556 LAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSS 615
           LA V+  D + R  ++      R   +P W  RKNFK FVK+   +  +   +N     +
Sbjct: 566 LASVEKVDLMRRPSEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNI----T 621

Query: 616 DFIRNSGYLLTRQYVPSKIYTKESSKEMQD-FPEASEQ---------TSRQFSVPQVIDD 665
           D +RN  YL+TR YV    Y    +    D F +A +Q         T+   ++  +  +
Sbjct: 622 DAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASPGNLALLGVE 681

Query: 666 PEDAEPFTFTRHTSGTPANNG--------------------LFVVDEDDSQNDVVL 701
            E+   F F    +     N                     LFVVDEDDSQ  V  
Sbjct: 682 VENGPAFAFQSQRAANSQANSLFNETDNRRVEERSPERNQELFVVDEDDSQPQVAC 737

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  163 bits (412), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 120/394 (30%), Positives = 203/394 (51%), Gaps = 37/394 (9%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MW+++Y   LEDG+I  +S CL   +++SIGRSSKN L IKNDKSISR H++  W+    
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  L------IRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114
           L      + L+NQG+LT+   K++KVGE+        +     IELGT PI+++  W D 
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTI-SVTKVSNHTEIELGTTPIRIKFEWIDE 119

Query: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTD---KIKFAYKCLFGLINGAVIR 171
           ++++PS L+QF   L   GI  K  ++D+ S +I+++D         + L+ L++   ++
Sbjct: 120 IWNIPSNLAQFQTILSQFGIATKT-SIDDDSASILISDFPSNNDDGMRELYALVHTIPLK 178

Query: 172 NSQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASD 228
            SQ LV++ N L   S     F+E+W++++    + ++  +  P  +  K    ++   +
Sbjct: 179 KSQLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVF--DYDPSVLFSK----FMRLDN 232

Query: 229 VITMAYVQEA------LERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGD 282
           VIT+  +         L R N  L   +    L   +     ++  ++L     T    +
Sbjct: 233 VITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTF---TNKREN 289

Query: 283 KIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEH 342
             KL TL +L+ ++  +T+ +++      +A P +V  ++ P   +       ++S   H
Sbjct: 290 GQKLCTLQNLITSIIDDTLPSVIN----TKAVPFEVQENNTP---EKVFEGHTAISKTVH 342

Query: 343 TPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG 376
           TPE   TPA     +R    RV+PLDSL FFAGG
Sbjct: 343 TPETEATPAVL-KKRRLNRRRVQPLDSLNFFAGG 375

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 82/130 (63%), Gaps = 8/130 (6%)

Query: 517 GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIR--------R 568
             V+ I+  K+REVKR+KST+V+++ DEL+E+AINQL +LAIV+P++ L+R        R
Sbjct: 575 SFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNR 634

Query: 569 QKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQ 628
            +  +  + +      W  RKNFK F KV    K  + G+     +SDFIR++ +L+TR 
Sbjct: 635 TRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRN 694

Query: 629 YVPSKIYTKE 638
           YVP K Y+K+
Sbjct: 695 YVPLKKYSKK 704

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  160 bits (406), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 200/409 (48%), Gaps = 38/409 (9%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVW-DSEV 59
           MWI+ Y+Y+  D T+  VS CL + +T+SIGRS K+PL +KNDKSISR H++  W  +  
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 60  KLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119
             + L+NQG+LT    + L   E++ F     I  P  +ELG  P+ V   W + V+++P
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNAD--IEHPAEVELGATPVVVCGAWTNHVYNIP 118

Query: 120 SQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIK------FAYKCLFGLINGAVIRNS 173
            +  QF   L   G  +      N + T ++  + +       +    + L+N ++I  S
Sbjct: 119 IEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKS 178

Query: 174 QFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPN-NLGPHEVILKGYKFYLIASDVITM 232
            FL  + N+L+   TTF   + +L+       + N NL   +V L G K  ++  +   +
Sbjct: 179 SFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTDL 238

Query: 233 AYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDL 292
            Y   A+E  N   I  E+    ++ +K   S + LI+L    +  I  + IK+HT  D 
Sbjct: 239 IYFIAAMEVINLPTITTEDDTIFINTVKSH-SEERLILLTTSNSRHI--ETIKVHTFKDF 295

Query: 293 VNAVSHNTVKTLLGGVPP-----MEAGPGDVIGSHQPTLTKTEVS---------SSQSLS 338
              + +  +  L+  +       +E    + I  +    T +++S         +S ++S
Sbjct: 296 YQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNNKVNSNTIS 355

Query: 339 NK--EHTPEHTVTPA------EKPPVKRRRYN--RVKPLDSLMFFAGGD 377
           +   + T E  + P+      EKPPVKRRR N  RV+PLDSL FF GG+
Sbjct: 356 DSLLKQTSE-LIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGN 403

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 138/270 (51%), Gaps = 39/270 (14%)

Query: 459 VKDIAQQIEMNHPESEQQSEQANLNMVETTPRP----TARKKTLQDFKSTVNNPDNSASS 514
           + D A+  +++   ++QQ E+  L+      +P     + K++ +  K TV+ P   + +
Sbjct: 547 MSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVS-PVKRSPT 605

Query: 515 TEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSA 574
               +  ++DAK+RE  RL S  V++  +ELTE+AIN+  +LA+V+ N  ++  +   + 
Sbjct: 606 PNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNN 665

Query: 575 ETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRM--GENYREGSSDFIRNSGYLLTRQYVPS 632
           E S  D  P W GRKNFKNFVK   KY+ + M  G+N   G + FIRNS +LL R+YVP 
Sbjct: 666 E-SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDN---GVASFIRNSAFLLAREYVPM 721

Query: 633 KIY-TKESSKEMQDFP----EASEQTSRQF--------SVPQVI--DDPEDAE-PFTFTR 676
           + +        +Q+FP    E S Q + Q         ++ Q    DD E  E  F+F+R
Sbjct: 722 QEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFSR 781

Query: 677 ------------HTSGTPANNGLFVVDEDD 694
                       H + T   N LFV ++DD
Sbjct: 782 ASGGDINNNVYPHITKTTKGNSLFVTEDDD 811

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 190/795 (23%), Positives = 338/795 (42%), Gaps = 131/795 (16%)

Query: 1   MWILKYTYELEDG--TIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSE 58
           MWI K  Y+ +    T+  +SS +   + + +GR+SK+ L I +++ +SR H+ +  +  
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  VKLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDL 118
           +  I L+  G     G K ++ G S +F  K   + P+ +E+G+  I+ +++W    F +
Sbjct: 60  IIEITLL--GAQLKIGHKTIEKGISCEFHPK---QSPLRLEVGSHSIECKLLWTQWEFKV 114

Query: 119 PSQLS----QFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAY-KCLFGLINGAVIRNS 173
           PS L             +GI +        S  I+ + + +  Y K LF L+ G  +   
Sbjct: 115 PSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEV 174

Query: 174 QFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMA 233
            FL  ++++L+  T  FE     L     + ++P    P    LKG   Y I  +     
Sbjct: 175 GFLKGISSLLNSDTLKFESKVKEL--EREFSIFPE-FNPIPNPLKG--LYFIVPEKDEFD 229

Query: 234 YVQEALERGNG---------------------ELIVVENTEQLLDRLKQENSTDDLIVLK 272
            ++  +E G G                     ++I+++ +  +   +  +  TD  I+L+
Sbjct: 230 ILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLE 289

Query: 273 AEETTKIPGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTL---TKT 329
              +        +  T+  L N      + + +     +     D + +   +L    K 
Sbjct: 290 KAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKV 349

Query: 330 EVSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG--DYSTEEPEQEI 387
            VS++  L+             E PP K+RR N VKPLDSL FFAGG  + ST       
Sbjct: 350 NVSATSGLN----------LNTEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSS 399

Query: 388 STQPVNPAASD-TAKTSITTQINVPENDASQESSAFDKFQPNIV--LKNSAKPLTI---D 441
             Q V PA  +  A+TSI +   +P     +E +       ++V   +N  +P+      
Sbjct: 400 EKQTVQPAEHNKIAETSIASIELLPTKSGIKEIT-------DVVPETENEPEPMVSPKKR 452

Query: 442 SPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNM-VETTPRPTARKKTLQD 500
           SP    +  ++   + HV  I   +E+     E+ +E ++  + VE            Q 
Sbjct: 453 SPAKNESLADMRAGDNHV-SIKTTLEV-----EKSAEPSHKKLKVEGIFDEKVEMSNEQK 506

Query: 501 FKSTVNNPDNSAS--STEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAI 558
           +     + D++ S  S   +V+ IK+ K REV R+K+T+V++  DELTE+AI +L  LA+
Sbjct: 507 YHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAV 566

Query: 559 VQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFI 618
           V+  D ++R+ +    +T  N +H     R+NFK FVKV   Y  + + ++   G+  + 
Sbjct: 567 VESVD-MLRKTQSRHMKTETNKRH---HVRRNFKRFVKVWPAYLNKAICQDPM-GAQRY- 620

Query: 619 RNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQ---------------------- 656
                   RQ VP K+Y   +  E+ D     E +S +                      
Sbjct: 621 ------SNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNETFTSDPLDHNIQMAS 674

Query: 657 FSVP------------QVIDDPEDAEPFTFTRHTSGTPA-----NNGLFVVDEDDSQNDV 699
            S+P            QV+ +PE    F+  R+++ + +      N LFVV+++   N  
Sbjct: 675 KSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGNSLFVVEDESDDNTA 734

Query: 700 V----LAARESIRPE 710
           V    L+A  + R E
Sbjct: 735 VTYHNLSATSATRTE 749

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  132 bits (331), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 202/760 (26%), Positives = 354/760 (46%), Gaps = 133/760 (17%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVW----D 56
           M IL+Y   L DG +  VS CL+    ++IGRSSKN   IKNDKSISR H+S++W    D
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 57  SEVKLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVF 116
            +  +I++ N G++T    KYL   E++ F     I + + + +GT PI +E+  Q+VV 
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQF---TLIDKKLEVNIGTSPITLEIFNQEVVC 117

Query: 117 ----DLPSQLSQFIDTLDHVGIGVKAD--TVDNRSTTIIVTDKIKFAYKCLFGLINGAVI 170
               D+ +  S+ I  L+++ I ++ D  T+     TII+ +    +Y            
Sbjct: 118 NSIEDIQNSDSKLI--LNNLNI-LQDDPLTLKREGPTIIIKEN---SY------------ 159

Query: 171 RNSQFLVEV-TNILSKPTTTFEESWDSLIQNESYMLY------PNNLGPHEVILKGYKFY 223
             +  L+E+ +N+   P  T EE       N+ Y  +        N G   ++     +Y
Sbjct: 160 --TDILLELFSNVFGIPIVTIEELRGIANANDFYSYWDKIYSRKKNKGKACMLDLSTCYY 217

Query: 224 LIASDVITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDL---IVLKAEETT--K 278
           +   D   + YV+ A+   N E+ ++++ + L+  +++  S  ++    VL  + T   +
Sbjct: 218 ISEVDKY-VDYVKVAIRSLNAEIKILKDKDDLVKDIRKNISKGNISKFFVLSNDITQGEE 276

Query: 279 IPGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLS 338
            P + I + ++  L+ AV  N +K ++                H  +  K E+       
Sbjct: 277 APFN-ISVTSIAKLLEAVKTNNMKDIVM---------------HDYSSFKIEIPREV--- 317

Query: 339 NKEHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAA 396
            K    ++ +   E P  KRRR NR  VKPLD+L FFAGG          I+T+P N   
Sbjct: 318 -KSPKDDNIIEKQEPPAPKRRRMNRSKVKPLDTLSFFAGG---MSHDTHSINTKPSNDVQ 373

Query: 397 S--DTAKTSITTQI-NVPENDASQESSAFDKF----QPNIVLKN---------SAKPLTI 440
           S  +T K    ++I ++ + +++Q+ + +DK     +   V KN         + KP+  
Sbjct: 374 SHQETEKDVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSKNADDKLQDSTAEKPINF 433

Query: 441 D------SPGDAHNTHEINTANQHVKDIAQQIEMNHP-----------ESEQQSEQANLN 483
           +      S   + N   I  +N ++    ++  +N             +++  +EQ N  
Sbjct: 434 NPTTKTPSFSPSINDKAIENSNANLDPTMEKTRVNKKPASLDTKNNLLDNKLIAEQINEA 493

Query: 484 M-VETTPRPTA-RKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVD 541
           +  +T   P   R++TL D+ +T        SS+  LV  I++ KSR V R+ S +V VD
Sbjct: 494 LSAKTNDAPVVRRRRTLLDYGNT------DKSSSTDLVRTIQNVKSRGVDRVNSKIVTVD 547

Query: 542 TDELTEDAINQLGDLAIVQPNDSLIRR----QK-IDSAETSRNDQHPPWDGRKNFKNFVK 596
            +EL E+ +N+  D+ +V  ND L+++    QK ID+A     D +  +  RK++K F K
Sbjct: 548 ENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANI---DHNSNFKNRKDYKLFKK 604

Query: 597 VQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTK-ESSKEMQDFP-EASEQTS 654
              K+ + ++ + +   +SD   N      R  +P + Y + E   E   F  E+S++T 
Sbjct: 605 SIPKW-QSKLNKQHHSMTSDNGENLVVSKNRNKIPLRKYNENEKIHEADIFEFESSKKTE 663

Query: 655 RQFSVPQVIDDPE------DAEPFTFTRHTSGTPANNGLF 688
              S+P+  ++ E      +A   TF+ ++S    NN LF
Sbjct: 664 NPESLPKNNNEMEEKEREINAHTLTFSENSS----NNKLF 699

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 177/375 (47%), Gaps = 55/375 (14%)

Query: 354 PPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQ---- 407
           P  K+RR NR  VKPLDSL FFAGG  S    +  +  +  N       K  I +Q    
Sbjct: 346 PQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANNITRKKDKEVIKSQGKGE 405

Query: 408 INV-PENDAS------QESSAFDKFQPNIVLKNSAK--------PLTIDSPGDAHNTHEI 452
           IN+  E D S        +S F K + ++  K   +        P  I  P    N    
Sbjct: 406 INIETEMDESGNGELLSTASEFKKPKSDVQHKLEKRMQVAIDRSPEKIKKPKLEENISIQ 465

Query: 453 NTANQHVKDIAQQ----IEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNP 508
              +  VK  +      IE       Q ++++N   +E       R+KTL D+K T +  
Sbjct: 466 QLLSNKVKSTSDTSSVLIET------QIAKESNTKAIEYGK---VRQKTLTDYKHTSDER 516

Query: 509 DNSASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRR 568
               S    LV  I+D K RE  R+K+++V++  +ELTE+AIN+  DL +V  N  L + 
Sbjct: 517 IERPSV--DLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKD 574

Query: 569 QKIDSAETSRNDQHP-PWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTR 627
           + +D  + + ++Q+   W G+KNFK FVK+  KYK  +    + +  S FIRNS  L+TR
Sbjct: 575 KSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITR 634

Query: 628 QYVPSKIYTK----ESSKEMQDFPEAS------EQTSRQFSVPQVIDDPEDAEPFTFTRH 677
            +VP K Y+K     +S EM DF          E+    +S    +D+P     FTFTR+
Sbjct: 635 NFVPMKQYSKLDNNSNSNEMTDFSNIEVNKKPVEKNREAYSSDDSVDEP----SFTFTRN 690

Query: 678 TSGTPANNGLFVVDE 692
           +S       LFV+DE
Sbjct: 691 SSSKQ----LFVMDE 701

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 135/252 (53%), Gaps = 24/252 (9%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MW+L+Y Y L+DG++ ++S C+  ++T+ +GRSSKN L+++NDKSISR  IS+ WD +  
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
            I + N G++T    +YL  GE++ F+ K    + + +++GT PI V + W+        
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSK---NDLVTMKIGTTPIVVNLSWE-------V 110

Query: 121 QLSQFIDT-LDHVGI----GVKADTVDNRST--TIIVTD--KIKFAYKCLFGLINGAVIR 171
           +   ++ T +D V +    G +  T++N  +   II  D   I   Y   + +I+  ++ 
Sbjct: 111 KRCNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILI 170

Query: 172 NSQFLVEV--TNILSKPTTTFEESWDSLIQNESYML-YPNNLGPHEVILKGYKFYLIASD 228
           NS+ L ++   NI+   T  F+  W  L  +ES +  +  N+      LKG   +L+  +
Sbjct: 171 NSKTLRDILTNNII--MTKKFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPE 228

Query: 229 VITMAYVQEALE 240
                Y ++ LE
Sbjct: 229 SYNCEYFEKFLE 240

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 110/406 (27%), Positives = 180/406 (44%), Gaps = 55/406 (13%)

Query: 1   MWILKYTYELED--GTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISV-VWDS 57
           MW+ K  Y+     G ++ +S  L  ++ F +GR+SK+ L I+ +K +SR H+ + V D 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59

Query: 58  EVKLIRLINQ---GRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114
            V ++ L +Q   G   A+ G  L  G S         + P+I+E+G+  ++  + W   
Sbjct: 60  HVNILLLGSQLKVGGEDASKGSVLPFGPS---------QSPVILEVGSHSVQCILEWAQW 110

Query: 115 VFDLPSQLSQFIDTLDHV--GIGVKADTVDNRSTT--IIVTDKIKFAY-KCLFGLINGAV 169
            F +P+ L Q    L  V  G+G++  T  +++TT  II   +    Y K LF L+ G  
Sbjct: 111 EFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIP 170

Query: 170 IRNSQFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDV 229
           I + +FL + T +L +P T F+    S IQ + Y             L G  F +     
Sbjct: 171 ILHLEFLKQFTALLRQPVTDFDPQLRS-IQEQHYAF--RGFTKKAADLNGLHFIVNRKHD 227

Query: 230 ITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLK-----AEETTKIPGDK- 283
             M  ++  LE G G +    +   L   LK     +  + LK     + E  K+   + 
Sbjct: 228 FEM--LKYTLEIGGGTVHFCHDINDLSACLKT-IPINGALALKYDHGISAEVKKVDDTRY 284

Query: 284 --------IKLHTLVDLVNAVSHNTVKTLLGGVPP-----MEAGPGDVIGSHQPTLTKTE 330
                   I+L T+ +L  A+ ++ +  LL   PP     +E  P  +  + +    K E
Sbjct: 285 CEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQE---MKQE 341

Query: 331 VSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG 376
             S  SL N       T+    +    R+R  + +PLDSL FFAGG
Sbjct: 342 SLSPISLGNT------TIKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 13/120 (10%)

Query: 516 EGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAE 575
           + +VD IK  K REV R+++T+V++  +ELTEDAI QL  LAIVQP D L ++  +D+  
Sbjct: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVG 656

Query: 576 TSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIY 635
           +S     P    RKN+KNF KV  KY  ++        +S   RN+  +  R+Y+P ++Y
Sbjct: 657 SS-----PLTFARKNYKNFKKVWPKYMNRK--------NSPETRNATAISNRKYLPLELY 703

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 110/461 (23%), Positives = 200/461 (43%), Gaps = 83/461 (18%)

Query: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60
           MWI+ + ++ E     +V   L     +SIGRS+K    I+ DKSISR H+ + +D    
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60

Query: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120
           +I   N+G+LT    + + + E++         +  +I +G  PI V V +    + +P 
Sbjct: 61  II--TNKGKLTKFNEEIIPLDETIVVHN-----QNTVINIGGMPIDVNVRYFYEEWKIPH 113

Query: 121 QLSQFIDTLDHVG-IGVK-ADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVE 178
           +L +  +T   V   GVK +++   ++TT I +D   ++  CLF L+ G  + + +FL +
Sbjct: 114 RL-ELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYS-GCLFALLKGVPVVSIEFLNQ 171

Query: 179 VTNILSKPTTT-FEESWDSLIQNE----SYMLYPNNLGPHEVILKGYKFYLIASDVITMA 233
           +  +L +     F+  +  L+       SY   PN L    +I+   K Y       T+ 
Sbjct: 172 MGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMY------DTLR 225

Query: 234 YVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKA------EETTKI--PGDK-- 283
           Y    +E G G+  ++ N+ +L D+    N    +++  +       E+TK+    DK  
Sbjct: 226 YT---IEVGGGDAKLLANSSEL-DKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSI 281

Query: 284 --------IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPT-LTKTEVSSS 334
                   +KL  +   VN +  N +  L            DV+    P+ + + ++ S+
Sbjct: 282 AETSLRHGVKLLNINQFVNILLENKINGL---------KKRDVVDLTSPSPVQQKKIQSA 332

Query: 335 QSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNP 394
           ++  N + T         KP         ++ LDSL FF GG+    + E++       P
Sbjct: 333 KASVNGKKT-------KSKP--------NIQSLDSLNFFGGGNLEVTQNEEK-----HEP 372

Query: 395 AASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKNSA 435
             S T+++ +  +         +ES AF  +  N  L  SA
Sbjct: 373 VISHTSESKVKVK---------EESKAFVPYNDNQDLDTSA 404

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 103/228 (45%), Gaps = 31/228 (13%)

Query: 338 SNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTE-EPEQ---EISTQPVN 393
           +N+ HT        E   V+R+R  RV+ LD+LM  +    +T+ EP+    ++  + + 
Sbjct: 429 ANQPHTSTKKDDRTELQKVRRKR-PRVQQLDNLMMRSSSQQATQIEPDDRNDKLKLRRIG 487

Query: 394 PAASDTAKTSITTQINVPENDASQESSAFDKFQ-PNIVLKN-SAKPLTIDSPGDAHNTHE 451
             AS+     +     +P N  S   +     + P+I  KN +   +++  PG A +   
Sbjct: 488 DTASNVNAEGV-----LPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEH--- 539

Query: 452 INTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRP--TARKKTLQDFKSTVNNPD 509
           ++     + D  + I+    +S  + EQ   NM E   RP   AR +T    +S+ N   
Sbjct: 540 VSAKKNLISDGGKSID---AQSSNRIEQNMGNMTELDSRPHSVARLETDLQVRSSTN--- 593

Query: 510 NSASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLA 557
                   ++  I + K +EVKRL+  +++VD  ELTE A+    D A
Sbjct: 594 --------IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAA 633

>KNAG0K01590 Chr11 complement(329918..332941) [3024 bp, 1007 aa]
           {ON} Anc_3.224 YBR038W
          Length = 1007

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 8/83 (9%)

Query: 465 QIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKD 524
           + E+NHP       +AN    E+  RP     TL+     ++NP        GL+D +  
Sbjct: 250 RFELNHPVRRDYVRRAN---SESKRRPQPHDPTLKKAMLKLDNP-----IPRGLLDTLPR 301

Query: 525 AKSREVKRLKSTLVQVDTDELTE 547
             S E   ++ T   VD+DE  E
Sbjct: 302 RDSPEFTEMRYTACTVDSDEFLE 324

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 54  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 109

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 110 EAATLFKDYKSQYVKRVKETV 130

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 54  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVSSILTSIQSLFNDPNPASPANV 109

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 110 EAATLFKDHKSQYVKRVKETV 130

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 129/321 (40%), Gaps = 36/321 (11%)

Query: 117 DLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGL-INGAVIRNSQF 175
           +L  QL++F+ +L  + I ++  T+D R     + + I   Y+   GL +N +       
Sbjct: 246 ELVPQLTEFLLSLPRLPIFLETTTLD-RQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNG 304

Query: 176 LVEVTNILSKPTTTFEESWDSLIQNESY----------MLYPNNLGPHEVILKGYKFYLI 225
           +  +  +L        + W   ++  SY          M + N+L  +EV   G KF L 
Sbjct: 305 IERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLK 364

Query: 226 ASDVITMAYVQEALE-RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI 284
              +I   +    +  +  G ++ VEN          ENS   + +++ E+   +  D  
Sbjct: 365 REKIIHELFAHNVVTLKDTGGMVYVEN----------ENS---VFIMEDEDLISVNQDSQ 411

Query: 285 KLHTLVDLVNA--VSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEH 342
           +  T +       V     +    G+ P++   GD++     +  K + +SS S ++ + 
Sbjct: 412 ESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKR 471

Query: 343 TPEH-----TVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAAS 397
           T E      T+TP +K  VK+   NR + L        G+      E ++S +   P+ S
Sbjct: 472 TGERASLSDTITPTKK--VKKVGENRSR-LSGSESVEQGNSEANRDEYDLSEEIPGPSTS 528

Query: 398 DTAKTSITTQINVPENDASQE 418
             A  + +      END S E
Sbjct: 529 FFATVNHSRTARADENDISIE 549

>TBLA0H02200 Chr8 complement(531667..536124) [4458 bp, 1485 aa] {ON}
           Anc_5.174 YGR170W
          Length = 1485

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 350 PAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTAKTSITTQIN 409
           PA K P++R  +N  +P    +    G+ S +         P++P  +  A T       
Sbjct: 179 PARKHPIRRFSHNHSRPKYPYL----GNKSNKS--SSTLAVPISPIVTSIATT------- 225

Query: 410 VPENDASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEIN 453
              +D+   +S  D+  PN+     + P+ I SP +A++T  ++
Sbjct: 226 ---DDSVDPTSNIDRLSPNVYSSPPSTPINIQSPTNAYSTSNLS 266

>Suva_4.270 Chr4 (477714..480599) [2886 bp, 961 aa] {ON} YBR038W
           (REAL)
          Length = 961

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 465 QIEMNHPESEQQSEQAN----LNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVD 520
           + E+NHP  +Q   +AN      MV   P P+ +K  L+     ++NP        GL+D
Sbjct: 198 KFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLK-----LDNP-----IPRGLLD 247

Query: 521 LIKDAKSREVKRLKSTLVQVDTDELTEDA 549
            +    S E   ++ T   V+ D+  ++ 
Sbjct: 248 TLPRRNSPEFTEMRYTACTVEPDDFLKEG 276

>Skud_2.150 Chr2 (281578..284469) [2892 bp, 963 aa] {ON} YBR038W
           (REAL)
          Length = 963

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 465 QIEMNHPESEQQSEQAN----LNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVD 520
           + E+NHP  +Q   +AN      MV   P P+ +K  L+     ++NP        GL+D
Sbjct: 200 KFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLK-----LDNP-----IPRGLLD 249

Query: 521 LIKDAKSREVKRLKSTLVQVDTDELTEDA 549
            +    S E   ++ T   V+ D+  ++ 
Sbjct: 250 TLPRRNSPEFTEMRYTACTVEPDDFLKEG 278

>YBR038W Chr2 (311898..314789) [2892 bp, 963 aa] {ON}  CHS2Chitin
           synthase II; catalyzes transfer of N-acetylglucosamine
           (GlcNAc) to chitin upon activation of zymogenic form;
           required for chitin synthesis in the primary septum
           during cytokinesis; localization regulated by Cdk1p
           during mitosis
          Length = 963

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 465 QIEMNHPESEQQSEQAN----LNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVD 520
           + E+NHP  +Q   +AN      MV   P P+ +K  L+     ++NP       +GL+D
Sbjct: 200 KFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLK-----LDNP-----IPKGLLD 249

Query: 521 LIKDAKSREVKRLKSTLVQVDTDELTEDA 549
            +    S E   ++ T   V+ D+   + 
Sbjct: 250 TLPRRNSPEFTEMRYTACTVEPDDFLREG 278

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKT-LQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT    + L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>Smik_2.156 Chr2 (292824..295718) [2895 bp, 964 aa] {ON} YBR038W
           (REAL)
          Length = 964

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 465 QIEMNHPESEQQSEQAN----LNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVD 520
           + E+NHP  +Q   +AN      MV   P P+ +K  L+     ++NP        GL+D
Sbjct: 201 KFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLK-----LDNP-----IPRGLLD 250

Query: 521 LIKDAKSREVKRLKSTLVQVDTDELTEDA 549
            +    S E   ++ T   V+ D+   + 
Sbjct: 251 TLPRRNSPEFTEMRYTACTVEPDDFLREG 279

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 65  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 120

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ +KR+K T+
Sbjct: 121 EAATLFKDHKSQYIKRVKETV 141

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKT-LQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT    + L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKT-LQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT    + L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKT-LQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT    + L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ +KR+K T+
Sbjct: 125 EAATLFKDHKSQYIKRVKETV 145

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ VKR+K T+
Sbjct: 125 EAATLFKDHKSQYVKRVKETV 145

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 458 HVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTAR-KKTLQDFKSTVNNPDNSASSTE 516
           HVK ++   EM HP      E   L++++    PT      L   +S  N+P+ ++ +  
Sbjct: 69  HVKFLS---EMFHPNVYANGEIC-LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANV 124

Query: 517 GLVDLIKDAKSREVKRLKSTL 537
               L KD KS+ +KR+K T+
Sbjct: 125 EAATLFKDHKSQYIKRVKETV 145

>Smik_8.130 Chr8 (195390..195779) [390 bp, 129 aa] {ON} YHR059W
           (REAL)
          Length = 129

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 148 IIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVTNILSKPTTTFEESWDSLIQNESYML 205
           +++T KI + Y       NG +   + FL ++    ++    FE +W++L Q +S ML
Sbjct: 17  LLITPKISYRYSSTIPKPNGQIPDVNTFLTKIGRNCNELKDAFENNWNNLFQWDSKML 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,506,380
Number of extensions: 3635167
Number of successful extensions: 13166
Number of sequences better than 10.0: 321
Number of HSP's gapped: 13892
Number of HSP's successfully gapped: 349
Length of query: 762
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 645
Effective length of database: 40,065,477
Effective search space: 25842232665
Effective search space used: 25842232665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)