Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0E018905.436ON47447425160.0
ZYRO0F10076g5.436ON48246712871e-174
SAKL0G02574g5.436ON48446510191e-134
Kwal_55.214185.436ON4844689231e-119
KLTH0F16016g5.436ON4844728761e-112
KLLA0E02223g5.436ON4804698321e-106
AER403C5.436ON4804647911e-99
Ecym_47605.436ON4784837734e-97
Kpol_1062.285.436ON4654685671e-66
TPHA0E017505.436ON4594703948e-42
TBLA0A028105.436ON4814783193e-31
SAKL0E07194g2.304ON4951981598e-11
Ecym_33422.304ON4951391589e-11
KAFR0H032502.304ON4622431518e-10
YNL026W (SAM50)2.304ON4841351501e-09
Kwal_27.114562.304ON4962061501e-09
CAGL0M06853g2.304ON4662541482e-09
KLLA0E08735g2.304ON4921651473e-09
KLTH0G10824g2.304ON4952541463e-09
TBLA0B060602.304ON5031461463e-09
KNAG0H019402.304ON4562301454e-09
Smik_14.3042.304ON5001361446e-09
Kpol_1003.512.304ON4781521411e-08
AGR392C2.304ON4955041402e-08
NCAS0G038602.304ON4611731321e-07
NCAS0G037502.304ON4611731321e-07
NDAI0G007102.304ON4911371312e-07
Suva_14.3192.304ON4841411312e-07
Skud_14.3022.304ON4841341284e-07
TPHA0G008302.304ON4782541205e-06
ZYRO0A02310g2.304ON4921311188e-06
TDEL0G023402.304ON4942041152e-05
Suva_3.1601.14ON41687840.090
Smik_3.221.14ON41778800.27
Skud_3.111.14ON41666780.56
NDAI0F041801.85ON1079118723.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0E01890
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    973   0.0  
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   500   e-174
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   397   e-134
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   360   e-119
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   342   e-112
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   325   e-106
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   309   e-99 
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   302   4e-97
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   223   1e-66
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    156   8e-42
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    127   3e-31
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    66   8e-11
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    65   9e-11
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    63   8e-10
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    62   1e-09
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    62   1e-09
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    62   2e-09
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    61   3e-09
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    61   3e-09
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    61   3e-09
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    60   4e-09
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    60   6e-09
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    59   1e-08
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    59   2e-08
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    55   1e-07
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               55   1e-07
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    55   2e-07
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    55   2e-07
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    54   4e-07
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    51   5e-06
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    50   8e-06
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    49   2e-05
Suva_3.160 Chr3 complement(243889..245139) [1251 bp, 416 aa] {ON...    37   0.090
Smik_3.22 Chr3 complement(35546..36799) [1254 bp, 417 aa] {ON} Y...    35   0.27 
Skud_3.11 Chr3 complement(22077..23327) [1251 bp, 416 aa] {ON} Y...    35   0.56 
NDAI0F04180 Chr6 complement(1008120..1011359) [3240 bp, 1079 aa]...    32   3.5  

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/474 (100%), Positives = 474/474 (100%)

Query: 1   MLFHDLASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYT 60
           MLFHDLASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYT
Sbjct: 1   MLFHDLASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYT 60

Query: 61  FGDIRRKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGV 120
           FGDIRRKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGV
Sbjct: 61  FGDIRRKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGV 120

Query: 121 YNSTAGTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLP 180
           YNSTAGTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLP
Sbjct: 121 YNSTAGTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLP 180

Query: 181 LAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYA 240
           LAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYA
Sbjct: 181 LAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYA 240

Query: 241 GITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEY 300
           GITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEY
Sbjct: 241 GITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEY 300

Query: 301 VISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMD 360
           VISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMD
Sbjct: 301 VISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMD 360

Query: 361 KWYLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFND 420
           KWYLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFND
Sbjct: 361 KWYLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFND 420

Query: 421 LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF
Sbjct: 421 LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  500 bits (1287), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 338/467 (72%), Gaps = 2/467 (0%)

Query: 9   DIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKL 68
           ++  +ETKPLYISKI +DGDN  SPLS S+ +AI  +AL+ P+Q+V +S+  F DIR+KL
Sbjct: 17  NLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKL 76

Query: 69  LCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTT 128
           L TGL+ DV ITL++D D  S    NK+  + YGIE+PL+T A+++LK    YN+ +GTT
Sbjct: 77  LFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPD-YNTISGTT 135

Query: 129 SLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVR 188
           +L DD+ S+A S+++ NLLG+AD+E+  LG  +NP TS+W+GK  + SFSLPL K PSVR
Sbjct: 136 TLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVR 195

Query: 189 ASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRD 248
           A +  +G++ +  SK ++A  D+H + QY++  G QKRWI   + SVP  Y G++   R+
Sbjct: 196 AIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRN 255

Query: 249 ISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGS 308
           ++     AS++++ + G F+K S  + F +DTR++ G FP+SG +  +NNEYVISQ++GS
Sbjct: 256 LNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGS 315

Query: 309 SQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPF-SEKTEVHPMDKWYLGGL 367
           S+ L  ++NF+K  F L+HH SHWK+K+T S  LQ GGI P  SE   VHP+D++ LGGL
Sbjct: 316 SKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGL 375

Query: 368 DSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNS 427
           +S+KGF  NGVG GG +FFYK+ L+ S KLINTP  SPLRL +F NLGNA +D  T  NS
Sbjct: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435

Query: 428 YAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           YAAATG+SL YKTPQA +DLTYAHPLTSR QD++KPG S GV+ ++F
Sbjct: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 202/465 (43%), Positives = 293/465 (63%), Gaps = 5/465 (1%)

Query: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72
           S TKPLYI+ +S+DGDN  +PLS ++YK+ILD  LS P+QN+ +++  F +I++KL  TG
Sbjct: 22  SATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTG 81

Query: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132
           L+QDV+ITL+ D    S +F  ++  KEYG+E PL T A+I L P+ +YN    T+   D
Sbjct: 82  LFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPA-LYNKLCLTSGTSD 140

Query: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192
             +S+    S++N LG+A++      + Y P + K   KSL G F LPL KNPS++A ++
Sbjct: 141 MLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAVID 200

Query: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISGL 252
            +   ++   + ++A  D H + QYS + G+QK W+  +T + P  + G+++  R++ G 
Sbjct: 201 VNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLYGF 260

Query: 253 G--AQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSSQ 310
              A  S+    ++G F K S  S+  NDTRK+ G FP+SG    + NEYV++Q    ++
Sbjct: 261 NDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNK 320

Query: 311 VLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKWYLGGLDS 369
            +PQE+NF K   S + H S+  N++T+SLD   G IIP   K   VH MD++YLGGL S
Sbjct: 321 TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKS 380

Query: 370 MKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNSYA 429
           +KGF+ N VG  G +FFY++ +T+S +L N   +SPLR   F N G++ N       S+A
Sbjct: 381 LKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLNK-RELPQSFA 439

Query: 430 AATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           AATG SL YKT  ANMDLTYA PLT R QD+ KPGFSFGV  S+F
Sbjct: 440 AATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 192/468 (41%), Positives = 289/468 (61%), Gaps = 5/468 (1%)

Query: 10  IQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLL 69
           +Q S  KPLY + IS+DG+  L PLS + Y ++L+  LS P+Q +  SL  F +I++KL+
Sbjct: 19  LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLI 78

Query: 70  CTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTS 129
            TG++ DV+I+L++D      +  ++D+ KE  +ESP+ T ARI+LKP   +N    T+S
Sbjct: 79  YTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLE-FNKLCFTSS 137

Query: 130 LVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRA 189
             D   S+    S++N LG+A+  +    +KY P  +    K+L     +PL KNPSV+A
Sbjct: 138 TNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKA 197

Query: 190 SLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDI 249
             + +   ++   + ++ + D H + Q S++ G+QK+W+  + N  P FY G +   R++
Sbjct: 198 VFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNL 257

Query: 250 SGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQ--TKG 307
             +  +AS     ++  F K S  S+   D RK++G FP SG ++ +NNEYV+SQ   K 
Sbjct: 258 HDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKD 317

Query: 308 SSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKWYLGG 366
           S   +  ++ F+K   SL+   S +KNK+ NSLD+  GGI+P       VH MDK+YLGG
Sbjct: 318 SGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHMDKFYLGG 377

Query: 367 LDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATN 426
           L S+KGF+ N VG  G +FFYK+ + +S KL  TP  SPLRL FF+N G   N+  T+  
Sbjct: 378 LASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSNEKPTSV- 436

Query: 427 SYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           S AA++GISL YK+P ANMDLTYA PL++R+QD+ KPGFSFGV+ S +
Sbjct: 437 SCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 280/472 (59%), Gaps = 7/472 (1%)

Query: 7   ASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRR 66
           +S +Q S  KPLY + IS+DGDN  SPLS +VY ++L+  L  P+Q +  SL  F +I++
Sbjct: 16  SSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKK 75

Query: 67  KLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAG 126
           KL+ TGL++DV+I+L+ +  +   +   KD  K Y +E P+ T ARI L P  +  + A 
Sbjct: 76  KLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINL--NRAS 133

Query: 127 TTSLVDDSASVAISR-SYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNP 185
            TS   D+ S    R S +N  G+A+  +    L Y P  S ++ K L+    +PL KNP
Sbjct: 134 LTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNP 193

Query: 186 SVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITST 245
           SV+A  + +   ++   + +I + D H + Q S++ G+QK+W+  +T   P  Y G +  
Sbjct: 194 SVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVV 253

Query: 246 NRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQT 305
            R++  +  +AS+    +   F K S  S+   D RK++G FP SG +  +NNEYV+S++
Sbjct: 254 ARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSES 313

Query: 306 --KGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKW 362
             K +   + Q + F K     + H + + NK+ NSL+L  GGI    + +  VH +DK+
Sbjct: 314 FDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHHIDKF 373

Query: 363 YLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLN 422
           YLGG+ S+KGF+ N VG  G   FYK+ L +S KL NTP +SPLRL FF N G+  N   
Sbjct: 374 YLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKP 433

Query: 423 TATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           T   S AA++G+SL YK+  ANMDLTYA PLT+R QDI KPGFSFGV+ S +
Sbjct: 434 TQF-SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  325 bits (832), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/469 (38%), Positives = 273/469 (58%), Gaps = 7/469 (1%)

Query: 12  GSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCT 71
           GS  K +Y +K+++DGDN LSP+S  +Y++I ++ L+ P+Q V S+  +  DI++KLL T
Sbjct: 13  GSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFT 72

Query: 72  GLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLV 131
           GL+Q   ITL+ D D +SS    ++ PK   IE P+ T A++ L P+ VYN  + +T+  
Sbjct: 73  GLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPA-VYNKGSLSTTTR 131

Query: 132 DDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASL 191
           D  +S      ++N  G A++ S    + Y P   K + + L    +LP  KNPSV+A++
Sbjct: 132 DTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAV 191

Query: 192 NFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISG 251
             +   ++   + +I E+D+H + Q+ LS G++K ++     SV   + G+T   R+I G
Sbjct: 192 YANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYG 251

Query: 252 L--GAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSS 309
                  S     + G F K S  S+  +D+R++Y  FPVSG  + + +EY++SQ   +S
Sbjct: 252 FADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNS 311

Query: 310 QVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE--VHPMDKWYLGGL 367
           + LP E NF K   S + H   +  KL  SL L  G I P+  K++  VH +D +YLGG 
Sbjct: 312 KPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGP 371

Query: 368 DSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT-- 425
            S+KGF+ N VG  G  +FYK+ +++S KL NTPIDSPLRL  F+N G+  N+   A   
Sbjct: 372 KSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLE 431

Query: 426 NSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
              A +TGISL Y    AN+DL+Y+ PL  R  DI KPG +FG+  S+F
Sbjct: 432 RKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  309 bits (791), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 178/464 (38%), Positives = 266/464 (57%), Gaps = 9/464 (1%)

Query: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72
           S+TKPLYI+ + ++ D    PLS  V K+IL   L+ P+Q++ S+L +   I + L+ TG
Sbjct: 22  SQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYTG 80

Query: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132
           LYQD+ ITL+ D     ++F +  +PKEY IE PL   A + + P+  Y   +  T+  D
Sbjct: 81  LYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAP-YQRLSLVTTTRD 139

Query: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192
             AS     + +N  G A+  S    + Y P + K + K +     +P   NPS++A  +
Sbjct: 140 SYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFD 199

Query: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISGL 252
            +   ++  ++ +I E D H + Q   + G+QK+W+ ++  S P  +AG++   R++ G+
Sbjct: 200 VNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGVSIVGRNLHGI 258

Query: 253 GA-QASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSSQV 311
              +AS   S ++    K S  ++F +  RK  GTFPV G +    NE V+SQT   +  
Sbjct: 259 QLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-- 316

Query: 312 LPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSE--KTEVHPMDKWYLGGLDS 369
            PQE+ F+KF  + + H S  +N +T SLDL  G +I   +  K  VH MD++YLGGL S
Sbjct: 317 -PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSS 375

Query: 370 MKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNSYA 429
           +KGF  N VG  G   FY+++L +S  L  TP+DSPLRL  F N G+ F+         A
Sbjct: 376 LKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPEDVA 435

Query: 430 AATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473
           AATG+SL Y++P AN+DLTYA PLTSR  D+ KPGFSFGV  +Y
Sbjct: 436 AATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  302 bits (773), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 181/483 (37%), Positives = 274/483 (56%), Gaps = 14/483 (2%)

Query: 1   MLFHDLASDIQGSE-------TKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQN 53
           M+ ++L +++ G E       TKPL+I+ + ++ D  LSPLS S++++IL   LS P QN
Sbjct: 1   MVENNLRTNLDGHEAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQN 59

Query: 54  VGSSLYTFGDIRRKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARI 113
           + S+L   G I +KL+ TGLY DV ITL+QD     S++  + +PKEYG+E P+   A+I
Sbjct: 60  LRSTLSALGTIEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQI 119

Query: 114 ILKPSGVYNSTAGTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSL 173
            L P+  Y   +  T+  D  A+  I  S +N   +A++      L   P + K + K L
Sbjct: 120 QLVPA-FYQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLL 178

Query: 174 KGSFSLPLAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTN 233
                +PL K PS++A  + +   V+   +S++ E+D H + Q   + G+Q++ I     
Sbjct: 179 SLKCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKF 238

Query: 234 SVPNFYAGITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYE 293
             P  Y+GI+   R++  L         N   + +KVS   +   + +K+ GT P+SG++
Sbjct: 239 RGPIIYSGISILGRNLLDLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWK 298

Query: 294 LLVNNEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEK 353
             + NE V+ QT    +   QE  F K  FS + ++S  +N +  SLDL FG I  +   
Sbjct: 299 FNLFNEAVLGQTVAGEK---QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSG 355

Query: 354 TE--VHPMDKWYLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFF 411
           +E  VH MD++YLGGL S+KGFQ N VG  G + FYKVA  +S  +  TP+ SPLRL  F
Sbjct: 356 SELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAF 415

Query: 412 MNLGNAFNDLNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTF 471
           +N G+ FN         A ATGISL Y++  A++DLTYA PL+ R+QD+ KPGFSFGV+ 
Sbjct: 416 VNAGDVFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSI 475

Query: 472 SYF 474
           +Y 
Sbjct: 476 AYM 478

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  223 bits (567), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 231/468 (49%), Gaps = 16/468 (3%)

Query: 6   LASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIR 65
           +  +I  S TKPLYIS++S++ D+S  PLS S  + +L+  +S+P+QNV ++L +F DI+
Sbjct: 13  VKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIK 72

Query: 66  RKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTA 125
           R LL TGLY DV +TL  D        + K    + GIES + T A I LKP+ +  +  
Sbjct: 73  RNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQ 132

Query: 126 GTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNP 185
            T +   +  SV   + + N LG AD E+   G KYN Q++ W  K  KG F LP  K P
Sbjct: 133 TTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVP 192

Query: 186 SVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITST 245
           S+R  L+ D   V++   S++        +  +   G+QK W+ +  N+ P FY+G++  
Sbjct: 193 SLRTVLSVD---VSEDKVSHLQ------RLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV 243

Query: 246 NRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQT 305
           N      G     V S       +    + F  D+ K+ G+FP SG  L + NEYV+SQ 
Sbjct: 244 NNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQL 303

Query: 306 KGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMDKWYLG 365
              ++  P   N ++F+ + + + S   +++  ++ +  G   P  E T        ++G
Sbjct: 304 DSDNK--PINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRST-----FVG 356

Query: 366 GLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT 425
                +      +    +   +K    +S KL NT +DSPLRL       N F  L    
Sbjct: 357 ESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYF 416

Query: 426 NSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473
           +  AA TG+SL YKT   NM L+Y  PL   S      GFSF +  +Y
Sbjct: 417 DGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  156 bits (394), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 127/470 (27%), Positives = 225/470 (47%), Gaps = 29/470 (6%)

Query: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72
           S+TKP+Y++++ +        LS + Y+ IL   +S+PV++V      F +IR  L+ +G
Sbjct: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68

Query: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKP---SGVYNSTAGTTS 129
           LY++V + L+ D  A     + K S ++ GIES +   A + + P   +   N     TS
Sbjct: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128

Query: 130 LVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRA 189
             +   SV+++R ++NL G +D+ +  L    N   S+ + KS+   F++PL +N S+R 
Sbjct: 129 --NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRT 186

Query: 190 SLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDI 249
            L          SK  IA+  +    Q+ L+ GL K  ++    S+P FY+G+ +  R  
Sbjct: 187 IL---------ESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGL-NIQRKQ 236

Query: 250 SGLG-----AQASKVFSNYSGK-FNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVIS 303
           + LG        +++  N S +  N +SL+S++  D+R Y   FP  G+   + +++V++
Sbjct: 237 TTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLN 296

Query: 304 QTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMDKWY 363
           +T   S  + +  N S  + S + H S   +++T+S        +P           +++
Sbjct: 297 ETNSISNEIKK--NISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFW 354

Query: 364 LGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNT 423
               +  K    N +        +KV L +S ++ N PI SP+R    +   N    +  
Sbjct: 355 DNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAE 409

Query: 424 ATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473
              +Y+A TG+SL YK   + M L+Y  PL     D    G SF V  +Y
Sbjct: 410 YLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 126/478 (26%), Positives = 221/478 (46%), Gaps = 35/478 (7%)

Query: 15  TKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTGLY 74
           TKPLYISK++I   N    +S S  K++L+  LS P+QN+ ++L TF +I  KL  T L+
Sbjct: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80

Query: 75  QDVRITLE--QDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132
           +DV+I+L+  Q   +K     +  S  +  ++SP+   A I +KP+        T ++ +
Sbjct: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTISN 140

Query: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192
           + +  + S++++N L RAD    +    Y+  ++KW+     G  + PL    SV++   
Sbjct: 141 NKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSVSG 200

Query: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQK--RWILEQTNSVPNFYAGITSTNRDIS 250
               K  Q+SK YI         QY + +G +K  R+  E      N Y G+ + N  I 
Sbjct: 201 ISLFKPLQQSKDYI---------QYLVESGFRKDMRFPEEVGVKSSNLYTGL-AINGAIK 250

Query: 251 GLGAQASKVFSNYSGK----FNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTK 306
             G     V +    +    + K S+ SKF  D+R +    P  G    +  EYV++   
Sbjct: 251 DEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVLNGLN 310

Query: 307 GSSQVLPQ---EDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIP-----FSEKTEVHP 358
            S ++ P+     N S+F  + + + + +++ +  SL ++ G  I      F+ +T+   
Sbjct: 311 DSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWETKRRE 370

Query: 359 MDKWYLGG-LDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNA 417
            +++ +   L+     + +G+       FY V L AS  L +    SPLR    + L   
Sbjct: 371 ANEFPVPSYLEERPHEKNDGIA------FYNVCLNASVPLFSKCKFSPLRFQNSIQL-ER 423

Query: 418 FNDLNTATNSYAAATG-ISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           +N+           TG + L YK+  A  D+ Y  P+   +   TK GF+   + S+ 
Sbjct: 424 YNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 100/198 (50%), Gaps = 28/198 (14%)

Query: 301 VISQTKGSSQVLPQEDNFSKF-----DFSLQHHTSHW--KNKLTNSLDLQFGGIIPFSEK 353
            IS T+G+   L  E    KF     +FS    T+ W   + +T +  L+ G I  F  K
Sbjct: 302 AISPTRGNYAKLLNELALGKFWKTTLEFS---QTNSWFTNDFITMTGTLKGGYISNFHPK 358

Query: 354 TE-VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFF-YKVALTASQKLINTPIDS 404
           ++ +H  DK++ GG + ++GFQ  G+G        GG++F  Y V+L  S+  +    +S
Sbjct: 359 SQPLHMGDKFHNGGSNDVRGFQAMGLGPKDLYDSMGGDAFVAYGVSL-FSRLPVRRWYES 417

Query: 405 PLRLNFFMNLGNAFNDLNTATNS--------YAAATGISLTYKTPQANMDLTYAHPLTSR 456
             RL++F+N G   N  NT  +S        ++ +TG+ L +K P A  +L +  P+++ 
Sbjct: 418 NFRLHWFVNGGRLINHNNTNLSSCIKSLAQEHSTSTGVGLVFKHPVARFELNFTVPISAH 477

Query: 457 SQDITKPGFSFGVTFSYF 474
           S D  + GF +G+  ++ 
Sbjct: 478 SSDSVRKGFQYGIGLTFL 495

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 351 SEKTEVHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPID 403
           S+   +H  DK++ GG + ++GFQ  G+G        GG++F        S+  +N   +
Sbjct: 357 SDNKFIHMKDKFHSGGSNDVRGFQQMGLGPRDIYDSIGGDTFVAYGISVFSRLPVNKWSN 416

Query: 404 SPLRLNFFMNLGNAFND--------LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTS 455
           S  RL++F+N G   N         L+     ++ ATGI + +K P A  +L +  PL +
Sbjct: 417 SGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHSIATGIGILFKHPVARFELNFTLPLAA 476

Query: 456 RSQDITKPGFSFGVTFSYF 474
            S D  + GF +G+  S+ 
Sbjct: 477 HSSDSVRKGFQYGIGLSFL 495

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 106/243 (43%), Gaps = 39/243 (16%)

Query: 256 ASKVFSNY----SGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSSQV 311
           +SKV S+Y     G+F K +L S    D R    T P  G    +NN+            
Sbjct: 235 SSKVVSDYLLIQEGEFYKTTLRSTMVWDGRNG-KTAPTKGRLFKINNDLGFGTNNLQFWR 293

Query: 312 LPQEDNFSKFDFSLQHHTSHW--KNKLTNSLDLQFGGIIPFSEKTEVHPMDKWYLGGLDS 369
              E N  K           W   + +T S  ++FG I   S+   +H  DK+  GG + 
Sbjct: 294 HVTEFNLVK----------SWLKDDFITMSNTIKFGYIKNLSQD-YIHFTDKFQNGGPND 342

Query: 370 MKGFQTNGVG-------FGGNSFF-YKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDL 421
           ++ FQ+ G+G        GG++F  Y V++  S+  I    DS  RL++F N G   N  
Sbjct: 343 IRSFQSMGIGPRHNSYSLGGDAFLSYGVSI-FSKLPIQKFHDSNFRLHWFFNGGKLINHD 401

Query: 422 N----------TATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTF 471
           N          T  NS +A  G+ L +  P A  ++ +A P+T    D+T+ GF FG+ F
Sbjct: 402 NASIWNCMQNLTIENSTSAGVGVVLRH--PMARFEMNFAVPITDHQDDLTRKGFQFGLGF 459

Query: 472 SYF 474
            + 
Sbjct: 460 EFL 462

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 67/135 (49%), Gaps = 17/135 (12%)

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPID-SPLR 407
           VH  DK+  GG   ++GFQT G+G        GG++F     L+   +L    ++ S  R
Sbjct: 351 VHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFV-SYGLSVFSRLPWKKVEKSNFR 409

Query: 408 LNFFMNLGNAFNDLNTA--------TNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQD 459
           L++F N G   N  NT+        +  ++ +TGI L  + P A  +L +  P+T+   D
Sbjct: 410 LHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHEND 469

Query: 460 ITKPGFSFGVTFSYF 474
           + + GF FG+  ++ 
Sbjct: 470 LIRKGFQFGLGLAFL 484

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 32/206 (15%)

Query: 287 FPVSGYELLVNNEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNK--LTNSLDLQF 344
           FP++G  L ++NE  +++   SS           F+FS   +   W N    T S  ++ 
Sbjct: 305 FPLAGSFLKISNEIALNKFWKSS-----------FEFS---NVRSWCNNDFFTASGTVKG 350

Query: 345 GGIIPFSEKTE-VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQK 396
           G I  F  +T+ +H  DK++ GG + ++ FQ  G+G        GG++F        S+ 
Sbjct: 351 GYINNFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDLYDSMGGDAFVSYGVSIFSRL 410

Query: 397 LINTPIDSPLRLNFFMNLGNAFN--------DLNTATNSYAAATGISLTYKTPQANMDLT 448
            I    +S  RL+ F N     N         L+T  + ++ +TG+ L +  P A  +L 
Sbjct: 411 PIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEHSTSTGVGLVFGHPVARFELN 470

Query: 449 YAHPLTSRSQDITKPGFSFGVTFSYF 474
           +  PLT+ S D  + GF +G+  S+ 
Sbjct: 471 FCVPLTAHSSDSIRKGFQYGIGLSFL 496

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 108/254 (42%), Gaps = 34/254 (13%)

Query: 238 FYAGITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVN 297
           FY G+T T +  S     AS      +G   K S+   +  DTR      P  G    +N
Sbjct: 230 FYEGVTRTTKVTSD---HASDTLLFQAGTDFKSSIGHTYAIDTRDSVMA-PNRGNLFKLN 285

Query: 298 NEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNK-LTNSLDLQFGGIIPFS-EKTE 355
           NE  + +             + K  F L    S +KN  +T +  L+ G +  F  +K  
Sbjct: 286 NEVALGK-------------YWKSQFELSKVQSWFKNDFITTTTTLKGGYLGNFHPDKKT 332

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPIDSPLRL 408
           +H  DK+  GG + ++ FQ+ GVG        GG++F        S+  I    DS  RL
Sbjct: 333 LHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKFEDSHFRL 392

Query: 409 NFFMNLGNAFND--------LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDI 460
           ++F N G   N         L+  +  ++ + G  +  + P A  +L ++ PLT  ++D 
Sbjct: 393 HWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLPLTVSTEDS 452

Query: 461 TKPGFSFGVTFSYF 474
            + GF FG+  S+ 
Sbjct: 453 LRKGFQFGLGMSFL 466

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 20/165 (12%)

Query: 329 TSHWKNK--LTNSLDLQFGGIIPFSEKT-EVHPMDKWYLGGLDSMKGFQTNGVG------ 379
           T  W N+  +T S  ++ G I  F  KT  +H  DK+Y GG + ++ FQ  G+G      
Sbjct: 329 TKSWFNRNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDIYD 388

Query: 380 -FGGN-SFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT--------NSYA 429
             GG+ S  Y ++L  S+       DS  RL+ F N G   N  N  T        + ++
Sbjct: 389 YVGGDTSLSYGLSL-FSRLPFKRFYDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQHS 447

Query: 430 AATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
            +TG  L ++ P A  +L +  P+T+ + D T+ GF +G+  S+ 
Sbjct: 448 LSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISFL 492

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 104/254 (40%), Gaps = 30/254 (11%)

Query: 237 NFYAGITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLV 296
           N+  G+ S  R        +S      +G   K SL      DTR     FP++G    +
Sbjct: 256 NYELGVESLWRSTQATSTHSSDSLLLLAGDEVKNSLSHSVFWDTRDR-PIFPLAGSFYKL 314

Query: 297 NNEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEV 356
            NE   S+         +  ++ K DF             T S  L+ G I  FS    +
Sbjct: 315 TNELSPSKYWKCFFEASKVKSWRKNDF------------FTASFTLKGGYINNFSASKPL 362

Query: 357 HPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFF-YKVALTASQKLINTPIDSPLRL 408
           H  DK++ GG + ++ FQ  G+G        GG++F  Y V+L  S+       DS  RL
Sbjct: 363 HISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSL-FSRLPFKRWSDSNFRL 421

Query: 409 NFFMNLGNAFND--------LNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDI 460
           + F N     N         +++    ++ +TGI L    P A  +L +  PLT+ + D 
Sbjct: 422 HAFFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAHTSDS 481

Query: 461 TKPGFSFGVTFSYF 474
            + GF +G+  S+ 
Sbjct: 482 ARKGFQYGIGLSFL 495

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 70/146 (47%), Gaps = 29/146 (19%)

Query: 350 FSEKTEVHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPI 402
           F     +H  DK+  GG + ++GFQ  G+G        GG++F      +   K+   PI
Sbjct: 364 FPNSKAIHRNDKFQNGGANDIRGFQFMGLGPKDRFDSVGGDAFI-SYGFSVMNKI---PI 419

Query: 403 ----DSPLRLNFFMNLG-----------NAFNDLNTATNSYAAATGISLTYKTPQANMDL 447
               DS  R ++F+N G           N FNDL+      + + G+ + ++ P A  +L
Sbjct: 420 WKFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQN---SMSVGMGIVFRHPMARFEL 476

Query: 448 TYAHPLTSRSQDITKPGFSFGVTFSY 473
            +A P+ + S DIT+ GF +G+  S+
Sbjct: 477 NFAIPVVTHSGDITRKGFQYGIGLSF 502

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 103/230 (44%), Gaps = 33/230 (14%)

Query: 265 GKFNKVSLESKFHNDTRKYYGTF-PVSGYELLVNNEYVISQTKGSSQVLPQEDNFSKFDF 323
           G F +  +++ F  D R     F P  G    +NNE + +   GSS        F K   
Sbjct: 240 GSFVRSVIKNNFTKDNRD--SPFNPTKGTMYKINNE-LGAMDNGSS--------FWKTVL 288

Query: 324 SLQHHTSHW--KNKLTNSLDLQFGGIIPFS-EKTEVHPMDKWYLGGLDSMKGFQTNGVG- 379
            L H  S W  ++ +T S  L+ G I   +  K+ +H  DK+  GG + ++ FQ NG+G 
Sbjct: 289 ELNHVKS-WFPRDFITLSTTLRSGYIKNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGP 347

Query: 380 ------FGGNSFF-YKVALTASQKLINTPIDSPLRLNFFMNLGNAFND--------LNTA 424
                  GG++F  Y V+L +   L     DS  RL+++ N G   N         L   
Sbjct: 348 RHMHHSMGGDAFIAYGVSLFSKIPLKRFQ-DSNFRLHWYFNGGKLINHNNLPIHTLLREL 406

Query: 425 TNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           T  ++ + G  +  + P A  +L +  PLTS   D+ + GF FG+ F + 
Sbjct: 407 TLEHSTSIGAGIVMRHPMARFELNFGVPLTSHVGDLQRKGFQFGLGFEFL 456

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 19/136 (13%)

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFF-YKVALTASQKLINTPID-SPL 406
           VH  DK+  GG + ++ FQT G+G        GG++F  Y V++ +  +L    ++ S  
Sbjct: 367 VHICDKFQSGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSMFS--RLPWKKVEKSNF 424

Query: 407 RLNFFMNLGNAFNDLNTA--------TNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQ 458
           RL++F N G   N  NT+        +  ++ +TGI L  + P A  +L ++ P+T+   
Sbjct: 425 RLHWFFNGGKLINHDNTSLSNCIGQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHEN 484

Query: 459 DITKPGFSFGVTFSYF 474
           D+ + GF FG+  ++ 
Sbjct: 485 DLMRKGFQFGLGLAFL 500

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 73/152 (48%), Gaps = 24/152 (15%)

Query: 343 QFGGIIPFSEKTE-VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSF-FYKVALTA 393
           +FG I    +  + +H  DK++LGG + ++GFQ  G+G        GG+ F  Y ++L  
Sbjct: 331 KFGWITKIDDNDKPLHISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMFSAYGISL-F 389

Query: 394 SQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT-----------NSYAAATGISLTYKTPQ 442
           S+       DS  RL+ F N G   N  NT T           NS A  TGI   +K P 
Sbjct: 390 SKLPFKKFSDSNFRLHAFFNGGKLVNQ-NTNTFDRNLQSLFKENSLAIGTGI--IFKHPV 446

Query: 443 ANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
           A  +L +  PLTS S D  + GF +G+  S+ 
Sbjct: 447 ARFELNFTLPLTSYSTDHVRKGFQYGIGMSFL 478

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 114/504 (22%), Positives = 194/504 (38%), Gaps = 95/504 (18%)

Query: 10  IQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLL 69
           +Q +   P+ +S   ++G + + P    V +  LD+ + +   N+   L       R L 
Sbjct: 48  LQTNAFTPVVVSDTVVEGGSHIRP---GVLQVYLDKTV-YRASNMNQLLQQADTFHRLLT 103

Query: 70  CTGLYQDVRITLEQD--HDAK------SSEFANKDSPKEYGIESPLATHARIILKPSGVY 121
              L      TL+    H A        S F + D+P E  +   L    R+ LKP   +
Sbjct: 104 AHSLADAAEQTLDARGVHRAALSSTQIPSHFHSNDAPYELSV---LDVIHRVALKPVSRF 160

Query: 122 NSTAGTTSLVDDSASVAISRSYMNLLGRAD-----------SESFHLGLKYN-PQTSKWE 169
            +  GT ++ +      +   + N+LG  +           + S +L L +N P ++ W 
Sbjct: 161 RAKTGT-NVGNGEGDGYLQFQWRNILGGGERLTLDATKGTKTHSSYL-LNFNAPVSTWWL 218

Query: 170 GKSLKGSFSLPLAKNPSVRASLNF--DGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRW 227
           G        L L KN +    L     G + + RS  +   + +H+     L       W
Sbjct: 219 GD-------LSLFKNATQLGGLELFSLGTRASLRSCFFGLRSWNHELHAEQL-------W 264

Query: 228 ILEQTNSVPNFYAGITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTF 287
                            T   I+GL + AS +     G   K SL     +DTR     F
Sbjct: 265 C----------------TTGCINGLASDASLL---QCGDDVKTSLSYVLSSDTRDS-AVF 304

Query: 288 PVSGYELLVNNEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGI 347
             +G  L   +E  +     +   L    ++   DF            LT S  L+ G I
Sbjct: 305 ASTGRLLRWASELALGSYAKTQVQLSDAVSWGAGDF------------LTLSTTLKAGYI 352

Query: 348 IPFSEKTE-VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFF-YKVALTASQKLI 398
                    +H  DK++ GG + ++GFQ  G+G        GG++F  Y ++L  S+  +
Sbjct: 353 KNLQPGLRPIHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSLF-SRLPV 411

Query: 399 NTPIDSPLRLNFFMNLG-----NAFNDLNTAT---NSYAAATGISLTYKTPQANMDLTYA 450
                S  RL++F+N G     N  + L+  T     ++ + G  L ++ P A  +L + 
Sbjct: 412 QRWAGSDFRLHWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVARFELNFT 471

Query: 451 HPLTSRSQDITKPGFSFGVTFSYF 474
            PL + S D  + GF +G+  S+ 
Sbjct: 472 LPLATHSSDTARKGFQYGIGVSFL 495

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 77/173 (44%), Gaps = 30/173 (17%)

Query: 331 HWKNKL--------------TNSLDLQFGGIIPFSEKTEVHPMDKWYLGGLDSMKGFQTN 376
           +WKN+L              T S + + G I   S ++ VH  DK+  GG + ++ FQ+ 
Sbjct: 290 YWKNQLELSHLKSWFDNDFVTMSCNFKTGYIHSLSSQS-VHISDKFQSGGPNDIRSFQSM 348

Query: 377 GVG-------FGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGN-------AFND-L 421
           G+G        GG++F        S+  I     S  RL+ F+N GN       A  D L
Sbjct: 349 GLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCL 408

Query: 422 NTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
              +  ++ + G+ +  + P A  +L ++ PLT  S D  + G  FGV  S+ 
Sbjct: 409 AALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 77/173 (44%), Gaps = 30/173 (17%)

Query: 331 HWKNKL--------------TNSLDLQFGGIIPFSEKTEVHPMDKWYLGGLDSMKGFQTN 376
           +WKN+L              T S + + G I   S ++ VH  DK+  GG + ++ FQ+ 
Sbjct: 290 YWKNQLELSHLKSWFDNDFVTMSCNFKTGYIHSLSSQS-VHISDKFQSGGPNDIRSFQSM 348

Query: 377 GVG-------FGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGN-------AFND-L 421
           G+G        GG++F        S+  I     S  RL+ F+N GN       A  D L
Sbjct: 349 GLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCL 408

Query: 422 NTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474
              +  ++ + G+ +  + P A  +L ++ PLT  S D  + G  FGV  S+ 
Sbjct: 409 AALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 21/137 (15%)

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPIDSPLRL 408
           +H  DK+  GG + ++ FQT G+G        GG++F        S+  I     S  RL
Sbjct: 358 LHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLPIKDWSKSNFRL 417

Query: 409 NFFMNLG-----------NAFNDLNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRS 457
           ++F+N G           N F DL   +  ++ +TG+ +  + P A  +L ++ PLT   
Sbjct: 418 HWFLNGGKLINHNGMSINNCFTDL---SRQHSISTGVGILLRHPMARFELNFSVPLTIHQ 474

Query: 458 QDITKPGFSFGVTFSYF 474
            D  + GF FGV  S+ 
Sbjct: 475 GDDVRKGFQFGVGLSFL 491

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 29/141 (20%)

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSF-------FYKVALTASQKLINTP 401
           VH  DK+  GG + ++ FQT G+G        GG++F       F ++     QK     
Sbjct: 351 VHICDKFQNGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSVFSRLPWKKVQK----- 405

Query: 402 IDSPLRLNFFMNLGNAFNDLNTA--------TNSYAAATGISLTYKTPQANMDLTYAHPL 453
             S  RL++F N G   N  N +        +  ++ +TGI L  + P A  +L ++ P+
Sbjct: 406 --SNFRLHWFFNGGKLINHDNMSLSNCIGQLSKEHSTSTGIGLVLRHPMARFELNFSLPI 463

Query: 454 TSRSQDITKPGFSFGVTFSYF 474
            +   D+ + G  FG+  ++ 
Sbjct: 464 AAHENDLMRKGLQFGIGLAFL 484

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 15/134 (11%)

Query: 356 VHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPIDSPLRL 408
           +H  DK+  GG + ++ FQT G+G        GG++F        S+        S  RL
Sbjct: 351 IHICDKFQSGGPNDIRSFQTFGLGPRDLYDTIGGDAFVSYGVSVFSRLPWEKVKKSNFRL 410

Query: 409 NFFMNLGNAFNDLNTA--------TNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDI 460
           ++F N G   N  N +        +  ++ +TG+ L  + P A  +L ++ P+ +   D+
Sbjct: 411 HWFFNGGKLINHDNMSLSNCMGRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDL 470

Query: 461 TKPGFSFGVTFSYF 474
            + GF FG+   + 
Sbjct: 471 MRKGFQFGLGLVFL 484

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 107/254 (42%), Gaps = 44/254 (17%)

Query: 249 ISGLGAQASKVFSNYS-------GKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYV 301
           I GL  +   + SN S       G   KVS+      DTR  +   P  G  L V NE  
Sbjct: 241 IEGLLRETKIISSNCSNTLLFQAGNDQKVSIGHSIAWDTRDNH-IIPTYGSFLKVFNEVA 299

Query: 302 ISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKL-TNSLDLQFGGIIPFSEKTE-VHPM 359
           +++             + K    +    S  KN L T +  ++ G I   S     +H  
Sbjct: 300 LNR-------------YLKSQIEVNTAMSFLKNSLITVNGTMRLGYISNISSTLRPLHIG 346

Query: 360 DKWYLGGLDSMKGFQTNGVG-------FGGNSF-FYKVALTASQKLINTPIDSPLRLNFF 411
           D++ LGG + ++ FQ  G+G        GGNS+  Y +++  +     + + S  +++ F
Sbjct: 347 DRFQLGGGNDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPF-KSLMTSNFKIHTF 405

Query: 412 MNLGNAFNDLNTATNSYAAA-----------TGISLTYKTPQANMDLTYAHPLTSRSQDI 460
           +N G   N  N++  ++  A           TG+ + +K P A  +L +  PL +   D+
Sbjct: 406 INGGKLINH-NSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELNFTLPLITHKSDM 464

Query: 461 TKPGFSFGVTFSYF 474
            + GF +G+  S+ 
Sbjct: 465 VRKGFQYGIGISFL 478

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 15/131 (11%)

Query: 359 MDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLINTPIDSPLRLNFF 411
            DK+  GG + ++ FQ  G+G        GG++F        ++   +    S  RL++F
Sbjct: 362 CDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVFTRLPFHKISHSNFRLHWF 421

Query: 412 MNLGNAFNDLNTA--------TNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKP 463
           +N G   N  N++        +  ++ + G  L  K P A  +L +A P+T  + D  + 
Sbjct: 422 LNGGKLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKHPVARFELNFALPVTCHTGDCIRK 481

Query: 464 GFSFGVTFSYF 474
           GF +G+  S+ 
Sbjct: 482 GFQYGIGLSFL 492

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 84/204 (41%), Gaps = 30/204 (14%)

Query: 288 PVSGYELLVNNEYVISQ-TKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGG 346
           P  G  L + NE  I Q  KG  +V  Q +++ K DF            L +   L+ G 
Sbjct: 304 PSRGSLLKLTNELAIGQFWKGQIEV-SQNNSWLKDDF------------LGSCCTLRSGY 350

Query: 347 IIPFSE-KTEVHPMDKWYLGGLDSMKGFQTNGVG-------FGGNSFFYKVALTASQKLI 398
           I   S  +  ++  DK++ GG + ++ F   G+G        GG++F        S+  I
Sbjct: 351 IQNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDLYDSIGGDAFVAYGVSFFSRLPI 410

Query: 399 NTPIDSPLRLNFFMNLGNAFND--------LNTATNSYAAATGISLTYKTPQANMDLTYA 450
                S  RL++F N G   N         L    + ++ + G  +  +   A  +L + 
Sbjct: 411 KRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHSTSVGFGILLRHQVARFELNFT 470

Query: 451 HPLTSRSQDITKPGFSFGVTFSYF 474
            PLT  S D  + GF +G+  S+ 
Sbjct: 471 LPLTCHSGDALRKGFQYGIGISFL 494

>Suva_3.160 Chr3 complement(243889..245139) [1251 bp, 416 aa] {ON}
           YCL052C (REAL)
          Length = 416

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 204 SYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGIT-----STNRDISGLGAQASK 258
           S++++ D H  ++      LQ+RW+LE+T S+ N    IT       +RD+S +    S 
Sbjct: 19  SHMSQNDTHLTVRGGPGVVLQQRWLLERTKSLDNSTKRITWRPRADLDRDLSVIENDLST 78

Query: 259 VFSNYS------GKFNKVSLESKFHND 279
            FS YS      G+F    + + FH++
Sbjct: 79  GFSVYSNSTDVPGRFISTPMYNSFHSE 105

>Smik_3.22 Chr3 complement(35546..36799) [1254 bp, 417 aa] {ON}
           YCL052C (REAL)
          Length = 417

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 204 SYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGIT-----STNRDISGLGAQASK 258
           S++++ D H  ++  +   LQ+RW+LE T S+   +  IT        RD+S +  + S 
Sbjct: 19  SHMSQNDTHLTVKGGVGVVLQQRWLLEGTRSIDKSFKRITWRPRKDLTRDLSVIENELST 78

Query: 259 VFSNYSGKFNKVSLESKF 276
            FS YS   N   +  KF
Sbjct: 79  GFSVYS---NSTEVPEKF 93

>Skud_3.11 Chr3 complement(22077..23327) [1251 bp, 416 aa] {ON}
           YCL052C (REAL)
          Length = 416

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 204 SYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGIT-----STNRDISGLGAQASK 258
           S++++ D H  +Q      LQ+RW+LE+T +V   +  IT        RD++ +  + S 
Sbjct: 19  SHMSQNDTHLTVQGGPGVVLQQRWLLERTGNVDESFKKITWRPRADLTRDLTVIENELSV 78

Query: 259 VFSNYS 264
            FS YS
Sbjct: 79  GFSVYS 84

>NDAI0F04180 Chr6 complement(1008120..1011359) [3240 bp, 1079 aa]
           {ON} Anc_1.85 YNL267W
          Length = 1079

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 18/118 (15%)

Query: 173 LKGSFSLPLA------KNPSVRASLNFDGVKVNQR--SKSYIAETDD-HDEMQYSLSTGL 223
           LK +  +P+       +NP+++ S NFD +  N+R  SK +  +TD+  D+M+ S     
Sbjct: 657 LKSAAKVPIIPRDSQDRNPALKFSNNFDALITNKRSTSKEFHTQTDELADQMRISA---- 712

Query: 224 QKRWILEQTNSVPNFYAGITSTNRD--ISGLGAQASKVFSNYSGKFNKVSLESKFHND 279
               +L Q  + P  Y+  T+  RD  I+ +     K   N     +  + E K  ND
Sbjct: 713 ---LMLNQLENSPQEYSATTNQIRDEIIASMKEVQDKFGYNDLEAIHGAAGERKLKND 767

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,209,265
Number of extensions: 2465828
Number of successful extensions: 5828
Number of sequences better than 10.0: 58
Number of HSP's gapped: 5972
Number of HSP's successfully gapped: 58
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)