Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D063703.569ON70670636380.0
NDAI0I032503.569ON70970431780.0
NCAS0E002503.569ON70870631450.0
KAFR0J028903.569ON70670630980.0
Suva_7.163.569ON70870630860.0
YGL245W (GUS1)3.569ON70870630800.0
Smik_7.163.569ON70870630790.0
KNAG0I002203.569ON70770630670.0
Kpol_507.83.569ON70770630640.0
Skud_7.223.569ON70870630540.0
CAGL0C01947g3.569ON70570730110.0
SAKL0F00748g3.569ON70770629750.0
Kwal_47.192723.569ON70470729660.0
TPHA0A060203.569ON70770829350.0
ZYRO0E09570g3.569ON70670729330.0
AFR264W3.569ON70770628790.0
KLTH0G00682g3.569ON70470728540.0
KLLA0A00682g3.569ON70870728530.0
TBLA0E001903.569ON70770527610.0
YOR168W (GLN4)6.51ON8093655624e-61
ZYRO0C07018g6.51ON8035475625e-61
SAKL0E02134g6.51ON8015465591e-60
Smik_15.3486.51ON8103655563e-60
KAFR0G026106.51ON7943345545e-60
TDEL0G041906.51ON8093655537e-60
Suva_8.2236.51ON8213635493e-59
Kpol_1037.386.51ON8083655474e-59
NDAI0K028606.51ON8143635476e-59
KNAG0M011006.51ON7993375459e-59
AGR259C6.51ON7983655441e-58
TBLA0G004506.51ON8083655441e-58
Skud_15.3326.51ON8093345432e-58
KLTH0C10340g6.51ON8004945388e-58
CAGL0L04532g6.51ON7953315291e-56
Kwal_56.225596.51ON8003655291e-56
TPHA0J005506.51ON8083315263e-56
NCAS0F002406.51ON8113675246e-56
KLLA0F20449g6.51ON8043265212e-55
Ecym_31356.51ON8044115062e-53
TPHA0L005907.100ON5582761922e-14
NDAI0A084607.100ON5292731877e-14
NCAS0I005607.100ON5272191861e-13
KNAG0L006207.100ON5172311814e-13
YOL033W (MSE1)7.100ON5363661742e-12
Suva_15.1347.100ON5353481708e-12
TBLA0E021807.100ON5312811636e-11
TDEL0H035007.100ON5342411627e-11
Kpol_1044.127.100ON5362311602e-10
CAGL0F01133g7.100ON5323421547e-10
Skud_15.1227.100ON5322631547e-10
AEL338C7.100ON5332331531e-09
KLLA0F07975g7.100ON5422741521e-09
KAFR0D013207.100ON5142341475e-09
Smik_15.1327.100ON5353401467e-09
Kwal_26.72027.100ON5672491459e-09
SAKL0B09548g7.100ON5542821404e-08
Ecym_26267.100ON5733481386e-08
KLTH0D02794g7.100ON5462341386e-08
ZYRO0D05808g7.100ON5332461351e-07
YDR180W (SCC2)8.381ON149356830.25
Suva_7.1626.153ON378125732.9
Smik_12.4694.236ON89565733.9
Smik_4.4298.381ON148952734.1
Skud_5.2388.160aON17837695.3
ZYRO0G03982g7.160ON161860717.5
Skud_4.4458.381ON149356708.7
NCAS0I031201.141ON689114709.0
KAFR0F038304.173ON1845102709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D06370
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1405   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1228   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1216   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1197   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1193   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1191   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1190   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1186   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1184   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1181   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1164   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1150   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1147   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1135   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1134   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1113   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1103   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1103   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1068   0.0  
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   221   4e-61
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   221   5e-61
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   219   1e-60
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   218   3e-60
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   218   5e-60
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   217   7e-60
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   216   3e-59
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   215   4e-59
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   215   6e-59
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   214   9e-59
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   214   1e-58
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   214   1e-58
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   213   2e-58
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   211   8e-58
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   208   1e-56
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   208   1e-56
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   207   3e-56
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   206   6e-56
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   205   2e-55
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   199   2e-53
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    79   2e-14
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    77   7e-14
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    76   1e-13
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    74   4e-13
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    72   2e-12
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    70   8e-12
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    67   6e-11
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    67   7e-11
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    66   2e-10
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    64   7e-10
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    64   7e-10
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    64   1e-09
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    63   1e-09
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    61   5e-09
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    61   7e-09
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    60   9e-09
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    59   4e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    58   6e-08
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    58   6e-08
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    57   1e-07
YDR180W Chr4 (821295..825776) [4482 bp, 1493 aa] {ON}  SCC2Subun...    37   0.25 
Suva_7.162 Chr7 (302203..303339) [1137 bp, 378 aa] {ON} YGL105W ...    33   2.9  
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    33   3.9  
Smik_4.429 Chr4 (777324..781793) [4470 bp, 1489 aa] {ON} YDR180W...    33   4.1  
Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C (...    31   5.3  
ZYRO0G03982g Chr7 (322285..327141) [4857 bp, 1618 aa] {ON} some ...    32   7.5  
Skud_4.445 Chr4 (788199..792680) [4482 bp, 1493 aa] {ON} YDR180W...    32   8.7  
NCAS0I03120 Chr9 (573421..575490) [2070 bp, 689 aa] {ON} Anc_1.1...    32   9.0  
KAFR0F03830 Chr6 (750178..755715) [5538 bp, 1845 aa] {ON} Anc_4....    32   9.6  

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1405 bits (3638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/706 (97%), Positives = 686/706 (97%)

Query: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE
Sbjct: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
           AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD
Sbjct: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD
Sbjct: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE
Sbjct: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI
Sbjct: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360

Query: 361 YRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           YRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK
Sbjct: 361 YRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NPDVGEKKVIFY            LEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/704 (82%), Positives = 637/704 (90%), Gaps = 1/704 (0%)

Query: 4   LIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEAFP 63
           L+INGKAPVVAY +LIAAR++N   P SI+++FVDDKK+AP+V +G S+  F+KIIE FP
Sbjct: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65

Query: 64  KIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADIAC 123
           +IFTE   + +A W K A+ + V+KNFQKLS SL KLDA LNLRT+ILGGLKYSAADIAC
Sbjct: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125

Query: 124 WGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKKKE 183
           WGALRSNGM GSI+KNKVDVNVSRWY+LLE D  FG  HE LTKS+Q+LKK SN GKKKE
Sbjct: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185

Query: 184 GHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+ YKGKLIIRFDDTN
Sbjct: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245

Query: 244 PSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMR 303
           PSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQ+MY+LCVKMIKEGKAYCDDT TEKMR
Sbjct: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305

Query: 304 EERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRC 363
           EERMDGIASARRDR VEENLRIF +EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365

Query: 364 NLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVH 422
           NLTPHHRTGTT K YPTYDFCVP+VD++EGVTHALRTIEYRDRNAQYDWML+AMNLRKVH
Sbjct: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425

Query: 423 IWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 482
           IWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQG
Sbjct: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 485

Query: 483 PSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKKNP 542
           PSRNVINLEWNLIWAFNKKVIDPVA R TA+V+PVK+HL+G+D PQ+PKTEMKPKHKKNP
Sbjct: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545

Query: 543 DVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDFKK 602
            VGEKKVI+Y            +E+NEEVT+MDWGNVIITKKNADGS+ GKL+LDGDFKK
Sbjct: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605

Query: 603 TKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKDL 662
           TKHKLTWLADTEDV PVDLVDFDHLISKDKLEEDESFEDFLTP TEFHTSAIADLNVKD+
Sbjct: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665

Query: 663 KVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGYYRLDA+AKDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/706 (82%), Positives = 631/706 (89%), Gaps = 1/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A L+INGKAPVVAYAELIAAR+VN   P SI++EFVDDKKAAPA  +G+++  F+KI+  
Sbjct: 3   ATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIVAQ 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           F  +F+    E+I  WVK AS + VIKNFQKLS SL KLDA LNLRT+ILGGLKYSAADI
Sbjct: 63  FSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAADI 122

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGM GSIIKNKV+VNVSRWYTLLE D  FG  HEFLTKS+Q+LKK +N GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAGKK 182

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 242

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL+LLGI+GDR+T SSDYFQEMYD C++MIKEGKAYCDDT TEK
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEK 302

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARRDR VEENL+IFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTGTT K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WML A+NLRK
Sbjct: 363 RCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR TA+VNPVK+HL+G+D PQ+PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKHKK 542

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI++            LE NEEVT+MDWGNVIIT+KNADGSL GKL+L+GDF
Sbjct: 543 NPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEGDF 602

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADT DV PVDLVDFDHLI+KDKLEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLNVK 662

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGDIIQFERKGYYRLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/706 (81%), Positives = 627/706 (88%), Gaps = 3/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A L+INGKAPVVAY  LIAAR+VN   P++I +EFVDDKK+APA  +G SEG F KI+ A
Sbjct: 3   ATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAA 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           FP  F        + W+  AS ++++KNFQKL+ SLEKLDA LNLRT+I GGL+YSAADI
Sbjct: 63  FPDAFRNANVA--SEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADI 120

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           A WGALRSNGMVGSIIKNKV VNVSRWY+LLE D  FG  HEFLTKS+Q+LKK ++ GKK
Sbjct: 121 AAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKK 180

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 240

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEK EFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYDLCV++IKEG AYCDDT TEK
Sbjct: 241 TNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEK 300

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY 360

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WMLNA++LRK
Sbjct: 361 RCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWN+IWAFNKKVIDPVAPR TAVVNPVK+HL GEDAP++PK EMKPKHKK
Sbjct: 481 QGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKK 540

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI+Y            +E NEEVTLMDWGN+IITKKNADGS+E K++L+GDF
Sbjct: 541 NPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDF 600

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKT HKLTWLADTEDV PVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK
Sbjct: 601 KKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           ++KVGD+IQFERKGY+RLD+L KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 EMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/706 (81%), Positives = 623/706 (88%), Gaps = 1/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           + L INGKAP VAYAELIAAR+VN + P SI VEFVDDKKA  A LD  +E VF KI   
Sbjct: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKITGK 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           F  IF  G  EE+A WVK A  + V+KNF KLS SLE LD  LNLRT+ILGGLKYSAAD+
Sbjct: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AHEFLTKS+Q++KK +NVGKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGK+IIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYD CV+MIK+GKAYCDDT TEK
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARRDR VEENLRIFT+EMKNGTE GLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDP+APR TAVVNPVK+HL+G +APQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI+Y            ++ +EEVTLMDWGNV+ITKKNADGS+  KL+L+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEGDF 602

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADT+D+ PVDLVDFDHL++KDKLEEDESFEDFLTPETEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGDI+QFERKGY+RLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/706 (80%), Positives = 622/706 (88%), Gaps = 1/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           + L INGKAP+VAYAELIAAR+VN + P SI ++ VDDKKA  A LD  +E VF KI   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKITSK 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           F  IF  G  E++A WV  A  + VIKNF KLS SLE LD+ LNLRT+ILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADV 122

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AH+FL+KS+ +LKK++NVGKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVGKK 182

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL LLGI+GDR+T+SSDYFQEMYD CV+MIK+GKAYCDDT TEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDG+ASARRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG+T K YPTYDFCVP+VDAIEGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDP+APR TA+VNPVK+HL+G +APQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKHKK 542

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI+Y            +  +EEVTLMDWGNVIITKKN DGS+  KLNL+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEGDF 602

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADT+DV PVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+K+GDIIQFERKGYYRLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/706 (80%), Positives = 624/706 (88%), Gaps = 1/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           + L INGKAP+VAYAELIAAR+VN + P SI + FVDDKKA  A+LD  +E VF KI   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           F  IF  G  E++A WV  A  + V+KNF KLS SLE LD+ LNLRT+ILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AH+FL+KS+Q+LKK++NVGKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL LLGI+GD++T+SSDYFQEMYD C++MIK+GKAYCDDT TEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIAS+RRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKK+IDP+APR TA+VNPVK+HL+G +APQ PKTE KPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKHKK 542

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI+Y            +  +EE+TLMDWGNVIITKKN DGS+  KLNL+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADT+DV PVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+K+GDIIQFERKGYYRLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/706 (80%), Positives = 622/706 (88%), Gaps = 3/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A L+INGKAP+VAY  LIAAR+ N+    S+ +EFVDDK AAPAV +G+SE V  KI   
Sbjct: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           FP++F +  + ++A WVKTA+ ++V+KNF KL+ SL KLDA LNLRT++LGGLKYS ADI
Sbjct: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGMVGSIIKNKV VNVSRWYTL E    F  AHEFLTKSMQ+LKKAS  GKK
Sbjct: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL LLGI+GDR+T+SSDYFQ+MYD+C+++IKEG AYCDDT TEK
Sbjct: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARRDR VEENL+IFT+EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG T K YPTYDFCVP+VD++EGVTHALRTIEYRDRN QYDWMLNA++LRK
Sbjct: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVV+PVKLH++G  AP++PKTEMKPKHKK
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVIFY            LE +EEVTLMDWGNVIITK++ DGSLEGKL+L+GDF
Sbjct: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADTEDV PVDLVDFDHLI+KD+LEE ESFEDFLTP+TEF T AIADLNVK
Sbjct: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
            +KVGDIIQFERKGYYRLD+L KDGKPY+FFTIPDGKSVNRYGAKK
Sbjct: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/706 (80%), Positives = 625/706 (88%), Gaps = 2/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A L+I GKAPVVAYAELIAAR+VN+  P+SI +EFV+DKKA+PA L+G+S  V  KI+ A
Sbjct: 3   ATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIVTA 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
              +F EG +     W+K AS + V+KNFQ+L+ SLEKLDA LNLRTYI GGL ++ ADI
Sbjct: 63  NSDVFPEGAANS-TEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVADI 121

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGMVGSIIKNKV+VNVSRWYTLLE +  FGG HEFLTKS+Q+LKKAS  GKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGKK 181

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKE  EFQDSI+EDL+LLGI+GDR+T SSDYFQEMYD CV++IK+GKAYCDDT TEK
Sbjct: 242 TNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTEK 301

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MR+ERM+GIAS RRDR VEENL+IFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVI+
Sbjct: 302 MRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIF 361

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG+  K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WMLNA+ LRK
Sbjct: 362 RCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNW+DPRFPT        MTVEGLRNFVLS
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVLS 481

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIW+FNKKVIDPV PRLTAVV+PVK+HL+GEDAPQS K EMKPKH K
Sbjct: 482 QGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHPK 541

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKV+FY            +ED EE+TLM+WGN IITKKNADGSL  KL+L+GDF
Sbjct: 542 NPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGDF 601

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHK+TWLADTEDV  VDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK
Sbjct: 602 KKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 661

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGDIIQFERKGYYRLD+LA DGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 662 DMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/706 (79%), Positives = 622/706 (88%), Gaps = 1/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           + L +NGKAP VAYAELIAAR+VN + P SI ++FVDDKKA  A LD  +EGVF KI   
Sbjct: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKITGK 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           F  IF  G  E+++ W   A  + V+KNF KLS SLE LD+ LN+RT+ILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AH+FLTKS+Q+LKK++NVGKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEKEEFQDSI+EDL LLGI+GD++T+SSDYFQEM+D CV+MIK+GKAYCDDT TE+
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARR+R VEENLR+FT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTG+T K YPTYDFCVP+VDAIEGVTHALRTIEYRDRN QYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDP+APR TA+VNPVK+HL+G +APQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKK+I+Y            +  +EEVTLMDWGNVIITKKN DGS+  KL+L+GDF
Sbjct: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTKHKLTWLADT+DV PVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGDIIQFERKGYYRLDAL K+GKPYVFFTIPDGKSVNRYGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/707 (80%), Positives = 627/707 (88%), Gaps = 6/707 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPE-SINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           + L+INGKAPVVAYAELIAAR+VN    + S+ VEFVDDKK+A A  DG+S+     I+ 
Sbjct: 3   STLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAIVA 62

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
            FP+I   G +EE   W+K A+ + VIKNFQKL+ SLEKLDA LN RTYI GGLK+ +AD
Sbjct: 63  KFPEIL--GANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           IACWGALRSNGMVGSIIKNKV VNVSRWY LLE++ +FG +HEFLTKS+Q+LKKA+N GK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAGK 180

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFD
Sbjct: 181 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKEK EFQDSI+EDL+LLGI+GDR+T+SSDYFQEMY+LCVK+IKEGKAYCDDT TE
Sbjct: 241 DTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPTE 300

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           KMREERMDGIASARR+R VEENL+IFT++MKNGTEEGLKNCVRAKIDY A NKTLRDPVI
Sbjct: 301 KMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 360

Query: 361 YRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419
           YRCNLTPHHRTG+  K YPTYDFCVP+VD+IEGVTHALRTIEYRDRNAQYDW L+ +NLR
Sbjct: 361 YRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPR TA+VNPVK+H++G  AP+SPKTEMKPKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPKHK 538

Query: 540 KNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599
           KNP VGEKKVI+Y            +EDNEEVTLMDWGN+IITKKNADGS+E KL+L+GD
Sbjct: 539 KNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEGD 598

Query: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKTKHKLTWLADT+D   VDLVDFDHLISKDKLEEDESFEDFLTP+TEFHT AIADLNV
Sbjct: 599 FKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLNV 658

Query: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KD+ VGDIIQFERKGYYRLDA AKDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 659 KDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/706 (79%), Positives = 618/706 (87%), Gaps = 2/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A L+INGKAPVVAYAELIAAR+VN    ++I +EFVDDKKAAPA  +GE++  F KII A
Sbjct: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           +  +F+EG     + W K AS +++IKNFQKLSGSL KLD+ LNLRTYIL     + ADI
Sbjct: 63  YQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADI 121

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           ACWGALRSNGMVGSIIKNKV VNVSRWYT+LE D  F GAHEFLTKS+Q+LKKASN  KK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKK 181

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKEK EFQDSI+EDL LLGI+GD++T+SSDYF+EMY LCV++IKEGKAYCDDT TEK
Sbjct: 242 TNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEK 301

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERMDGIASARRDR VEENLRIF +EMKNGTEEGLKNCVRAKIDY+A NK LRDPVI+
Sbjct: 302 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIF 361

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTGTT K YPTYDFCVP+VDAIEGVTHALRTIEYRDRN QY+WML+A++LRK
Sbjct: 362 RCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRK 421

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 481

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVV PVKLHL+G+D PQ+PK EMK KHKK
Sbjct: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK 541

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NPDVGEKKVI+Y            + + EE+TLMDWGNVIITKKN+DGSL GKL+L+GDF
Sbjct: 542 NPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDF 601

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTK KLTWLADTED   VDLVDFDHLISKDKLEE ++FEDFLTPETEFHT AIADLNVK
Sbjct: 602 KKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVK 661

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGD+IQFERKGYYRLD+LAKDGKPYVFFTIPDGK+VN+YGAKK
Sbjct: 662 DMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/707 (78%), Positives = 614/707 (86%), Gaps = 4/707 (0%)

Query: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           MAKL +  KAPVVAY+ELIAAR+ N V P +I ++FV+DKKA+PA  +G S  V   I+E
Sbjct: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
           +FP+ F +G  +    W + AS + V+KNFQKLS SL+KLDA LNLRT++LGG  YS AD
Sbjct: 61  SFPEAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPAD 119

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           IACWG+LRSNGMVGSIIKN+V VNVSRWYTLLE    FG AHEFLTK++Q+LKKAS   K
Sbjct: 120 IACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNK 179

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+EYKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFD 239

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMY+LCVKMI+EGKAYCDDT TE
Sbjct: 240 DTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATE 299

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           +MREERMDGIASARRDR VEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVI
Sbjct: 300 RMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVI 359

Query: 361 YRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419
           YRCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWMLNA++LR
Sbjct: 360 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLR 419

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVVNPVK H+DG  APQ+P  +MK KHK
Sbjct: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHK 537

Query: 540 KNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599
           KNP VGEKKVI+Y            +E+ EE+TLMDWGNVI+TKKNADGSL GKL+L+GD
Sbjct: 538 KNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGD 597

Query: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKTK K+TWLADT D   VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNV
Sbjct: 598 FKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNV 657

Query: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KD+K GDIIQFERKGYYRLDA+A   KPYVFF+IPDGKSVN+YGAKK
Sbjct: 658 KDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/708 (77%), Positives = 621/708 (87%), Gaps = 6/708 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           A LII GK+ VVAY+ELIAAR+VN+V P+SI +EFV+DKKAA A L+GE++ V  KI+ A
Sbjct: 3   ATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIVSA 62

Query: 62  FPKIFTEGT--SEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAA 119
              +F EG   SEE   WVK A S+ VIKNFQKL+ SL+KLDA LNLRT+I GGL YS A
Sbjct: 63  NADVFPEGVTGSEE---WVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIA 119

Query: 120 DIACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVG 179
           DIACWGALRSNGMVGSIIKNKV+VNVSRWYTL E++  FG A+EFLTKS+Q+LKKAS+ G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAG 179

Query: 180 KKKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRF 239
           KKKE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA  YKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRF 239

Query: 240 DDTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVT 299
           DDTNPSKEK EFQ+SI+EDL LLGI+GDR+T SSDYFQEMYD C+++IKEGKAYCDDT  
Sbjct: 240 DDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPV 299

Query: 300 EKMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPV 359
           +KMREERMDGIASARR+R VEENL+IFT+EM+NGTEEGL+NCVRAKIDY+A NKTLRDPV
Sbjct: 300 DKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPV 359

Query: 360 IYRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNL 418
           IYRCNL PHHRTGT  K YPTYDFCVP+VD++EGVTHALRTIEYRDRNAQY+WMLNAMNL
Sbjct: 360 IYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNL 419

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 479 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKH 538
           +SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLT V+NP+K+HL G DAP++P+ EMKPKH
Sbjct: 480 ISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKH 539

Query: 539 KKNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDG 598
            KNP VGEK+VIF             +E+ EE+TLM+WGN II KKNADGS++  L+L+G
Sbjct: 540 PKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEG 599

Query: 599 DFKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKTKHK+TWLA+TEDV  VDLVDFDHLI+KDKLEEDESFE+FLTP TEFHT AIAD+N
Sbjct: 600 DFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVN 659

Query: 659 VKDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           VKD+KVGDIIQFERKGYYRLDAL KDGKPY+FFTIPDGK+VN+YGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/707 (76%), Positives = 610/707 (86%), Gaps = 2/707 (0%)

Query: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           M  L+INGKAPVVAYAELIA+R+VN  + ++I VEFVD+K AAP V +G S+  F KII 
Sbjct: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
            +P +F   +SEE+A W+K A    V+KNFQ+LS SLE+LDAVLNLRT+ILGGLK SAAD
Sbjct: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           I CWGALRSNGMVGSIIKNKV VNVSRWYTLLE + +FGGAHE+LTKSMQ +KKA   GK
Sbjct: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKEGHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA  YKGKLIIRFD
Sbjct: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKE+ EFQD+I+EDL+L+GI+GD++T+SSDYFQEMYDLCV++IKEGKAYCDDT  E
Sbjct: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           KMREERM+GI SA+RD  VEENLRIFT+EMKNGTE G KNCVRAKIDY+AANKTLRDPVI
Sbjct: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360

Query: 361 YRCNLTPHHRT-GTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419
           YRCNLTPHHRT G  K YPTYDFCVP+VD+IEGVTHALRTIEYRDRNAQYDWML A+ LR
Sbjct: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+
Sbjct: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVI 480

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539
           SQGPS+NVINLEWNLIWA NKK+IDPVAPR TAVV+PV++ L+GE AP++PK E+KPKHK
Sbjct: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540

Query: 540 KNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599
           KNP VGEKKVI+             LE  EE+TLMDWGN+IIT KNADGSL  K NL GD
Sbjct: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600

Query: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKTKHK+TWLA+T D  PV++VDFDHLI+KDKLEEDE+F DF+TP+TEFHT A+ D+NV
Sbjct: 601 FKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNV 659

Query: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KD+KVGDIIQFERKGY RLD+ A+  KPY+FFTIPDGKSVNRYGAKK
Sbjct: 660 KDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/706 (75%), Positives = 597/706 (84%), Gaps = 2/706 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61
           + LII  K+P VAYAELIAAR VN    +++ ++F + K+AA A  DGES+    +++E 
Sbjct: 3   STLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEK 62

Query: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121
           +P +      EE A W+  A +D V+K+F+KLSGSLEKLDA LNLRT++LGG++ + AD+
Sbjct: 63  YPDVLG-SVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADV 121

Query: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181
           A WGALRSNG VGSIIKNKV VNVSRWYT LE   AFGGAHEFL KS+++LK A NV KK
Sbjct: 122 AVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKK 181

Query: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241

Query: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301
           TNPSKE+ EFQDSI+EDL+LLGI+GDR+T SSDYFQEMYD CV+MIKEGKAYCDDT TE+
Sbjct: 242 TNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTER 301

Query: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361
           MREERM+GIASARR+R VEENL+IFT+EMKNGTEEGLKNCVRAK DY A NKTL+DPV+Y
Sbjct: 302 MREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLY 361

Query: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420
           RCNLTPHHRTGT  K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WMLNA+ LRK
Sbjct: 362 RCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRNFVLS
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLS 481

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540
           QGPSRNVINLEWNLIWAFNKKVIDP+APR T V NPVKLHL+G D PQ+P TEMKPKHKK
Sbjct: 482 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKK 541

Query: 541 NPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600
           NP VGEKKVI+Y            L   EEVTLMDWGN II  KN DGSL   LNL+GDF
Sbjct: 542 NPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDF 601

Query: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTK KLTWLADT D  PVDLVDFDHLISKD+LEE+++FEDFLTPETEFHT+AIADLNVK
Sbjct: 602 KKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVK 661

Query: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           D+KVGD+IQFER GYYRLD +    KP+VFFTIPDGK+VN+YGAKK
Sbjct: 662 DMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/707 (76%), Positives = 607/707 (85%), Gaps = 4/707 (0%)

Query: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           MAKLII  KAPVVAY+ELIAAR+VN+   ++I +EFV+DKK++PA  +   + V  +I++
Sbjct: 1   MAKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQ 60

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
            +P++F  G  E    W K AS +  +KNFQKLS SL KLDA LN RT+ILGG  +SAAD
Sbjct: 61  TYPEVFKHGF-ENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAAD 119

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           IACWG+LRSNGMVGSIIKNKV VNVSRWYTLLE    FG AHEFL K++Q+LKKAS   K
Sbjct: 120 IACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNK 179

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKE HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+EYKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFD 239

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYDLCVKMI+EG AYCDDT T+
Sbjct: 240 DTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTD 299

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           KMREERMDG+ASARRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVI
Sbjct: 300 KMREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVI 359

Query: 361 YRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419
           YRCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY WML+A++LR
Sbjct: 360 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLR 419

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPR TA+V PVK H++G  APQ+P  ++K KHK
Sbjct: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHK 537

Query: 540 KNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599
           KNP VGEKKVI+Y            + + EE+TLMDWGN I+TKKNADGSL GKL+L+GD
Sbjct: 538 KNPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGD 597

Query: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKTK KLTWLADT+D   VDLVDFDHLI+KDKLEE E F D+LTP+TEFH SA+ADLNV
Sbjct: 598 FKKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNV 657

Query: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KD+K GDIIQFERKGYYRLD+ A   KPYVFF IPDGKSVN+YGAKK
Sbjct: 658 KDMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/707 (75%), Positives = 600/707 (84%), Gaps = 3/707 (0%)

Query: 2   AKLIINGKAPVVAYAELIAARVVNTVNPE-SINVEFVDDKKAAPAVLDGESEGVFMKIIE 60
           A LII  KAPV+AY ELIAAR VN    + +I + FV+DKKAA A  +GE+E V  K+  
Sbjct: 3   ASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKLSA 62

Query: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120
           A+P I  +  S+  A W++  +   VIKNFQ+L+ SL KL+A LNLRTYIL  L+ S AD
Sbjct: 63  AYPDILNDN-SDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLAD 121

Query: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180
           IA WG LRSNGMVGSIIKNKV +NVSRWY+  E    FG AHEFLTKS+Q+LKKASNV K
Sbjct: 122 IAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVNK 181

Query: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240
           KKE HKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFD
Sbjct: 182 KKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 241

Query: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300
           DTNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYD CV+MIKEGKAYCDDT TE
Sbjct: 242 DTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 301

Query: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360
           +MREER +GI S+RR+R VEENL+IFT+EMKNGTEEGLKNCVRAKIDY+A NK +RDPVI
Sbjct: 302 RMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPVI 361

Query: 361 YRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419
           YRCNLTPHHRTGT  K YPTYDFCVP+VD++EGVTHALRTIEYRDRN QYDWMLNA++LR
Sbjct: 362 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHLR 421

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQW+VDK++VSNWDDPRFPT        MT+EGLRNFVL
Sbjct: 422 KVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 481

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539
           SQGPSRNVINLEWNLIW+FNKKVIDPVAPR TA+V+PVK+HL+G+D PQ+P  EMK KHK
Sbjct: 482 SQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKHK 541

Query: 540 KNPDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599
           KNP +GEKKVI+Y            L + EEVTLMDWGN IITKKN DGS   KL+L+GD
Sbjct: 542 KNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEGD 601

Query: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FK TK KLTWLADT+D    DLVDFDHLISKDKLEE E+FEDFLTP+TEFHT+A ADLNV
Sbjct: 602 FKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLNV 661

Query: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           KD+KVGDIIQFERKGY+RLD+L KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 662 KDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1068 bits (2761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/705 (74%), Positives = 604/705 (85%), Gaps = 2/705 (0%)

Query: 3   KLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEAF 62
           KLI++GKA  VAY ELIAAR+VN  +  ++++ FV+DKKAAPA LDG S+ V  KI+   
Sbjct: 4   KLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIVALS 63

Query: 63  PKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADIA 122
           P  F   + E++A W K A    V+KNFQ+L+ +LE LDA LNLR+++LGGL +SAAD+A
Sbjct: 64  PSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAADVA 123

Query: 123 CWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKKK 182
            WGALRSNGMVGSIIKNKV VNVSRWY+ LE + AFG +HEFLTKS+Q+LKKA+N GKKK
Sbjct: 124 VWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAGKKK 183

Query: 183 EGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDT 242
           E HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+ YKGKLIIRFDDT
Sbjct: 184 ESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDT 243

Query: 243 NPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKM 302
           NPSKEKEEF++SIIEDL LLGI+GDR+T SSDYFQEMYD C++MIKEGKAYCDDT TEKM
Sbjct: 244 NPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEKM 303

Query: 303 REERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYR 362
           REERM+G  SARR+R VEENL+IFT++M NGTEEGLKNCVRAKIDY+A NKTLRDPVIYR
Sbjct: 304 REERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 363

Query: 363 CNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKV 421
           CNLTPHH TG   K YPTYDFCVP+VD++EGVTHALRTIEYRDRNAQY+WML+A+ LR V
Sbjct: 364 CNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKLRHV 423

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        M++EGLRNFVLSQ
Sbjct: 424 HIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFVLSQ 483

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKKN 541
           GPSRNVINLEWNLIWAFNKKVIDP APR TAVVNP K+HL+G + PQ+ K EMKPKHKKN
Sbjct: 484 GPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKHKKN 543

Query: 542 PDVGEKKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDFK 601
           PDVGEKKV+F             LE+ EE TLMDWGN IITKK+A+ S+  KL+L+GDFK
Sbjct: 544 PDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEGDFK 602

Query: 602 KTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKD 661
           KTKHK+TWLADT+DV  VDLVDFDHL++KD++EE ESFEDFLT +TEFHTSAIADLNVKD
Sbjct: 603 KTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLNVKD 662

Query: 662 LKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706
           +K+GD IQFERKGYYRLD+L K+G PYVFFTIPDGK+VN+YGAKK
Sbjct: 663 MKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  221 bits (562), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 127/365 (34%), Positives = 206/365 (56%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF E+Y L   +IK GKAY      E+++  R    DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RD+ +E+NL+ F ++M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  + YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD--GEDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  V++PV++ +D   +D  +      +P     P+ GE
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRP---GTPEFGE 605

Query: 547 KKVIF 551
           + V F
Sbjct: 606 RTVPF 610

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  221 bits (562), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 161/547 (29%), Positives = 272/547 (49%), Gaps = 59/547 (10%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 256 IEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI-- 310
           I  +  LG    ++T+SSDYF ++Y+L  ++I +GK Y  +   E+++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 311 ----ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLT 366
               A   R R VEENL  F K MK+G  +  +  +R K D  + +  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEFRK-MKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWD 425
           PH RTG   + YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 426 FARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMK-PKHKKNPDV 544
           +V N++     +  +K ++   PRL  +++PV++ +D  + P S +  +  P     P+ 
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVVD--NVPDSFEDVVSIPFRPGTPEF 602

Query: 545 GEKKVIFYX---------XXXXXXXXXXXLEDNEEVTLMDWGNVIITK---KNADGSLEG 592
           GE++V F                      L   + V L+   + +I K   K++DG +  
Sbjct: 603 GEREVPFTKRVFIDRSDFSENASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKITK 662

Query: 593 ---KLNLDGDFKKTKHKLTWLADTEDV-APVDLVD---FDHLI-SKDKLEEDESFEDFLT 644
                + +G  KK K  + W+  +E   +PV + +    + L  S++     E +   + 
Sbjct: 663 IHVHYDTEGKIKKPKTYIQWVPLSEKFNSPVRIAETRVHNALFKSENPSAHPEGYLKDIN 722

Query: 645 PETEF-HTSAIADLNVKDL----------------------KVGDIIQFE--RKGYYRLD 679
           P++E  + ++I + N  D+                      K  ++ +F+  R GY+ LD
Sbjct: 723 PDSEIVYKNSIVEHNFHDILAKSPWEVDSVKNSEFYVKEDPKSKEVCRFQAMRTGYFTLD 782

Query: 680 ALAKDGK 686
             ++D +
Sbjct: 783 KDSEDNR 789

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 160/546 (29%), Positives = 267/546 (48%), Gaps = 62/546 (11%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG E  ++T+SSDYF ++YDL   +IK GKAY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
           +A   RDRP+EENL  F K M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEFRK-MRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++    RL  V++PV++ +D   ED  +      +P     P+ G+
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTIPYRP---GTPEFGD 601

Query: 547 KKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVI--------ITKKNADGSLEGKL---- 594
           + V F               D++E   +     +        ++ ++ D   +GK+    
Sbjct: 602 RTVPFTKKFFIERSDFSEAADDKEFFRLTPTQPVGLIKVPYTVSFQSVDRDSDGKIVRIH 661

Query: 595 ----NLDGDFKKTKHKLTWLA-DTEDVAPVDLVD---FDHLI-SKDKLEEDESFEDFLTP 645
               N     KK K  + W+    +  +PV + +   ++ L  S++     E + + + P
Sbjct: 662 VKYDNDQAKAKKPKAYIQWVPFSAKHNSPVTISETRVYNQLFNSENPSSHPEGYLNDINP 721

Query: 646 ETEF-HTSAIADLNV------------------------KDLKVGDIIQFERKGYYRLDA 680
           E+E  +T ++ + N                         KD K     Q  R GY+ LD 
Sbjct: 722 ESEIVYTKSLVEHNFDHVIKNSPWVVNSVKESPFYVEEEKDRKEVCRFQAMRVGYFTLDK 781

Query: 681 LAKDGK 686
            ++DGK
Sbjct: 782 DSEDGK 787

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  218 bits (556), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/365 (34%), Positives = 203/365 (55%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG    ++T+SSDYF E+Y L   +IK GK Y      E+++  R    DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RD+ +E NL+ F ++M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD--GEDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  V++PV++ +D   +D  +      +P     P+ GE
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRP---GTPEFGE 606

Query: 547 KKVIF 551
           + V F
Sbjct: 607 RTVPF 611

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  218 bits (554), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 122/334 (36%), Positives = 190/334 (56%), Gaps = 11/334 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF ++YDL   +IK  K Y      E+++  R    DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A A R RP+EE+L  F K MK+G  E  K  +R K D Q+ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEFRK-MKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   + YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD 522
           N++        +K ++   PRL  +++P+++ +D
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVD 579

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  217 bits (553), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 205/365 (56%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG +  ++T+SSDYF ++Y+L   +IK GK Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RDR +EE L  F K M+NG  +  +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEFRK-MRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG+  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  V++PV++ LD   ED  +  K   +P    +P+ GE
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRP---GSPEFGE 607

Query: 547 KKVIF 551
           ++V F
Sbjct: 608 REVPF 612

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  216 bits (549), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 199/363 (54%), Gaps = 12/363 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG E  ++T+SSDYF E+Y L   +I   K Y      E+++  R    DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RD+P+E NL+ F + M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKKNPDVGEKK 548
           N++     +  +K ++   PRL  V++P+++ +D   A    +    P     P  GE+ 
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNL-ADDFEELATIPYRPGTPAFGERT 607

Query: 549 VIF 551
           V F
Sbjct: 608 VPF 610

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  215 bits (547), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 203/365 (55%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF ++Y+L   +I+  + Y      E+++  R    DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RDRPVEE+L+ F + M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG+  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ N V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  V++P+++ +D   ED  +      +P     P+ GE
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYEEIASIPYRP---GTPEFGE 606

Query: 547 KKVIF 551
           + V F
Sbjct: 607 RNVPF 611

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  215 bits (547), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 198/363 (54%), Gaps = 12/363 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG    ++T+SSDYF ++YDL   +I  GK Y      E+++  R    DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RDRP+EENL+ F + M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKKNPDVGEKK 548
           N++     +  +K ++   PRL  +++P+++ +D           + P     P+ GE+ 
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTI-PYRAGTPEFGERT 612

Query: 549 VIF 551
           V F
Sbjct: 613 VPF 615

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  214 bits (545), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 118/337 (35%), Positives = 191/337 (56%), Gaps = 11/337 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 IEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG--- 309
              +  LG E  ++T+SSDYF ++Y+L   +IK GK Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 310 ---IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLT 366
                   R+  +E+NL  F + MK G  +  +  +R K D+ + +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWD 425
           PH RTG+  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 426 FARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD 522
           +V N++     +  +K ++   PRL  V++P+++ +D
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVD 581

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  214 bits (544), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 201/365 (55%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESIERM 304

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG    ++T+SSDYF ++Y+L   +IK GK Y      E++R  R    DG      
Sbjct: 305 VAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPGGER 364

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
           +  A R+RP+EENL  F + M++G     +  +R K D  + +  + D V YR    PH 
Sbjct: 365 LPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNAPHP 423

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG+  + YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 424 RTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++    RL  V++P+++ +D   ED  +      +P     P+ GE
Sbjct: 544 NIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSIPYRP---GTPEFGE 600

Query: 547 KKVIF 551
           + V F
Sbjct: 601 RTVPF 605

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  214 bits (544), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 201/365 (55%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---------MDG 309
           +  LG +  ++T+SSDYF ++Y+L   +I   K Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   R+RP+EENL+ F + M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD--GEDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  +++P+++ +D   +D  +      +P     P+ GE
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYRP---ATPEFGE 606

Query: 547 KKVIF 551
           + V F
Sbjct: 607 RNVPF 611

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  213 bits (543), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 191/334 (57%), Gaps = 11/334 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDG------ 309
           +  LG +  ++T+SSDYF E+Y L   +I  GK Y      E+++  R    DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 310 IASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RD+ +E NL+ F ++M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLD 522
           N++     +  +K ++   PRL  V++P+++ +D
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVVD 582

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  211 bits (538), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 148/494 (29%), Positives = 250/494 (50%), Gaps = 38/494 (7%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF ++Y+L  K+I  GKAY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   R R VEENL  F K M++G  +  +  +R K D ++ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEFRK-MRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+++ V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  V++PV++ +D   ED  +      +P     P+ GE
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTVPYRP---GTPEFGE 600

Query: 547 KKVIFYXXXXXXXXXXXXLEDNEEVTLMDWGNVI--------ITKKNADGSLEGKL---- 594
           ++V F               D++E   +     +        ++ ++ D    GK+    
Sbjct: 601 RQVPFTGKFYIERSDFSEATDDKEFFRLTPNQPVGLIKVPYTVSYQSVDKDSNGKVIRIH 660

Query: 595 ----NLDGDFKKTKHKLTWLADTEDV-APVDLVD---FDHLI-SKDKLEEDESFEDFLTP 645
               N D   KK K  + W+  +    +PV + +   ++ L  S++     E F + + P
Sbjct: 661 VKYDNEDAKPKKPKTYIQWVPVSSKYNSPVRIAETRVYNQLFKSENPSAHPEGFLNDINP 720

Query: 646 ETEF-HTSAIADLN 658
           E+E  H +++ + N
Sbjct: 721 ESELVHGNSVVEHN 734

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  208 bits (529), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 190/331 (57%), Gaps = 11/331 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF ++Y+L   +IK GK Y      E+++  R    DG      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RD+ VE+NL  F + M++G  +  +  +R K + ++ +  + D + YR    PH 
Sbjct: 361 HACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTGT  K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKL 519
           N++     +  +K ++   PRL  +++P+++
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEV 570

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  208 bits (529), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 201/365 (55%), Gaps = 16/365 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +AK   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKNM 304

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTEKMREERMDGI----- 310
           +  LG +  ++T+SSDYF ++Y+L   +I   KAY   C     ++ R  + DG      
Sbjct: 305 VAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPGGER 364

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   R R VEENL  F K M++G  +  +  +R K D ++ +  + D + YR    PH 
Sbjct: 365 RACVHRSRSVEENLTEFRK-MRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNAPHP 423

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   K YPTYDF   +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGE 546
           N++     +  +K ++   PRL  +++PV++ +D   +D  +  K   +P     P+ GE
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRP---GTPEFGE 600

Query: 547 KKVIF 551
           + V F
Sbjct: 601 RSVPF 605

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  207 bits (526), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 187/331 (56%), Gaps = 11/331 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G V TRFPPEP+GYLHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESIQRM 310

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  ++T+SSDYF ++Y+L   +IK  K Y      E+++  R    DG      
Sbjct: 311 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   RDRP+EE+L+ F + M+ G  +  +  +R K D  + +  + D + YR   +PH 
Sbjct: 371 SACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNSPHP 429

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   K YPTYDF   +VD+ E ++H+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 430 RTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVVNPVKL 519
           N++     +  +K ++   PRL  +++P+++
Sbjct: 550 NIQVARFESAIRKFLEDTTPRLMFILDPIEV 580

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  206 bits (524), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 200/367 (54%), Gaps = 14/367 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +AK   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 256 IEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI-- 310
              +  LG    ++T+SSDYF ++YDL   +I   + Y      E+++  R    DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 311 ----ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLT 366
               A   R   +E NL+ F + M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 367 PHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWD 425
           PH RTGT  K YPTYDF   +VD+ E +TH+L T E+R     Y+W+ + +++ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 426 FARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMK-PKHKKNPDV 544
           +  N++        +K ++   PRL  +++P+++ +D  + P+  +  +  P     P+ 
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVD--NLPEDYEEILSIPYRAGTPEF 607

Query: 545 GEKKVIF 551
           G++ V F
Sbjct: 608 GDRTVPF 614

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  205 bits (521), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 182/326 (55%), Gaps = 11/326 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  FAK + G   +RFDDTNP  E  E+ +SI   
Sbjct: 249 GKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESIKSM 308

Query: 259 LKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI----- 310
           +  LG +  + T+SSDYF E+Y L   +IK GKAY      E+++  R    DG      
Sbjct: 309 VSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPGGER 368

Query: 311 -ASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHH 369
            A   R+RP+EE+L  F K M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 369 KACVSRERPIEESLTEFRK-MRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHP 427

Query: 370 RTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFAR 428
           RTG   K YPTYDF   +VD++E +TH+L T E+      Y+W+ + +++ +    ++ R
Sbjct: 428 RTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 487

Query: 429 VNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V    VS W+DPR  T        +    + +F+ + G + +  
Sbjct: 488 LNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 547

Query: 489 NLEWNLIWAFNKKVIDPVAPRLTAVV 514
           N++     +  +K ++   PRL  ++
Sbjct: 548 NIQVVRFESAIRKYLEDTTPRLMFIL 573

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  199 bits (506), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 130/411 (31%), Positives = 215/411 (52%), Gaps = 26/411 (6%)

Query: 159 GGAHEFLTKSM------QDLKKASNVGKKKEGHKANFEIDLPDAKIGEVVTRFPPEPSGY 212
           GG  E   ++M       DL K   VG+  + +    E  L  A  G V TRFPPEP+GY
Sbjct: 209 GGTAEGTKRTMFTEGFLGDLHK---VGENPQAYPELMEEHL-KATGGRVQTRFPPEPNGY 264

Query: 213 LHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFS 272
           LHIGH+KA ++N  +AK + G   +RFDDTNP  E  E+ +SI   +  LG +  ++T+S
Sbjct: 265 LHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESIERMVTWLGFKPWKITYS 324

Query: 273 SDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREER---MDGI------ASARRDRPVEENL 323
           SDYF ++YDL   +I+  K Y      E+++  R    DG       + + R+R + ENL
Sbjct: 325 SDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPGGERKSCSHRERSITENL 384

Query: 324 RIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTT-KTYPTYDF 382
             F K M++G  +  +  +R K D  + +  + D + YR    PH RTG+  K YPTYDF
Sbjct: 385 AAFRK-MRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHPRTGSKWKIYPTYDF 443

Query: 383 CVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIWDFARVNFVRTLLSKRKLQ 442
              +VD+ E +TH+L T E+      Y+W+ + +++ +    ++ R+N   T+LSKRK+ 
Sbjct: 444 THCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIA 503

Query: 443 WMVDKNLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKV 502
            +V++  V  WDDPR  T        +    + +F+ + G +    N++     +  +K 
Sbjct: 504 RLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTTTTTNIQVVRFESAIRKY 563

Query: 503 IDPVAPRLTAVVNPVKLHLDG--EDAPQSPKTEMKPKHKKNPDVGEKKVIF 551
           ++    RL  +++P+++ ++   ED  +      +P     P+ G++ V F
Sbjct: 564 LEDTTARLMFLLDPIEVVVNNLPEDYQELVTIPYRP---GTPEFGDRTVPF 611

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 121/276 (43%), Gaps = 51/276 (18%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G++H+G  + AL N   AK   G+ ++R +DT+  +  E  ++ I E LK
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 261 LLGIEGDR---------LTFSSDYFQEMYDLCVKMIKEG----KAYCDDTVTEKMRE--E 305
             GIE D            F      ++Y   +K++ E     K +C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 306 RMDGIASARRDRPV----EENLRIFTKEMKNGT--------------EEGLKNCVRAKID 347
           +++  +SA  DR      EE ++   KE+ N                E+ L   +  +I 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIK--QKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQ 223

Query: 348 YQAANKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNA 407
           Y    KT  DP++ + +             PTY F   V D +  +TH +R  E+     
Sbjct: 224 YNPHKKTYDDPILIKSD-----------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTP 272

Query: 408 QYDWMLNAMNLRK---VHIWDFARVNFVRTLLSKRK 440
           ++  M NA+  +    +HI     +N  +  LSKRK
Sbjct: 273 KHISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 112/273 (41%), Gaps = 58/273 (21%)

Query: 202 VTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKL 261
           +TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+   E   +I E LK 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 262 LGI--------EGDRLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTEKMREERMDGI 310
            GI        + DRL     Y + + D        G AY   C     E++R +  +  
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLD-------SGAAYHCFCTKDRLEQLRRKNSNTP 155

Query: 311 ASARRDRP--------VEENLRI---FTKEMKNGTE-EGLKNCVRAKIDYQAANKT---- 354
            S   DR         VE NL     +T  +K+        + +  ++D Q   K     
Sbjct: 156 NSPSYDRNCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLNQKERGVW 215

Query: 355 LRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLN 414
             DP++ +           +  YPTY F   V D + G+TH +R  E+     ++     
Sbjct: 216 FDDPILIK-----------SDGYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH----- 259

Query: 415 AMNLRKVHIWDFARVNFVRTL-------LSKRK 440
            + L ++  WD  +   +  L       LSKRK
Sbjct: 260 -VALYQLFGWDMPKFIHIPLLTSIDDKKLSKRK 291

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 100/219 (45%), Gaps = 27/219 (12%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V+TRF P P+G LH+G  + AL N   AK   GK I+R +DT+ ++   E   +I + LK
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCV-KMIKEGKAYCDDTVTEKMREERMDGIA--SARRDR 317
              +E D           +Y   + K++K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 318 PVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY-----RCNLTPHHRTG 372
              + + +  + +K   ++G+   +R K          R P+I+       N+ P++R G
Sbjct: 166 ---KCIHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG 215

Query: 373 T---------TKTYPTYDFCVPVVDAIEGVTHALRTIEY 402
                     +  +PTY F   V D +  VTH +R  E+
Sbjct: 216 MWFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 100/231 (43%), Gaps = 25/231 (10%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIE 257
           +  VVTRF P P+G LH+G  + AL N   AK   GK I+R +DT+  +   E + +I++
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 258 DLKLLGIEGDRLTF-SSDYFQE-MYDLCVKMIKEG----KAYCDDTVTEKMREERMDGIA 311
            L    I+ D   +  SD  +E +Y    + + +G    K +C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 312 SARRDRPVEEN------LRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNL 365
           +   D+ V         +R    E+ +  ++ L   VR  I  +       DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSD- 214

Query: 366 TPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAM 416
                      +PTY     V D + GVTH +R  E+     ++  M  A 
Sbjct: 215 ----------RFPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 146/366 (39%), Gaps = 64/366 (17%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  E  +++I E LK
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCVK-MIKEGKAYCDDTVTEKMREERMDGI-----ASAR 314
              I  D         + +YD  VK ++  GKAY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 315 RDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTT 374
            DR       +  +E+K+   +G+   VR K   +    T  D +  + NL P       
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERYP--TFTDLLHGQINLQPQVNFNDK 219

Query: 375 K----------TYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIW 424
           +            PTY     V D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 425 ---DFARVNFVRTL----LSKR---------KLQWMVDKNLVS-----NWDDPRFPTXXX 463
               F  +  + T+    LSKR         K Q ++ + L++      W  PR      
Sbjct: 274 ACPKFIHIPLLTTVGDKKLSKRKGDMSISDLKRQGVLPEALINFCALFGWSPPR--DLAS 331

Query: 464 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK--------------KVIDPVAPR 509
                 ++E L       G ++    ++   +W FNK              +++D + P 
Sbjct: 332 KKHECFSMEELETIFNLNGLTKGNAKVDDKKLWFFNKHFLQKRILNPSTLRELVDDIMPS 391

Query: 510 LTAVVN 515
           L ++ N
Sbjct: 392 LESIYN 397

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 138/348 (39%), Gaps = 55/348 (15%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E LK
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCVK-MIKEGKAYCDDTVTEKMREERMDGI-----ASAR 314
              I  D         + +YD  VK ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 315 RDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTT 374
            DR       +  +E+++   + +   VR K   Q    T  D +    NL P       
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQYP--TFTDVLHGEINLQPQVNYNDR 219

Query: 375 K----------TYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIW 424
           +            PTY     V D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 425 DFARVNFVRTL-------LSKRKL---------QWMVDKNLVS-----NWDDPRFPTXXX 463
           D+ +   +  L       LSKRK          Q ++ + LV+      W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 464 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPV 506
                 ++E L       G ++    ++   +W FNK     ++ DPV
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 116/281 (41%), Gaps = 61/281 (21%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +  +  +++I   LK
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 261 LLGIEGD-----------------RLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTE 300
            LG++ D                 R +    Y  E+ D        GKAY   C      
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLD-------NGKAYRCFCSKERLT 156

Query: 301 KMRE--ERMDGIASARRDR--------PVEENL--------RIFTKEMKNGTEEGLKNCV 342
            ++E  +++    +A  DR         +EENL        R+ + ++    E+ L   +
Sbjct: 157 GLKESAQKLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKL 216

Query: 343 RAKIDYQAANKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEY 402
             +  Y + ++   DPV+ + +             PTY F   V D +  ++H +R  E+
Sbjct: 217 NIQPQYNSIDRRFDDPVLMKSD-----------NLPTYHFANVVDDHLMKISHVIRGEEW 265

Query: 403 RDRNAQYDWMLNAMNLRK---VHIWDFARVNFVRTLLSKRK 440
                ++  +  A   +    +HI     +N  +  LSKRK
Sbjct: 266 LPSTPKHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 101/241 (41%), Gaps = 58/241 (24%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G LHIG  + AL N   AK  +G+ ++R +DT+ ++  +  +++I + LK
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 261 LLGIEGD-------------RLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREERM 307
             GIE D             R +  ++ +Q+  D  +K     + +C         +ER+
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCS--------KERL 152

Query: 308 DGI-ASARRDRP-----------------VEENL--------RIFTKEMKNGTEEGLKNC 341
           DG+  SA+R +P                 +EE L        R+   E      + L   
Sbjct: 153 DGLRESAKRLKPPTTVTYDRKCESLSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGT 212

Query: 342 VRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIE 401
           V  +      ++   DP++ + +             PTY F   + D +  +TH +R  E
Sbjct: 213 VDIQPQVNVNDRRYDDPILIKSD-----------NLPTYHFANVIDDHLMKITHVIRGEE 261

Query: 402 Y 402
           +
Sbjct: 262 W 262

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 101/231 (43%), Gaps = 32/231 (13%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIE 257
           I  V TRF P P+G+LH+G  + AL N   AK   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 258 DLKLLGIEGD-------------RLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTEK 301
            LK  GI+ D             R +  +  +Q+  D   K++  G AY   C     + 
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYID---KLLDNGHAYRCFCPKERLDS 154

Query: 302 MRE--ERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKID--YQAANKTLRD 357
           +R+  +++    +   DR     L +   E++N    G+   VR K    Y   +  L  
Sbjct: 155 LRDSAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHG 211

Query: 358 PVIYRCNLTPHHR------TGTTKTYPTYDFCVPVVDAIEGVTHALRTIEY 402
            +  +  +  + R         +   PTY F   + D +  +TH +R  E+
Sbjct: 212 HINIQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 74/342 (21%), Positives = 137/342 (40%), Gaps = 54/342 (15%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
            VTRF P P+G LH+G  + AL N   AK+  GK I+R +DT+ S+ K+   D+I   LK
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCVK-MIKEGKAY---CDDTVTEKMREE--RMDGIASAR 314
              ++ D   +      ++Y   +  +I+ G+AY   C     + +R+   R+    +  
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVS 165

Query: 315 RDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANK--TLRDPVIYRCNLTPHHRTG 372
            DR       +   E+K+  ++G+   VR    ++A  K     D +  + +L P     
Sbjct: 166 YDRHCA---HLSEGEIKSKLDQGIPFTVR----FKAPEKYPPFEDLLHGKIDLQPQQNPS 218

Query: 373 TTK----------TYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVH 422
             +           YPTY     + D    ++H +R  E+     ++  +  A       
Sbjct: 219 DIRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAFG----- 273

Query: 423 IWD---FARVNFVRTL----LSKRK--------------LQWMVDKNLVSNWDDPRFPTX 461
            W+   F  +  + T     LSKR+               + +V+ +++  W  PR    
Sbjct: 274 -WEPPKFTHLPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPR--EL 330

Query: 462 XXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 503
                   T++   N       ++    ++   +W FNK+ +
Sbjct: 331 ASKNHECFTLQEFENLFDLDSLTKGNAKVDMKKLWFFNKQFL 372

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 108/263 (41%), Gaps = 34/263 (12%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + LK
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCVK-MIKEGKAYCDDTVTEKMREERMDGI-----ASAR 314
              I  D         + +YD  VK ++  G AY      E++ E R   +     + A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 315 RDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTT 374
            DR       +  +E+ +   +G+   VR K   +       D +    NL P       
Sbjct: 165 YDRCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYP--LFADLLHGEINLQPQVNFNDR 219

Query: 375 K----------TYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIW 424
           +            PTY     V D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 425 D---FARVNFVRTL----LSKRK 440
           D   F  +  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 96/233 (41%), Gaps = 47/233 (20%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKLL 262
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 263 GIEGD------------RLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTEKMREERM 307
           GI+ D            R +  S  ++   D   K++  G AY   C     E +R   M
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHAD---KLLASGHAYRCFCSKERLENLRTSAM 161

Query: 308 --------------DGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANK 353
                           ++    D  +++N+    +       E  ++ +  ++D Q    
Sbjct: 162 ALQPPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQPQTN 221

Query: 354 T--LR--DPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEY 402
              +R  DPV+ + +             PTY F   V D +  +TH +R  E+
Sbjct: 222 PNDIRYDDPVLMKSD-----------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 110/274 (40%), Gaps = 48/274 (17%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G+LH+G  + AL N   AK   G+ ++R +DT+  +     + S+ + LK
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 261 LLGIEGD------------RLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREE--- 305
              I+ D            R +  +  +QE  +  V+     K +C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 306 -------RMDGIASARRDRPVEENLRI---FTKEMKNGTE-EGLKNCVRAKIDYQAANKT 354
                    D   S   D+ VE NL+    FT   K+  +    ++ +  K+D Q     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 355 L----RDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYD 410
           L     DP++ + +             PTY F   + D +  +TH +R  E+     ++ 
Sbjct: 231 LDIRYDDPILMKSD-----------NLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKHT 279

Query: 411 WMLNAMNLRKVHIWDFARVNFVRTL----LSKRK 440
            +  A      H   +  +  + T     LSKRK
Sbjct: 280 ALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 98/234 (41%), Gaps = 32/234 (13%)

Query: 200 EVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDL 259
            VVTRF P P+G LHIG  + AL N   A+   GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 260 KLLGI--------EGDRLTFSSDYFQEMYD-------LCVK-MIKEGKAYCDDTVTEKMR 303
               +        + DR+    +Y  ++ +        C K  +   +A+  D     + 
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 304 EERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRC 363
           +  +  +  A   RPV   LR+ +    +  ++ L   V   I  +       DP++ + 
Sbjct: 159 DNDVRRLFDAGHTRPV---LRLKSPNKYDSFQDMLHGTV--NIQERKDRVGFDDPILMK- 212

Query: 364 NLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMN 417
                     +  +PTY F   V D +  VTH +R  E+     ++  +  A++
Sbjct: 213 ----------SDGFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKALS 256

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 130/340 (38%), Gaps = 50/340 (14%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 261 LLGIEGDRLTFSSDYFQEMYDLCVK-MIKEGKAYCDDTVTEKMREERMDGI-----ASAR 314
              IE D         + +YD  VK ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 315 RDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRCNLTPHHRTGTT 374
            DR       +  +E+ +   +G+   VR K   Q       D +    NL P       
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYP--VFTDLLHGEVNLQPQVNFNDK 219

Query: 375 K----------TYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVHIW 424
           +            PTY     V D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 425 ---DFARVNFVRTL----LSKR---------KLQWMVDKNLVS-----NWDDPRFPTXXX 463
               F  +  + T+    LSKR         K Q ++ + L++      W  PR      
Sbjct: 274 VCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR--DLAS 331

Query: 464 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 503
                 ++E L N     G ++    ++   +W FNK  +
Sbjct: 332 KRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 102/249 (40%), Gaps = 50/249 (20%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKLL 262
           TRF P P+G LHIG  + AL N   AK   G+ ++R +DT+  +     ++SI E LK  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 263 GI-----------------EGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMRE- 304
           G+                 + DR      Y  ++ DL V      + +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 305 -ERMDGIASARRDR--------PVEENL--RI-FTKEMKNGTE-EGLKNCVRAKIDYQAA 351
            +++    +   DR         ++E L  +I FT  +K+  +    ++ +   ID Q  
Sbjct: 170 AQKLQPPTTVSYDRHCAHHSTEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQ 229

Query: 352 ----NKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNA 407
               +    DP++ + +             PTY F   V D +  +TH +R  E+     
Sbjct: 230 VNPNDMRYDDPILMKSD-----------GLPTYHFANVVDDHLMKITHVVRGEEWLPSTP 278

Query: 408 QYDWMLNAM 416
           ++  + NA 
Sbjct: 279 KHIALYNAF 287

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 114/282 (40%), Gaps = 63/282 (22%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     + +I + LK
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 261 LLGIEGDR-LTFSSDYF--------QEMYDLCVK-MIKEGKAY---CDDTVTEKMREERM 307
             G+E D     + D F         E+Y   +K ++  G AY   C         +ER+
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCS--------KERL 172

Query: 308 DGI-ASARRDRP--VEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANK----------- 353
           DG+ +SA++ +P       R  T+  ++   E LK  V   +  +A  K           
Sbjct: 173 DGLRSSAQQLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQ 232

Query: 354 ------------TLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIE 401
                          DP++ + +             PTY F   V D +  +TH +R  E
Sbjct: 233 LDMQIQINMNDIRYDDPILMKSD-----------GLPTYHFANVVDDHLMRITHVIRGEE 281

Query: 402 YRDRNAQYDWMLNAMNLRK---VHIWDFARVNFVRTLLSKRK 440
           +     ++  + NA        +HI      N  +  LSKRK
Sbjct: 282 WLPSTPKHIALYNAFGWNPPQFIHIPLLTSTNDKK--LSKRK 321

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/348 (20%), Positives = 136/348 (39%), Gaps = 66/348 (18%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKLL 262
           TRF P P+G+LH+G  + AL N   AK+  G+ ++R +DT+ ++     + ++ +  K L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 263 GIEGD------------RLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMREERMDGI 310
           GI+ D            R +  ++ +++  D   ++I  G AY      E+++  R   +
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSD---QLISTGHAYRCFCSKERLKGLRDSAM 178

Query: 311 A-----SARRDRP----------------VEENLRIFTKEMKNGTEEGLKNCVRAKIDYQ 349
           A     +   DR                 V   +R+ + E+    E+ L N +  +    
Sbjct: 179 ALKPPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQIN 238

Query: 350 AANKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQY 409
             +    DP++ +           +   PTY F   + D +  +TH +R  E+     ++
Sbjct: 239 PIDVRYDDPILIK-----------SSGLPTYHFAHVIDDHLMEITHVIRGQEWLPATPKH 287

Query: 410 DWMLNAMNLRK---VHIWDFARVNFVRTLLSKRK----LQWMVDKNLVS----------N 452
             +  A        +H+   A  N  +  LSKRK    +Q + +K ++            
Sbjct: 288 IVLYKAFGWNPPQFIHLPLLASTNNKK--LSKRKGDTNIQQLREKGILPEALINFCVLFG 345

Query: 453 WDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 500
           W  P             ++  L N       ++    L+ + +W FNK
Sbjct: 346 WAPPSPEDPDRKQSYRFSLAELENLFNLNHLTKGNAKLDESRLWNFNK 393

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 98/234 (41%), Gaps = 48/234 (20%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLKLL 262
           TRF P P+G LHIG  + AL N   AK   G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 263 GIEGD-------------RLTFSSDYFQEMYDLCVKMIKEGKAY---CDDTVTEKMRE-- 304
           GI  D             R +  ++ +Q+  +   K++  G AY   C     + +RE  
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTN---KLLDSGHAYRCFCTKERLDGLRESA 163

Query: 305 ERMDGIASARRDRPV----EENLR-------IFTKEMKNGTE-EGLKNCVRAKIDYQAA- 351
           +++    +A  DR      E  +R        FT  +K+       ++ +  K+D Q   
Sbjct: 164 QKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQV 223

Query: 352 ---NKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEY 402
              ++   DP++ + +             PTY F   V D +  +TH +R  E+
Sbjct: 224 NPNDRRYDDPILVKSD-----------ALPTYHFANVVDDHLMDITHVVRGEEW 266

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 101/246 (41%), Gaps = 41/246 (16%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEFQDSIIEDLK 260
           V TRF P P+G LH+G  + AL N   AK   G+ I+R +DT+ S+  E  +++I + L+
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 261 LLGIEGDRLTFSSDYF--------QEMYDLCV-KMIKEGKAY---CDDTVTEKMREE--R 306
              +  D        F         E+Y   +  +++ G AY   C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 307 MDGIASARRDR--------PVEENL--------RIFTKEMKNGTEEGLKNCVRAKIDYQA 350
           +    +A  DR         +++NL        R+   E     ++ L   +  +    A
Sbjct: 160 LQPPTTASYDRHCAHMSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQVNA 219

Query: 351 ANKTLRDPVIYRCNLTPHHRTGTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYD 410
            +    DP++ + +             PTY F   + D +  +TH +R  E+     ++ 
Sbjct: 220 NDVRYDDPILVKSD-----------NLPTYHFANVIDDHLMEITHVIRGEEWLPSTQKHL 268

Query: 411 WMLNAM 416
            + NA 
Sbjct: 269 AIYNAF 274

>YDR180W Chr4 (821295..825776) [4482 bp, 1493 aa] {ON}  SCC2Subunit
           of cohesin loading factor (Scc2p-Scc4p), a complex
           required for loading of cohesin complexes onto
           chromosomes; involved in establishing sister chromatid
           cohesion during DSB repair via histone H2AX;
           evolutionarily-conserved adherin
          Length = 1493

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 247 EKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKM 302
           E   F   +IE LK+L IE   L    D FQE  +L  K I+ G  + DD VT K+
Sbjct: 309 EPVNFLSDLIESLKILTIEYGSLKIEFDTFQEALELLPKYIRNG-PFLDDNVTAKL 363

>Suva_7.162 Chr7 (302203..303339) [1137 bp, 378 aa] {ON} YGL105W
           (REAL)
          Length = 378

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 58  IIEAFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYS 117
           II  +P  FT+  S + A W      + V+K+ Q +   L++L+ VL   T+I+  L  +
Sbjct: 12  IISKYPVSFTKEQSAQAAQW------ESVLKSGQ-VQPHLDQLNLVLRDNTFIVSTLYPT 64

Query: 118 AADIACWGALRSNGMVGSIIKNKVDV--------NVSRWYTLLETDLAFGGAHEFLTKSM 169
           + D+  +    +  ++  ++ +  DV        ++ RW   L+  L    A +F     
Sbjct: 65  STDVHVFEV--ALPLIKELVASSKDVKSTYTQYRHIIRWIDYLQNLLEVSSADQFAINHD 122

Query: 170 QDLKK 174
            DL +
Sbjct: 123 LDLPR 127

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 172 LKKASNVGKK--KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAK 229
           +KK   +GKK  ++  +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 230 EYKGK 234
            YK +
Sbjct: 80  FYKQR 84

>Smik_4.429 Chr4 (777324..781793) [4470 bp, 1489 aa] {ON} YDR180W
           (REAL)
          Length = 1489

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 251 FQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKM 302
           F   +IE LK L  E + L    + FQE  DL  K I  G  + DD VT K+
Sbjct: 309 FLSDLIESLKTLSTEYNALKIEFNTFQEALDLLPKYICNG-PFMDDNVTAKL 359

>Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C
           (REAL)
          Length = 178

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 215 IGHAKAALLNQYFAKEYKGKLIIRFDDTNPSKEKEEF 251
           IGH K  L N Y   + K K I  FDD N ++E E++
Sbjct: 115 IGHLKDGLKNLYNISDLKSKRICLFDDENRNREVEKY 151

>ZYRO0G03982g Chr7 (322285..327141) [4857 bp, 1618 aa] {ON} some
            similarities with uniprot|P32521 YIR006C Saccharomyces
            cerevisiae PAN1 Part of actin cytoskeleton- regulatory
            complex Pan1p-Sla1p-End3p
          Length = 1618

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 97   LEKLDAVLNLRTYILGGLKYSAADIACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDL 156
            ++K++A  N    I+G +K S ADIA   +L S    GSI  N  D  V  + T LE ++
Sbjct: 1080 IKKINAGCNSNKEIIGDIKSSIADIAA--SLESGLSGGSIHANPGDFEVWEFGTRLEPEV 1137

>Skud_4.445 Chr4 (788199..792680) [4482 bp, 1493 aa] {ON} YDR180W
           (REAL)
          Length = 1493

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 247 EKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKM 302
           E   F   +IE LK+L  E D L    + FQE   L  K I  G  + DD VT K+
Sbjct: 309 EPLNFLSDLIESLKILPDEYDSLKMELNTFQEALSLLPKYIYNG-PFLDDNVTTKL 363

>NCAS0I03120 Chr9 (573421..575490) [2070 bp, 689 aa] {ON} Anc_1.141
           YCR033W
          Length = 689

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 12/114 (10%)

Query: 594 LNLDGDFKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSA 653
           L  + +++K       L   E+  P D  + D     DK EE++ F   LTP T   +S 
Sbjct: 448 LKFETEWEKDMKSFRGLTPEEEDVPDDTTELDE-SENDKFEEEDEFSS-LTPRTSSRSSR 505

Query: 654 I--ADLNVKDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAK 705
           I  AD  V D ++ D++ F+    YR   LA D  P +         V RY  K
Sbjct: 506 INRADF-VDDSELEDVL-FQIDPDYRNHQLAADIPPLIL------SPVTRYAQK 551

>KAFR0F03830 Chr6 (750178..755715) [5538 bp, 1845 aa] {ON} Anc_4.173
            YLR342W
          Length = 1845

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 12/102 (11%)

Query: 24   VNTVNPESINVEFVDDKKAAPAVLDGESEGVFMK---II--------EAFPKIFTEGTSE 72
            +N  NP S +VEF D K   P  + G  E +F +   ++        + F  +F   T  
Sbjct: 1103 MNATNPYSPDVEFEDQKNNYPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFAR-TLS 1161

Query: 73   EIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGL 114
            +I   +     D++   F    G + K    L+L   I  G+
Sbjct: 1162 QIGGKLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGM 1203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,772,865
Number of extensions: 3477484
Number of successful extensions: 10420
Number of sequences better than 10.0: 79
Number of HSP's gapped: 10570
Number of HSP's successfully gapped: 79
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)