Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056903.501ON2012019231e-128
Skud_16.4483.501ON2082165912e-77
YPR154W (PIN3)3.501ON2152155913e-77
Smik_16.4063.501ON2122155852e-76
NDAI0B059203.501ON2352355542e-71
NCAS0F036003.501ON2372405421e-69
Suva_16.4823.501ON2352175422e-69
KNAG0A079903.501ON2212295211e-66
Kwal_47.189053.501ON2362365126e-65
TPHA0A057203.501ON2202235002e-63
TBLA0C045303.501ON2222224846e-61
SAKL0F02486g3.501ON2302374785e-60
KLTH0G02332g3.501ON2332334655e-58
CAGL0F04829g3.501ON2022064419e-55
ZYRO0D09702g3.501ON1581604318e-54
KAFR0G037403.501ON2342454389e-54
Skud_7.4473.501ON2382424092e-49
YGR136W (LSB1)3.501ON2412474065e-49
Ecym_12283.501ON2532533642e-42
Smik_6.2323.501ON2411583501e-40
Suva_7.4243.501ON2491383328e-38
AFR320W3.501ON2571563312e-37
KNAG0B007503.501ON2172133021e-33
KLLA0E03873g3.501ON2201052794e-30
TBLA0D029103.501ON2691222004e-18
NCAS0A089901.356ON434511481e-10
Smik_8.811.356ON468531471e-10
Suva_15.1991.356ON457531471e-10
TBLA0D049501.356ON468661472e-10
YHR016C (YSC84)1.356ON468631462e-10
Skud_8.681.356ON475531462e-10
Kpol_480.83.501ON239301433e-10
KNAG0C020401.356ON464511427e-10
Ecym_27471.356ON452511419e-10
NCAS0A119205.470ON463701411e-09
Smik_7.3351.356ON460511401e-09
CAGL0I08965g1.356ON437641401e-09
NCAS0B072501.356ON441511401e-09
YFR024C-A (LSB3)1.356ON459511391e-09
KAFR0C044001.356ON459511392e-09
KLLA0A08360g1.356ON423681364e-09
TPHA0O012801.356ON454511364e-09
ZYRO0G20372gsingletonON150341304e-09
TDEL0D022401.356ON433511356e-09
Kwal_0.3711.356ON217511327e-09
Skud_6.1081.356ON459511348e-09
Suva_6.961.356ON455511339e-09
TBLA0F034901.356ON511511331e-08
TBLA0A025705.470ON493551321e-08
KAFR0A009701.356ON396841321e-08
NDAI0A043505.470ON459581321e-08
KAFR0E036405.470ON441571321e-08
NDAI0B045801.356ON424511322e-08
SAKL0D09702g1.356ON428511302e-08
TPHA0A022101.356ON397511303e-08
KLTH0H12980g1.356ON399511293e-08
SAKL0G03454g5.470ON468641293e-08
AEL017W1.356ON416501284e-08
AFR140C5.470ON388591284e-08
KNAG0C046305.470ON516571285e-08
KLTH0D06138g2.502ON489651276e-08
KLTH0F15114g5.470ON435641268e-08
Skud_4.6615.470ON460551268e-08
TPHA0E015005.470ON457641268e-08
TPHA0C040202.502ON485501269e-08
KAFR0D033602.502ON455601251e-07
Kpol_440.105.470ON470561251e-07
TDEL0A033405.470ON473521251e-07
ZYRO0G00792g1.356ON469511241e-07
NDAI0G059601.356ON423551242e-07
CAGL0M01650g5.470ON466551242e-07
YDR388W (RVS167)5.470ON482551242e-07
Smik_4.6585.470ON472551232e-07
Kwal_55.212875.470ON461641223e-07
ZYRO0D11110g5.470ON459551214e-07
Kpol_1008.251.356ON449511214e-07
CAGL0K02761g2.502ON450571214e-07
SAKL0E02200g2.502ON511501181e-06
TBLA0B054702.502ON539501171e-06
ABR008C2.502ON443631171e-06
Suva_8.512.502ON456501171e-06
KNAG0I015801.356ON581531162e-06
Ecym_24402.502ON459501153e-06
TDEL0A027802.502ON451501134e-06
Kpol_1056.372.502ON501501134e-06
Smik_8.472.502ON447501134e-06
ZYRO0B01298g2.502ON411501125e-06
KLLA0B13475g2.502ON508501125e-06
YHR114W (BZZ1)2.159ON633521135e-06
YHL002W (HSE1)2.502ON452501116e-06
CAGL0A02145g1.356ON391521118e-06
NCAS0A050802.502ON450761082e-05
Ecym_23165.470ON421541072e-05
Skud_8.432.502ON454501072e-05
NDAI0K021302.502ON459501055e-05
Kwal_26.79022.502ON532501047e-05
ACR266W2.159ON626491012e-04
KLLA0E03059g5.470ON428591002e-04
SAKL0G17600g4.335ON441601002e-04
AGR306C5.170ON923561002e-04
Ecym_23082.591ON678561002e-04
KLTH0E09790g2.159ON622631002e-04
TPHA0B028902.159ON63452993e-04
KNAG0A067102.502ON41950983e-04
Kwal_47.178942.159ON62159984e-04
Kpol_325.126.366ON57056976e-04
TDEL0B052202.159ON61352967e-04
Skud_8.1752.159ON63352958e-04
Kpol_1072.562.159ON63752950.001
SAKL0H21912g4.108ON1253108950.001
KLLA0F23848g2.159ON64951940.001
Skud_12.2567.365ON40360940.001
Suva_15.3102.159ON63452940.001
NDAI0B043202.159ON63292940.001
Suva_2.564singletonON4339830.002
SAKL0E10780g2.159ON62575920.002
Smik_8.1922.159ON63352920.002
TBLA0C055602.159ON67353920.003
KLLA0A04983g4.108ON125181920.003
YLR191W (PEX13)7.365ON38660900.003
Smik_12.2517.365ON38860900.004
Ecym_25266.366ON52451900.004
KLTH0E07744g4.108ON124960900.004
ABR082W2.591ON68356890.005
ZYRO0G10098g4.108ON139261890.006
TBLA0F002806.366ON57657880.007
Smik_3.1866.366ON59157880.008
Skud_3.1606.366ON58657880.008
SAKL0A00594g6.366ON63653880.008
NCAS0B069802.159ON63982880.009
Suva_3.1246.366ON60057870.009
TPHA0H023806.366ON52850870.010
Suva_10.2877.365ON39260870.010
KAFR0J026506.366ON55350870.011
Kpol_538.255.170ON70754870.012
NDAI0I002206.366ON61553860.012
KAFR0F007502.159ON60284860.012
YCR088W (ABP1)6.366ON59257860.013
AER140C4.335ON41458850.015
ADL288C2.319ON92556860.015
KLLA0C12551g2.591ON60758850.017
Suva_2.337.413ON98287840.025
KNAG0I027006.366ON57550840.025
ZYRO0D17358g6.366ON66850840.026
KLLA0E23365g8.539ON57562830.032
NCAS0D047406.366ON59450830.033
KAFR0L015807.365ON34461820.037
TDEL0E055204.45ON158990830.039
TPHA0F003804.45ON161844820.041
CAGL0C03597g6.366ON58053820.042
ZYRO0B16214g2.159ON65963820.043
TDEL0F023804.108ON125560810.054
Smik_13.2022.591ON66368810.056
KLLA0F14575g5.170ON85155810.057
SAKL0E06820g2.319ON90552810.059
TBLA0A006108.539ON59754810.059
KAFR0L018807.413ON93081810.064
YLL017WsingletonOFF10338760.068
KNAG0H035002.159ON63492800.076
TBLA0D004507.413ON100567800.081
Ecym_72314.108ON114660800.087
KNAG0B022307.413ON90457800.088
Ecym_33662.319ON90653800.088
KLTH0B04818g7.365ON38060790.089
Ecym_42288.344ON26160780.098
TBLA0H035908.539ON60067790.11
Suva_2.3268.344ON24050770.12
SAKL0H15048g8.344ON20750770.12
Skud_4.4208.344ON23350770.13
NDAI0J008508.344ON24558770.14
Kpol_2000.28.344ON22550760.15
AGL237C6.366ON57851780.15
TDEL0A078106.366ON55850770.16
NCAS0B060202.319ON864106780.16
NDAI0A033304.108ON122660780.16
Ecym_11678.539ON55058770.16
SAKL0H10098g8.539ON55582770.17
Ecym_11474.335ON42258770.17
NCAS0A034904.108ON123560770.18
NCAS0A145707.419ON35553770.18
TBLA0H011608.344ON22450760.19
TBLA0B096202.319ON94156770.20
Suva_13.2012.591ON66867770.20
Kwal_23.64376.366ON63165770.21
CAGL0E02783g4.108ON120356760.23
KAFR0E031608.539ON55466760.27
KLLA0D16874g8.344ON22788740.27
CAGL0E01045g8.344ON21363740.27
TBLA0C041004.108ON130260760.29
TPHA0K006807.419ON35547750.31
KAFR0I010404.108ON120360750.31
KLTH0A07348g6.366ON62651750.33
YDR162C (NBP2)8.344ON23650740.33
KLLA0E06953g7.419ON35752740.33
Kwal_47.174814.108ON124960750.34
Kpol_534.62.319ON88653750.34
Ecym_47107.365ON39960740.36
Skud_3.351.48ON50968740.37
KNAG0C033907.419ON34252740.37
ZYRO0A02662g2.319ON88653750.38
NDAI0A015007.413ON104754750.39
Kpol_1025.404.108ON120260750.39
KLTH0E12518g8.539ON55271740.39
Kpol_1024.458.539ON55461740.42
Ecym_71417.413ON102965740.43
ZYRO0F13882g8.344ON28853730.43
Kpol_457.12singletonON56751740.45
YMR032W (HOF1)2.591ON66967740.46
Smik_4.4068.344ON23570730.46
YCL027W (FUS1)1.48ON51272730.53
TDEL0B030708.539ON54170730.53
TDEL0C027307.413ON101692730.54
TPHA0K016004.108ON113660730.57
Smik_2.357.413ON98555730.58
Ecym_54262.159ON67248730.58
SAKL0H24222g4.45ON152655730.61
Suva_5.2397.419ON36852720.65
Kwal_27.120278.539ON49968720.67
YBL085W (BOI1)7.413ON98055730.68
AGL293C7.413ON98459720.71
TDEL0G024902.319ON85070720.74
TDEL0C028107.419ON33747720.74
NDAI0A014707.419ON36747720.74
Smik_4.1192.319ON88753720.79
TDEL0F046808.344ON26450710.81
Suva_4.1292.319ON88753720.83
AEL241W8.539ON54972710.89
Skud_2.3268.539ON55370710.91
ZYRO0B04004g7.419ON37152710.91
KAFR0K020007.419ON33247710.91
Suva_4.4548.539ON55270710.92
Suva_2.1184.108ON116650720.95
Skud_4.1372.319ON88753710.98
AGR170C4.108ON112155710.98
TPHA0K007207.413ON101166710.99
Smik_2.3408.539ON55867711.0
KLTH0C06028g7.419ON34252701.1
YBR200W (BEM1)8.539ON55167711.1
KLTH0H09416g4.45ON152866711.2
Smik_2.1134.108ON123053711.2
Kwal_27.107077.419ON34352701.3
KAFR0B058608.344ON24950691.4
NCAS0B022208.539ON55469701.5
YBL007C (SLA1)4.108ON124450701.5
TBLA0A076107.365ON41360691.5
KLLA0F10175g6.366ON57650691.7
Skud_2.237.413ON98255691.8
TBLA0I010807.413ON155554691.8
CAGL0C01881g7.413ON99951691.8
NDAI0B033302.319ON91953691.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05690
         (201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   360   e-128
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   232   2e-77
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   232   3e-77
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   229   2e-76
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   218   2e-71
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   213   1e-69
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   213   2e-69
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   205   1e-66
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   201   6e-65
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   197   2e-63
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   191   6e-61
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   188   5e-60
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   183   5e-58
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   174   9e-55
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   170   8e-54
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   173   9e-54
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   162   2e-49
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   160   5e-49
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   144   2e-42
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   139   1e-40
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   132   8e-38
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   132   2e-37
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   120   1e-33
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   112   4e-30
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    82   4e-18
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    62   1e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    61   1e-10
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    61   1e-10
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    61   2e-10
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    61   2e-10
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    61   2e-10
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...    60   3e-10
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    59   7e-10
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    59   9e-10
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    59   1e-09
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    59   1e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    59   1e-09
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    59   1e-09
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    58   1e-09
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    58   2e-09
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    57   4e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    57   4e-09
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    55   4e-09
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    57   6e-09
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   7e-09
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    56   8e-09
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    56   9e-09
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    56   1e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    55   1e-08
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    55   1e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    55   1e-08
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    55   1e-08
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    55   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    55   2e-08
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    55   3e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    54   3e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    54   3e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    54   4e-08
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    54   4e-08
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    54   5e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    54   6e-08
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    53   8e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    53   8e-08
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    53   8e-08
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    53   9e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    53   1e-07
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    53   1e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    53   1e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    52   1e-07
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    52   2e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    52   2e-07
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    52   2e-07
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    52   2e-07
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    52   3e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    51   4e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    51   4e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    51   4e-07
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    50   1e-06
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    50   1e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    50   1e-06
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    50   1e-06
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    49   2e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    49   3e-06
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    48   4e-06
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    48   4e-06
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    48   4e-06
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    48   5e-06
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    48   5e-06
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    48   5e-06
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    47   6e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    47   8e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    46   2e-05
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    46   2e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    46   2e-05
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    45   5e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    45   7e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    44   2e-04
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    43   2e-04
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    43   2e-04
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    43   2e-04
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    43   2e-04
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    43   2e-04
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    43   3e-04
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    42   3e-04
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    42   4e-04
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    42   6e-04
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    42   7e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    41   8e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    41   0.001
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    41   0.001
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    41   0.001
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    41   0.001
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    41   0.001
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    41   0.001
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    37   0.002
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    40   0.002
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.002
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    40   0.003
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    40   0.003
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    39   0.003
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    39   0.004
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    39   0.004
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    39   0.004
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    39   0.005
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    39   0.006
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    39   0.007
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    39   0.008
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    39   0.008
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    39   0.008
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    39   0.009
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    38   0.009
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    38   0.010
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    38   0.010
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    38   0.011
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    38   0.012
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    38   0.012
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    38   0.012
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    38   0.013
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    37   0.015
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    38   0.015
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    37   0.017
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    37   0.025
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    37   0.025
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    37   0.026
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    37   0.032
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    37   0.033
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    36   0.037
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    37   0.039
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    36   0.041
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    36   0.042
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    36   0.043
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    36   0.054
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    36   0.056
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    36   0.057
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    36   0.059
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    36   0.059
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    36   0.064
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    34   0.068
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    35   0.076
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    35   0.081
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    35   0.087
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    35   0.088
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    35   0.088
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    35   0.089
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    35   0.098
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    35   0.11 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    34   0.12 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    34   0.12 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    34   0.13 
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    34   0.14 
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    34   0.15 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    35   0.15 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    34   0.16 
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    35   0.16 
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    35   0.16 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    34   0.16 
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    34   0.17 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    34   0.17 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    34   0.18 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    34   0.18 
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    34   0.19 
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    34   0.20 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    34   0.20 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    34   0.21 
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    34   0.23 
KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {O...    34   0.27 
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    33   0.27 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    33   0.27 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    34   0.29 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    33   0.31 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    33   0.31 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    33   0.33 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    33   0.33 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    33   0.33 
Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa] ...    33   0.34 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    33   0.34 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    33   0.36 
Skud_3.35 Chr3 (59658..61187) [1530 bp, 509 aa] {ON} YCL027W (REAL)    33   0.37 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    33   0.37 
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    33   0.38 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    33   0.39 
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    33   0.39 
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    33   0.39 
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    33   0.42 
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    33   0.43 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    33   0.43 
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    33   0.45 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    33   0.46 
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    33   0.46 
YCL027W Chr3 (71803..73341) [1539 bp, 512 aa] {ON}  FUS1Membrane...    33   0.53 
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    33   0.53 
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    33   0.54 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    33   0.57 
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    33   0.58 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    33   0.58 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    33   0.61 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    32   0.65 
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    32   0.67 
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    33   0.68 
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    32   0.71 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    32   0.74 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    32   0.74 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    32   0.74 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.79 
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    32   0.81 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.83 
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    32   0.89 
Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W ...    32   0.91 
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    32   0.91 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   0.91 
Suva_4.454 Chr4 (790985..792643) [1659 bp, 552 aa] {ON} YBR200W ...    32   0.92 
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    32   0.95 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.98 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    32   0.98 
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    32   0.99 
Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W ...    32   1.0  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    32   1.1  
YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protei...    32   1.1  
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    32   1.2  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    32   1.2  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    32   1.3  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    31   1.4  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     32   1.5  
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    32   1.5  
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    31   1.5  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    31   1.7  
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    31   1.8  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    31   1.8  
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    31   1.8  
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    31   1.8  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    31   1.9  
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    31   2.0  
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    30   2.1  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    31   2.2  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    31   2.5  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    31   2.5  
Smik_3.50 Chr3 (73417..74958) [1542 bp, 513 aa] {ON} YCL027W (REAL)    31   2.6  
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    31   2.7  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    30   2.8  
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    31   3.0  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    30   3.1  
Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON} (1021...    30   3.1  
CAGL0B03685g Chr2 (369880..370695) [816 bp, 271 aa] {ON} similar...    30   3.4  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    30   3.4  
ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 ...    30   3.6  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    30   3.7  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    30   3.7  
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    30   4.7  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    30   4.9  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   5.0  
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    30   5.2  
Suva_3.186 Chr3 (282334..283866) [1533 bp, 510 aa] {ON} YCL027W ...    30   5.7  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     30   5.8  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    29   6.4  
KNAG0A03720 Chr1 (483214..485055) [1842 bp, 613 aa] {ON} Anc_8.5...    29   8.1  

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 177/201 (88%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKGGEYMEALYQFDPQQ 60
           MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKGGEYMEALYQFDPQQ
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKGGEYMEALYQFDPQQ 60

Query: 61  DGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSVPPPPQYEQA 120
           DGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSVPPPPQYEQA
Sbjct: 61  DGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSVPPPPQYEQA 120

Query: 121 QRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXXHHSHNHLKKFGSKL 180
           QRTNTGQSSGSYQQPFPPPSTN                        HHSHNHLKKFGSKL
Sbjct: 121 QRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQQQHHSHNHLKKFGSKL 180

Query: 181 GNAAIFGAGATMGSDLVNSIF 201
           GNAAIFGAGATMGSDLVNSIF
Sbjct: 181 GNAAIFGAGATMGSDLVNSIF 201

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  232 bits (591), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 150/216 (69%), Gaps = 23/216 (10%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51
           MSAS INRSL T+RTELDFL+ESNVIS +++D +N+SLP         ++ S+   EY+E
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPS- 110
           ALYQFDPQQDGDL L PGDK+++LEK S EW+KG CNGRVG+FPANYVK A+SGS+  S 
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGSSN 120

Query: 111 VPPPPQY-----EQAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXX 165
           +PPPPQY     +QA   N+  SS   QQPFPPPSTN                       
Sbjct: 121 LPPPPQYKAQELQQAPTQNSAVSSYQ-QQPFPPPSTN-------YYQQPQQQPQQAPPQQ 172

Query: 166 XHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
              SHNHLK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 173 QPSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  232 bits (591), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 124/215 (57%), Positives = 149/215 (69%), Gaps = 14/215 (6%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51
           MSAS INRSL  +RTELDFL+ SNVIS ++YD +N+SLP         +NAS    EY+E
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPS- 110
           ALYQFDPQQDGDL L PGDK+++LEK S EW+KG CNGR G+FPANYVK A+SGS+ PS 
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSN 120

Query: 111 VPPPPQY--EQAQRTNTGQSSGS--YQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXX 166
           +PPPPQY  ++ Q+  T  S+ S   QQPFPPPSTN                        
Sbjct: 121 LPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQH 180

Query: 167 HHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
             SH+HLK FGSKLGNAAIFGAGA++GSD+VN+IF
Sbjct: 181 QSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  229 bits (585), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 147/215 (68%), Gaps = 17/215 (7%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51
           MSAS INRSL  +RTELDFL+ESNVIS +++D +N+SLP         +N S+   EY+E
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD-RPS 110
           ALYQFDPQQDGDL L PGDKI++LEK S EW+KG CNGR G+FPANYVK A+SGS+ + +
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120

Query: 111 VPPPPQYE----QAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXX 166
           +PPPPQY+    Q   T     S   QQPFPPPSTN                        
Sbjct: 121 LPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTN---YYQQPQQAPAPAPQQQQQQQQ 177

Query: 167 HHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
            +SHNHLK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 178 PNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  218 bits (554), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 119/235 (50%), Positives = 145/235 (61%), Gaps = 34/235 (14%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKGG-----------EY 49
           MSAS INRSL  +RTELDFL+ESNVIS+E ++ +N  LPQ     G            EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRP 109
           +EA+Y F+PQQ+GDLAL  GDKI+V+EKPS EWFKG+CNG+VG+FP+NYV+ A+SG+ +P
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120

Query: 110 S----VPPPPQYEQAQRTNTGQSSG--SYQQPFPPPSTNXXXXXXXXXXXXX-------- 155
           S     P PPQY+ +  T +  SS   SYQ PFPP STN                     
Sbjct: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNYYQQPAQQPQAQYIPPPQPVQ 180

Query: 156 ---------XXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                               HH+  HLKKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 181 QVQQQVQQQPQQQQPQQQHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  213 bits (542), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 122/240 (50%), Positives = 146/240 (60%), Gaps = 42/240 (17%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP------------------QNA 42
           MSAS INRSLAT+RTELDFL+ESNVISQE +D +  +LP                     
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAA 102
            ++G E++EA+Y F+PQQ GDLAL PGDKIEV+EKPS EWFKGRCNG+ GMFP+NYVK A
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 103 YSGSD-------RPSVPPPPQYEQAQRTNTGQSSGSYQQP--FPPPSTN----------- 142
           +SGS        RP+ PP  QY+ + +T    +  S+QQP  FPP  TN           
Sbjct: 121 FSGSSGSVNKVARPNGPP--QYQNSLQTQNSHTP-SFQQPAPFPPALTNYYQQQQPQFIQ 177

Query: 143 -XXXXXXXXXXXXXXXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                                    HHSH+ LKKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 178 TPQQQQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  213 bits (542), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 117/217 (53%), Positives = 147/217 (67%), Gaps = 16/217 (7%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51
           MSAS +NRSL  +RTELDFL+ESNVIS +++D +N+SLP         + +++   EY+E
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD-RPS 110
           A+YQFDPQQDGDL L  GDK+++LEK S EW+KG CNGR G+FPANYVK  +S SD +  
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQHR 138

Query: 111 VPPPPQY--EQAQRTNTGQSS-GSYQ-QPFPPPSTN--XXXXXXXXXXXXXXXXXXXXXX 164
           +PPPPQY  ++ Q+  T  S+  SYQ QPFPPPSTN                        
Sbjct: 139 LPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQQQQ 198

Query: 165 XXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
               S+NHLK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 199 QQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  205 bits (521), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/229 (51%), Positives = 137/229 (59%), Gaps = 36/229 (15%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ---------------NASNK 45
           MSAS INRSL  VRTELDFLRES VIS+E ++ +  SLPQ               + S+ 
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSG 105
             EY+EALY F PQQDGDL L PGDKI+VLEKPS EW+KG+C G+VGMFP+NYVK A+SG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 106 S----DRPSVPP---------PPQYEQAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXX 152
                 RP+ PP          P Y+Q Q T   QSS     PFPP S N          
Sbjct: 121 ESSAPKRPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSNP---PFPPQSANYYPPQQQQQP 177

Query: 153 XXXXXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                          H HN  KKFGS+LGNAAIFGAGAT+GSD+VNSIF
Sbjct: 178 QQVVVEQQQP-----HKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  201 bits (512), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 117/236 (49%), Positives = 138/236 (58%), Gaps = 35/236 (14%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ---------NASNKGGEYME 51
           MSAS INRSL+TVRTEL+FLRESNVI++  Y  +   LP+            +   E++E
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS----D 107
           A+Y F  QQDGDL L  GDKIEVLEKPS EW+KGRCNGRVGMFP+NYVK A+SGS    +
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120

Query: 108 RPSVPPPPQYEQ----AQRTNTGQSSGSYQQPFPPPST------------------NXXX 145
           RP+VP PP+Y+      Q TNT  +S   Q PFPPPST                      
Sbjct: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQYQPQQQYQQQYYQ 180

Query: 146 XXXXXXXXXXXXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                                 H+    KKFG KLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 181 GQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  197 bits (500), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 139/223 (62%), Gaps = 25/223 (11%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ-----NA----------SNK 45
           MS S INRSL T+RTEL+FL+ES VIS  ++  +N SLP+     NA           + 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSG 105
             EY+EA+Y+FDPQQDGDLA+ PGDKI+VLEK S EW+KG CNG+VG+FP+NY K A+SG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 106 SDRPS-----VPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXX 160
           S   S       PP   +Q Q     QS  SYQQPFPP STN                  
Sbjct: 121 STNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTN---YYQQAPQQQQQQQQP 177

Query: 161 XXXXXXHHSHN--HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                 HHS+   HLK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 178 EQQQQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  191 bits (484), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 132/222 (59%), Gaps = 21/222 (9%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNA----------SNKGGEYM 50
           MS+S IN+SL+T+ TELDFL +SN I ++ Y  ++  LP+ A          S+K  E++
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRP- 109
           EA+YQFDPQQDGDL L PGDKI V EKPS EWFKG+CNG+VG+FP+NYV+ A+SGS+   
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120

Query: 110 --SVPPPPQYEQAQRTNTGQSS--------GSYQQPFPPPSTNXXXXXXXXXXXXXXXXX 159
             S   PPQY+Q     +  SS          Y Q                         
Sbjct: 121 SRSDAAPPQYQQDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQVVV 180

Query: 160 XXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                  HH H HLK FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 181 EQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  188 bits (478), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 116/237 (48%), Positives = 136/237 (57%), Gaps = 43/237 (18%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQN---------ASNKGGEYME 51
           MSAS INRSL T+RTELDFLRES VIS+E +  ++ SLPQ          +S+   EY+E
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD---- 107
           A+Y F  QQDGDL L PGDKI+VLEKPS+EW+KG+CNG VGMFP+NYVK A+SGS+    
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTR 120

Query: 108 ----------------RPSVPPPPQYEQAQRTNTGQSSGSYQQP-FPPPSTNXXXXXXXX 150
                            P+V   PQ        T  S+    QP FPPPST         
Sbjct: 121 EEPARPNLPPPPQYQSSPTVALQPQ-------QTSSSTQLASQPQFPPPSTGFYQQPPQQ 173

Query: 151 XXXXXXXXXXXXXX---XXHHSHN---HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                              H  HN     KKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 174 YYQQPPVQQSPVQQPAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  183 bits (465), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 132/233 (56%), Gaps = 32/233 (13%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51
           MSAS INRSL+TVRTEL+FLRES+VI++  Y  +  +LP         Q  S   GE++E
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSV 111
           A+Y F  QQDGDL L  GDK+EVLEKPS EWFKG+CNGRVGMFP+NYVK A+SGS     
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTTTER 120

Query: 112 PPPPQYEQA-------QRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXX 164
           P  P   Q        Q+TN    S   Q PFPP STN                      
Sbjct: 121 PVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTNYYQPPPQQYPQQYPQQQYYQAQ 180

Query: 165 XX--------------HHSH--NHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                           H S   +  KKFG KLGNAA+FGAGAT+GSD+VNSIF
Sbjct: 181 QAPVAAPVAAPAAQQGHSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  174 bits (441), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 122/206 (59%), Gaps = 9/206 (4%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASN-----KGGEYMEALYQ 55
           MS S INRSL  +R ELDFLRESNVIS+  +  +   LP N ++        EY+EALY 
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYD 60

Query: 56  FDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSVPPPP 115
           F PQQDGDLA+  GDKI+VLEKPS EW++G  NGR GMFP+NYV+ A + S   +   PP
Sbjct: 61  FQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPSANLA---PP 117

Query: 116 QYEQAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXXHHSHNHLKK 175
            Y+   + +   +  S+Q P  P                              +HN LK 
Sbjct: 118 AYDNP-KLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQPVQQSSAHNGLKS 176

Query: 176 FGSKLGNAAIFGAGATMGSDLVNSIF 201
           FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 177 FGSKLGNAAIFGAGATLGSDLVNSIF 202

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  170 bits (431), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 112/160 (70%), Gaps = 7/160 (4%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSG 105
           GGE++EA+Y+FDPQQ+GDLAL PGDKIEVLEKPS EWF+GRCNGRVGMFP+NYVK A+SG
Sbjct: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG 61

Query: 106 S-DRPSVPPPPQYEQ---AQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXX 161
             DRP+ PPPPQY+Q   A + + G +      P+PPPSTN                   
Sbjct: 62  GFDRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQQ 121

Query: 162 XXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
                HH    L KFGSKLGNAAIFGAGAT+GSDL+NSIF
Sbjct: 122 EQGKRHHG---LGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  173 bits (438), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 132/245 (53%), Gaps = 55/245 (22%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ--NASNKGG----------- 47
           MS++ INR++  ++TELDFLRES +I+Q+  D + + LP+  + S+K             
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 48  ------------------------EYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWF 83
                                   EY+EALY F+PQQ+GDL L  GDK+++LEKPS EW+
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 84  KGRCNGRVGMFPANYVKAAYSGSDRPSVPPPPQYEQAQRTNTGQSSGSYQQP------FP 137
           KG CNG++GMFPANYVK     S     PPPPQY+        Q S +YQQP      +P
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDS---FAPPPPQYQ--------QYSNNYQQPSYSQPAYP 169

Query: 138 PPSTNXXXXXXXXXXXXXXXXXXXXXXXXHHSHN-HLKKFGSKLGNAAIFGAGATMGSDL 196
           P ST                             N  LK+FGSKLGNAAIFGAGAT+GSDL
Sbjct: 170 PASTGYYQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDL 229

Query: 197 VNSIF 201
           VNSIF
Sbjct: 230 VNSIF 234

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  162 bits (409), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 132/242 (54%), Gaps = 45/242 (18%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP----------QNASNKGGEYM 50
           MSAS INRSL  +R EL+FL+ESNVIS E++  ++ +LP           NAS +  EY+
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTE--EYV 58

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS---- 106
           EALY F+ QQDGDL+L  GDKI++LEK S +W+KG+ N  +G+FPANYVK A++ S    
Sbjct: 59  EALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPD 118

Query: 107 ----------DRPSVPPP------PQYEQAQRTNTGQSSGSYQQ-----------PFPPP 139
                      RPSVPPP      P+Y   Q +        Y Q           P+PP 
Sbjct: 119 FEKTPLSSRVSRPSVPPPSYEPAVPEYSSQQVSAPNVPPLGYVQAPPLQQNQAPLPYPPS 178

Query: 140 STNXXXXXXXXXXXXXXXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNS 199
            TN                          + +  K FGSKLG+AAIFGAG+T+GSD++NS
Sbjct: 179 FTN--YYQQPQQQYAPAPQQAQPQQQSSSASSAFKSFGSKLGDAAIFGAGSTIGSDIINS 236

Query: 200 IF 201
           IF
Sbjct: 237 IF 238

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  160 bits (406), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 132/247 (53%), Gaps = 52/247 (21%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP----------QNASNKGGEYM 50
           MSAS +NRSL  +R EL+FL+ESNVIS +I++++N  LP          QNA  +  EY+
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE--EYV 58

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS---- 106
           EALY F+ QQDGDL+L  GDKI+VLEK S +W++G+ N ++G+FPANYVK A++ S    
Sbjct: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPK 118

Query: 107 ----------DRPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPS---------------- 140
                      RPSV PPP YE A      Q   +   P+ PP+                
Sbjct: 119 SAEAASSSTVSRPSV-PPPSYEPAASQYPSQQVSA---PYAPPAGYMQAPPPQQQQAPLP 174

Query: 141 -----TNXXXXXXXXXXXXXXXX-XXXXXXXXHHSHNHLKKFGSKLGNAAIFGAGATMGS 194
                TN                           + +  K FGSKLGNAAIFGAG+ +GS
Sbjct: 175 YPPPFTNYYQQPQQQYAPPSQQAPVEAQPQQSSGASSAFKSFGSKLGNAAIFGAGSAIGS 234

Query: 195 DLVNSIF 201
           D+VNSIF
Sbjct: 235 DIVNSIF 241

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  144 bits (364), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 125/253 (49%), Gaps = 52/253 (20%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSL--PQNASNKGG------EYMEA 52
           MS+S INRSLA ++TEL+FL ESNVISQ     +   L  P+  + K        EY+EA
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVLKEYVEA 60

Query: 53  LYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKA----------- 101
           LY F PQQ GDL    GDKIEVLEKPS +W+KG+ NGRVGMFP+NYVK+           
Sbjct: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD 120

Query: 102 -------------AYSGS-------------------DRPSVPPPP-QYEQAQRTNTGQS 128
                        A+S S                    +PS+PP    Y Q Q+      
Sbjct: 121 EPPPQYSLMVQDTAHSSSSNHSQLPPAPPAPIGGGYYQQPSLPPAASSYYQQQQIPMPLG 180

Query: 129 SGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXXHHSHNHLKKFGSKLGNAAIFGA 188
           S SYQQ   PP                               +  KKFGSKLGNAA+FGA
Sbjct: 181 SSSYQQNPAPPVQYQQPVAQPVVQQAAPQAVEQAQGQSSGGSDIFKKFGSKLGNAAVFGA 240

Query: 189 GATMGSDLVNSIF 201
           GATMGS+LV+ IF
Sbjct: 241 GATMGSELVHHIF 253

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  139 bits (350), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/158 (46%), Positives = 97/158 (61%), Gaps = 22/158 (13%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKG--------GEYMEA 52
           MSA+ +NRSL  +R EL+FLRESNVIS +I+D++N  LP+  ++           EY+EA
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60

Query: 53  LYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS------ 106
           LY F+ QQDGDL+L  GDKI+VLEK S +W+KG+ N RVG+FPANYVK A++ S      
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120

Query: 107 --------DRPSVPPPPQYEQAQRTNTGQSSGSYQQPF 136
                    RPSVPPP       +    Q+  SY  P 
Sbjct: 121 EGDLSSKVSRPSVPPPSYEPAVSQYPPQQTPASYAPPL 158

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (89%)

Query: 173 LKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
            K FGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  132 bits (332), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (65%), Gaps = 26/138 (18%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ----------NASNKGGEYM 50
           MSAS INRSL  +R ELDFL+ES VIS +I++++N  LP+          NAS +  E++
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE--EFV 58

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS---- 106
           EALY F+PQQ+GDL L  GDKI++LEK S +W++G+ N RVG+FPANYVK A++ S    
Sbjct: 59  EALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPE 118

Query: 107 ----------DRPSVPPP 114
                      RPS PPP
Sbjct: 119 NEGASLSSKVSRPSAPPP 136

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%)

Query: 173 LKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
            K FGSKLGNAAIFGAG+T+GSD+V+SIF
Sbjct: 221 FKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  132 bits (331), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 97/156 (62%), Gaps = 18/156 (11%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ-NASNKGG--------EYME 51
           MS++ INRSLAT+RTEL FL +S VI+++  + +  +LP  N + +G         EY+E
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD--RP 109
           ALY F  QQ GDL    G+KIEVLEKPS EW+KGRCNG+VGMFP+NYVK A+SG    + 
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120

Query: 110 SVPP-------PPQYEQAQRTNTGQSSGSYQQPFPP 138
           + PP        PQ +     +    +G  Q PFPP
Sbjct: 121 ASPPRYPAQASAPQVQSPTPQSPPPPAGFSQSPFPP 156

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 28/28 (100%)

Query: 174 KKFGSKLGNAAIFGAGATMGSDLVNSIF 201
           KKFGSKLGNAAIFGAGAT+GSDLV+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  120 bits (302), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 106/213 (49%), Gaps = 13/213 (6%)

Query: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNK--GG----------E 48
           MS   +NRS+  +RTEL++L ES VIS++ +D  N+ LP N   K  GG          E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAA-YSGSD 107
           Y+EA++++ PQ+  DL L  GDK+E+LEK S +W++G+  G+VG+FP+NYVKA  +SG D
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 108 RPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNXXXXXXXXXXXXXXXXXXXXXXXXH 167
                  P    + +          Q+    P                           H
Sbjct: 121 DAMFQDIPPSSFSTQQYVPPYVPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPKPQKQH 180

Query: 168 HSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSI 200
           H     K    + GN+ +FGAG  +GSD+VN I
Sbjct: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  112 bits (279), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 72/105 (68%), Gaps = 8/105 (7%)

Query: 6   INRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ--------NASNKGGEYMEALYQFD 57
           +  S+AT+++EL +L+E   +++  Y  +   LP+        +   +  E +EALY F 
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVADTMGQNNEIVEALYAFQ 63

Query: 58  PQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAA 102
           PQQDGDLAL PGDKIE+LEK S EW+KG+CNG+VG+FP+NYVK+ 
Sbjct: 64  PQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSV 108

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 81.6 bits (200), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 66/122 (54%), Gaps = 18/122 (14%)

Query: 6   INRSLATVRTELDFLRESNVISQEIYDMVNQSL------PQNAS-----------NKGGE 48
           I  +   +R  L+ L ++  IS+  YD +   L      P  +S             G +
Sbjct: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69

Query: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDR 108
           Y+EA+Y +  +Q GDL L PGD IEV+ K S +W++GR NG+VG+FP NYVK  YS  DR
Sbjct: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK-LYSSDDR 128

Query: 109 PS 110
            S
Sbjct: 129 DS 130

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 179 KLGNAAIFGAGATMGSDLVNSIF 201
           KLGNAA+FGAG+  G+D+VN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY+F  +Q GDL+   GDKI +L++    N+W+ GR NG+ G+FPANYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKAA 102
           ALY F  +Q GDLA   GD I +L+K    N+W+ GR NG+ G+FPANYV+  
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVRVT 468

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKAA 102
           ALY F  +Q GDLA   GD I +L+K    N+W+ GR NG+ G+FPANYV+ +
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVRVS 457

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 37  SLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMF 94
           +L Q  +N       ALY FD ++ GDL+   GD I +++K    ++W+ GRCNG  G+F
Sbjct: 401 TLSQRQTNNNLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIF 460

Query: 95  PANYVK 100
           PANYV+
Sbjct: 461 PANYVE 466

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 42  ASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYV 99
           A+N       ALY F  +Q GDLA   GD I +L+K    N+W+ GR NG+ G+FPANYV
Sbjct: 406 ATNSATPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYV 465

Query: 100 KAA 102
           + +
Sbjct: 466 RVS 468

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKAA 102
           ALY F  +Q GDLA   GD I +L+K    N+W+ GR NG+ G+FPANYV+ +
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVRVS 475

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%)

Query: 172 HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
           H K FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 210 HFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I VL+K    N+W+ GR NGR G+FPANYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  +QDGDL    GD I +L+K +  ++W+ GR NG+ G+FPANYV+
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 35  NQSLPQNASN--KGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGR 90
           N  +P  A +   GGE + ALY++  Q  GDL+   G  IE++E+    NEW+ GR NG+
Sbjct: 390 NAGMPPTAGSMTAGGETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQ 449

Query: 91  VGMFPANYVK 100
            G+FP NYV+
Sbjct: 450 QGVFPGNYVQ 459

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPA 96
           P+  ++ G     ALY F  ++ GDL+   GD I +++K    N+W+ G+ NGR G+FPA
Sbjct: 372 PRRDASSGAPKAVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPA 431

Query: 97  NYVK 100
           NYV+
Sbjct: 432 NYVE 435

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 457

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 35  NQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVG 92
           N S    A N G     ALY F  ++ GDL    GD I +++K    ++W+ GR NG+ G
Sbjct: 354 NSSANSPARNSGAPKAVALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEG 413

Query: 93  MFPANYVK 100
           +FPANYV+
Sbjct: 414 IFPANYVE 421

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL+   GD I +L+K    ++W+ GR NG+ G+FPANYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/34 (73%), Positives = 29/34 (85%)

Query: 168 HSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201
           H H+ L K GSKLGNAAIFG GAT+G+DLV+SIF
Sbjct: 117 HRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    ++W+ GR NGR G+FPANYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F+ +Q GDL    GD I +L+K    ++W+ GR NG+ G+FPANYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    N+W+ GR +GR G+FPANYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           AL+ F  ++ GDL    GD + +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL+   GD I +++K    N+W+ GR +GR G+FPANYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           E + ALY++  Q +GDL+   G  IE++++ +  NEW+ G+ NG+ G+FP NYVK
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 23  SNVISQEIYDMVNQS---LPQ-NASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKP 78
           +N   +E+Y+   Q    LPQ +  N+ G    ALY F  +++GDL    GD I ++++ 
Sbjct: 311 TNTDDEELYEHRGQHSDHLPQLSDKNQSGMKAVALYNFGGKEEGDLIFKRGDIIAIVKRS 370

Query: 79  SN--EWFKGRCNGRVGMFPANYVK 100
            +  +W+ G  NG+ G+FPANYV+
Sbjct: 371 DSQYDWWTGNLNGKEGLFPANYVE 394

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKA 101
           G E + ALY +  Q  GDL+   G  IE++E+ S  NEW+ G+ NG+ G+FP NYV+ 
Sbjct: 399 GVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQV 456

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE--WFKGRCNGRVGMFPANYVK 100
           G E + ALY++  Q  GDL+   G  IE++++ +NE  W+ GR NG+ G+FP NYV+
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++  DL    GD I +L+K    N+W+ GR NGR G+FPANYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  +Q GDL    GD + +L+K    ++W+ GR NG+ G+FPANYV+
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           AL++F  +Q GDL+ + GD + +L+K    N+W+ GR N + G+FPANYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  +Q GDL    GD I +L+K    ++W+ GR NG+ G+FPANYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPA 96
           P      G E + ALY +  Q +GDL    G  IEV+E+ +  N W+ GR NG+ G+FP 
Sbjct: 401 PTTGLQPGVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPG 460

Query: 97  NYVK 100
           NYV+
Sbjct: 461 NYVQ 464

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYV 99
           ALY F  +Q GDL    GD I +L++    ++W+ GR NG+ G+FPANYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 42  ASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYV 99
           A+    E   ALY F  Q DGDL+      IE+L++     W+ GR NGR G+FPANYV
Sbjct: 326 ATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           G E + ALY +  Q  GDL+   G  IE++++ +  NEW+ GR NG+ G+FP NYV+
Sbjct: 457 GVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 35  NQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMF 94
           N+S  QN   K    + AL+    ++  +L+   GD I V+E+   +W++GR  GRVG+F
Sbjct: 206 NESQTQNTVRK----VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIF 261

Query: 95  PANYV 99
           P NYV
Sbjct: 262 PLNYV 266

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPA 96
           P  A     E + ALY +  Q +GDL    G  IEV+E+   +N W+ GR NG  G+FP 
Sbjct: 369 PTTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPG 428

Query: 97  NYVK 100
           NYV+
Sbjct: 429 NYVQ 432

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           E + ALY +  Q  GDL+   G  IE++++   +NEW+ GR NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPA 96
           P   + + GEY  +LY++  Q  GDL+   G  I+++++ +  N+W+ G  NG+ G+FP 
Sbjct: 391 PAYTTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPG 450

Query: 97  NYVK 100
           NYV+
Sbjct: 451 NYVQ 454

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y+   Q++ +L+   GD I VLE+   +W++G  +G++G+FP NYV
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYV 283

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 40  QNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           Q +++ G + + A+Y F   +  +L+   GD I VLE+   +W++G   GR+G+FP NYV
Sbjct: 206 QPSTSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYV 265

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 47  GEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSN--EWFKGRCNGRVGMFPANYVK 100
            E   +LY++  Q  GDL+   G  IE++E+ +N  EW+ GR NG+ G+FP NYV+
Sbjct: 412 AETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKA 101
           ALY +  Q  GDL+ + G  IEV+++    NEW+ GR NG+ G+FP NYV+ 
Sbjct: 419 ALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQV 470

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    ++W+ GR  GR G+FPANYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           E + ALY F  +Q GDLA   GD I V++K    ++W+ G+   + G+FPANYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           E + ALY +  Q  GDL+   G  IEV+++    NEW+ GR NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           E + ALY +  Q  GDL+   G  IE++++    NEW+ GR NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           E + ALY +  Q  GDL+   G  IE++++    NEW+ GR NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPA 96
           P  A     E + ALY +  Q +GDL    G  IEV+E+    N W+ GR NG  G+FP 
Sbjct: 395 PTTAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQGVFPG 454

Query: 97  NYVK 100
           NYV+
Sbjct: 455 NYVQ 458

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           E + ALY +  Q  GDL+      IE++++   +NEW+ GR +G+VG+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVK 100
           ALY F  ++ GDL    GD I +L+K    ++W+ GR N   G+FPANYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           +  G   + ALY  +  +  +L+   GD I VLE+   +W++G  +G++G+FP NYV
Sbjct: 210 TTSGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYV 266

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y     +  +L+   GD I V+E+   +W++G   GRVG+FP NYV
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYV 282

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y     + G+L+   GD I+V+E+   +W++G   G VG+FP NYV
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYV 294

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 37  SLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPA 96
           SLP+    +    ++A++  +  +  +L+   GD I V+E+   +W++G   G+VG+FP 
Sbjct: 202 SLPEQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPV 261

Query: 97  NYV 99
           NYV
Sbjct: 262 NYV 264

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y     +  +L+   GD I VLE+   +W+KG   GR+G+FP NYV
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYV 275

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYVKAA 102
           AL+ F   + GDL    GD I ++++    N+W+ GR N R G+FPANYV+  
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVECV 581

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y  +  +  +L+   GD I V+E+   +W++G   G+VG+FP NYV
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYV 280

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y    ++  +L+   GD I VLE+   +W++G   G+VG+FP NYV
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYV 277

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y     +  +L+   GD I VLE+   +W+KG   G +G+FP NYV
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYV 289

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + ALY     +  +L+   GD I VLE+   +W+KG   G++G+FP NYV
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 266

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           ++ALY     +  +LA   GD I VLE+   +W++G   G +G+FP NYV
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYV 281

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y F+  +  +L+   GD I V+E+   +W++G   G VG+FP NYV
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYV 276

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           MEA+Y ++ Q D ++++ PGD I V+       W  G C+G  G+FP +Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 12/94 (12%)

Query: 40  QNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFK--GRCNGRVGMFPA 96
           QN+S+ G    + LY +  + D ++ ++PGDKI ++ + +   W K      G  G+ P 
Sbjct: 490 QNSSDDGKN--KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPT 547

Query: 97  NYVK----AAYSGSDR---PSVPPPPQYEQAQRT 123
            Y++    A    +DR   P VPPP +     RT
Sbjct: 548 TYIRISSAATVKANDRGPAPEVPPPRRSTLPVRT 581

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + ALY     +  +L+   GD I VLE+   +W+KG   G +G+FP NYV
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPS--NEWFKGRCNGRVGMFPANYV 99
           + ALY F+ QQ GDL+    D I V +K    N+W+ G  +G  G+FPANYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRP 109
           + ALY     +  +L+   GD I VLE+   +W++G   G  G+FP NYV         P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVT--------P 271

Query: 110 SVPPPPQYEQAQRTNT 125
              P PQ  Q +   T
Sbjct: 272 ISDPTPQELQMENERT 287

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 48  EYMEALYQFDPQQDGDLALSPGDKIEVLEKP-SNEWFKGRCNGRVGMFPANYVK 100
           E   +LY F  Q   DL       IE+L++  S+ W+ GR NG+ G+FP NYV+
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + ALY     +  +L+    D I VLE+   +W+KG   G++G+FP NYV
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 274

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + ALY        +L+   GD I VLE+   +W+KG+   + G+FP NYV
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYV 282

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + AL+    +   +L+   GD I V+E+   +W++G   G++G+FP NYV
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYV 278

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWFKGRCNGRVGMFPANYV 99
           A+Y +  Q D ++++  GD I+VL   + N W  G  NG  G+FP+NY 
Sbjct: 577 AIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           ++ G E   ALY +  Q +GDL    G  I+V+++     W+ G  NG  G+FP NYV+
Sbjct: 366 TSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 49  YMEALYQF--DPQQDG---DLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVKA 101
           Y  ALY +  DP Q G   DL    GD I V++K  N W+ G      R G FP N+V+ 
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVET 437

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC-----NGRVGMFPANYVKAA 102
           A Y ++   DGDL    G +IEV+    N+W+ G       N + G+FP NYV+ A
Sbjct: 15  AKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 49  YMEALYQF-DPQQDGDLALSPGDKIEVLEKPSNEWFKGRC---NGRVGMFPANYVK 100
           Y +ALY F +P ++  L    GD + + EK + +W+ G     NGR G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPAN 97
           P   S      ++AL+ ++ Q D ++++  GD I VL+      W  G  NG+ G+FP N
Sbjct: 560 PPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTN 619

Query: 98  YVK 100
           Y +
Sbjct: 620 YCQ 622

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNE-W--FKGRCNGRVGMFPANYVKAAYS-GSD 107
            L+Q+  Q + ++++SPG+ I +L   S   W   K    G  G+ P +Y++      S 
Sbjct: 495 VLFQYQKQDNDEVSVSPGNAISLLTADSGSGWTRIKNDSTGEAGLVPTSYIEINEKPRSS 554

Query: 108 RPSVPPPPQYEQAQRT 123
            P  PPP +   A RT
Sbjct: 555 APRAPPPRKSGNAART 570

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           ++ALY ++ Q D ++++S GD I V++      W  G  NG  G+FP++Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-W--FKGRCNGRVGMFPANYVKAAYSGSD 107
           + LYQ++ Q   ++++  GD I +++  +   W   K    G  G+ P +YV+     S 
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVEIKTQESR 564

Query: 108 RPSVPPPPQYEQAQRTNTGQSSGSYQ 133
            P+   PP   +   T   Q+   Y+
Sbjct: 565 GPAPVAPPSRRKTTTTRKVQALYDYE 590

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99
           + A+Y  +     +LA    D I V+E+   +W+ G    RVG+FP NYV
Sbjct: 219 VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYV 268

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 45  KGG--EYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           KGG    +EA+Y +  Q + + +L+ GD I VL+      W  G  NG  G+FP +Y K
Sbjct: 563 KGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCN--GRVGMFPANYVKAAYSGSDR 108
            LY +  Q D ++++SPGD I +L   +   W K + +  G+ G+ P  YV        R
Sbjct: 495 VLYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYVDIKEKA--R 552

Query: 109 PSVP--PPPQYEQAQRT 123
            S P  PPP+   A RT
Sbjct: 553 SSAPRAPPPRKGGATRT 569

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           GG    A Y +D  +D +L    GDKI  +E   ++W+ G     G  G+FP+NYV
Sbjct: 511 GGPSAVAEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           M+A Y ++ Q D +L+L+P D + V+       W  G  NG  G+FP +Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           MEA+Y ++ Q D ++++  GD+I V+       W  G C+G  G+FP +Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 32.3 bits (72), Expect = 0.89,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFK--GRCNGRVGMFPANYVKAAYSGS 106
           + LY +  Q D ++ ++PGDKI ++ + +   W K      G  G+ P  Y++ + + S
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAAS 557

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           +EA+Y ++   D +L++S G+ I+V+       W  G  NG  G+FP++Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 19/108 (17%)

Query: 49  YMEALYQFDPQQ--DGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYV---KA 101
           + +ALY +D  Q  D +L    GD+ +V +    +W     + +G +G  P NYV   +A
Sbjct: 73  HAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEA 132

Query: 102 AYSGSDRPSVPPPPQY--EQAQRT----NTGQSSGSYQQP----FPPP 139
              GS+  S PPPPQ+  +QA+ T    N    +  +QQ      PPP
Sbjct: 133 TPVGSN--SFPPPPQHVSKQARATTDVSNINIETDDHQQAEEDELPPP 178

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y + PQ   +LA+   D + +L+K   ++W+  K R  G      VG+ P NY++ A
Sbjct: 9   KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIEQA 68

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRCNGRVGMFPANYV 99
           M A Y +  Q   +L+L  GDKI+VL E   N W  G  NG  G+FP  Y 
Sbjct: 598 MTAAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKP-----SNEWFKGRC-NGRVGMFPANYVK 100
           E+  ALY F P+    ++AL+ GD + +L K      +++W+K R  NG++G  P NY++
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           +EA Y ++ + D ++++  GD I V+       W  G C+G  G+FP +Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFK--GRCNGRVGMFPANYVKAAYS-GS 106
           + LY +  Q   ++++SPGDKI ++ + S   W K      G  G+ P  YV+ + + G 
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRISNADGG 558

Query: 107 D-------RPSVPPPPQYEQAQRT 123
           D        P VPPP +     RT
Sbjct: 559 DAANGRGPAPEVPPPRRTALPVRT 582

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGR--CNGRVGMFPANYVKAA----- 102
           + LY +  Q   ++++SPGD I +L   +   W K R    G  G+ P  YVK       
Sbjct: 497 KVLYAYAKQDTDEISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVKITENVAV 556

Query: 103 ---YSGSDRPSVPPPPQYEQAQRTNTGQSSGS 131
              +     P+VPPP +     RT T   S S
Sbjct: 557 DGGHGNGHAPAVPPPRRTTMPSRTLTAAYSYS 588

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           + A Y +    D +++++ GD I V+       W  G  NG  G+ P +Y K
Sbjct: 581 LTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYCK 632

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 36.6 bits (83), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 64  LALSPGDKIEVLEKP--SNEWFKGRCNGRVGMFPANYVK 100
           L    G  IE++++   +NEW+ GR NG+ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNE-W--FKGRCNGRVGMFPANYVKAAYSGSDR 108
            LY +  Q   ++ ++PGD I ++ K +   W   K    G +G+ P++YV    S    
Sbjct: 499 VLYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSYVDIKESTHSV 558

Query: 109 PSVPPPPQYEQAQRT 123
           P  PPP +   + RT
Sbjct: 559 PHAPPPRKCVSSVRT 573

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE--WFKGRCNGRVGMFPANYVK 100
           +EALY +  Q D +L++  G  ++VL KP +   W  G  +G  G+FP +Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFPTSYCK 625

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           +EA+Y ++ Q D ++++  GD I V+       W  G C+G  G+FP +Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 38.1 bits (87), Expect = 0.011,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 36  QSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFK--GRCNGRVG 92
           Q+   + SNK       LY +  Q D ++++SPGD+I ++ + +   W K      G  G
Sbjct: 490 QTTSDDGSNK------VLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESG 543

Query: 93  MFPANYVK-------AAYSGSDRPSVPPPPQYEQAQRT 123
           + P  Y++        A +    P VPPP +     RT
Sbjct: 544 LVPTTYIRISTTDTATANNRGPAPEVPPPRRSTLPIRT 581

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSN--EWFKGRCNGRVGMFPANYVK 100
           M ALY ++ Q D +++L+ GD I+V+ KP +   W  G  N +  +FP +Y K
Sbjct: 617 MVALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFK--GRCNGRVGMFPANYVKAA 102
           + LY +    D +++++PGD I+V+EK +   W K      G +G+ P++Y++  
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLETV 592

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLE-KPSNEWFKGRC--NGRVGMFPANYVKAAYSGSD 107
           +A+Y F      +L +  GD I +L+ + S +W+       G+ G+ PA +V+   SGS 
Sbjct: 416 KAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVETRGSGSS 475

Query: 108 RPSVPPPPQYEQAQRTNTGQS 128
           RPS   P + +   R+ +  S
Sbjct: 476 RPSDESPSRSKSKTRSRSNTS 496

 Score = 35.4 bits (80), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +ALY +  Q D +L +  GD + +LEK S ++W+  K R  G      VG+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 52  ALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYVK 100
           ALY ++  Q+   +L     D  ++ +    +WF  K   N  VG  P NYV+
Sbjct: 76  ALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYVE 128

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKPS-----NEWFKGRC-NGRVGMFPANYVK 100
           E+  ALY F P+  + ++AL  GD + +L K       ++W+K R  NG +G  P NY++
Sbjct: 309 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIE 368

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKPS-----NEWFKGRC-NGRVGMFPANYVK 100
           E+  ALY F P+  + ++AL  GD + +L K       ++W+K R  NG +G  P NY++
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKG--RCNGRVGMFPANYVK 100
           A Y ++  +D +L    GD+I  +E   ++W+ G  +  G  G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A++Q++PQ D +LA+  GD + +L+K   ++W+  K R  G      VG+ P NY++ A
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 49  YMEALYQFDPQQDGD-LALSPGDKIEVLEKPSNEWFKGRC---NGRVGMFPANYVK 100
           Y  A+Y F    D D L    GD + + EK + +W+ G     NG+ G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKA 101
           ++ALY ++PQ D +LA+   D + +LEK   +EW+  K R  G       G+ P+NYV+ 
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 102 A 102
           A
Sbjct: 68  A 68

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVK 100
           GG    A Y ++  +D +L  +  DKI  +E   ++W+ G    +G  G+FP+NYV+
Sbjct: 517 GGATAIAQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 45  KGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           K   +  A Y +D  +D +L     DKI  +E   ++W+ G    +G  G+FP+NYV
Sbjct: 531 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 45  KGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           K   +  A Y +D  +D +L     DKI  +E   ++W+ G    +G  G+FP+NYV
Sbjct: 526 KENPWATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVKAA 102
           A Y ++  ++ +L  + GDKI  +E   ++W+ G     G  G+FP+NYV+ A
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVELA 635

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNE-W--FKGRCNGRVGMFPANYVKAAYSG-- 105
           + LY +  Q   ++ +SP D I +L   S   W   K    G  G+ P  Y+K   S   
Sbjct: 510 KVLYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNETTGESGLVPTTYIKIEESSHR 569

Query: 106 SDRPSVPPPPQYEQAQRTNTGQ 127
            + P+ PPP +     RT T +
Sbjct: 570 GNAPAAPPPRRSTLPTRTMTAK 591

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYV 99
           M A Y +  Q D +++++ GD I V+       W  G  NG  G+FP +Y 
Sbjct: 588 MTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 45  KGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           K   +  A Y +D  +D +L     DKI  +E   ++W+ G    +G  G+FP+NYV
Sbjct: 540 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFPANYV 99
           A Y +D  +D +L    G KI  +E   ++W+ G     G  G+FPANYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKPS-----NEWFKGRC-NGRVGMFPANYVK 100
           E+  ALY F P+    ++AL  GD + +L K       ++W+K R  NG +G  P NY++
Sbjct: 315 EFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYIE 374

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           A Y ++  +D +L     DKI  +E   ++W+ G    NG  G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 38.1 bits (87), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR-----VGMFPANYVK 100
           A+  ++PQ   DL +S GDKI VL    + W+ GR   +      G+FP+++VK
Sbjct: 13  AVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           +  A Y +D  ++ +L     DKI  +E   ++W+ G    NG  G+FP+NYV
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 9/84 (10%)

Query: 35  NQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGR--- 90
           NQS+  N  NK     + LY +  Q   ++ ++PGD  +V+E  +   W K +   +   
Sbjct: 465 NQSIESN-HNKN----KVLYAYAKQDADEIDVTPGDVFDVIEADTGSGWTKIKNLSQGHA 519

Query: 91  VGMFPANYVKAAYSGSDRPSVPPP 114
           VG+ P +Y++       +PSVPPP
Sbjct: 520 VGVVPTSYIEIGEPVRAKPSVPPP 543

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCNGRVGMFPANYVK 100
           +E ++ +  Q D +++++ GD + V++      W  G  NG  G+ P +Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 45  KGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           K   +  A Y +D  +D +L     DKI  +E   ++W+ G    +G  G+FP+NYV
Sbjct: 532 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 49  YMEALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKG---RCNGRVGMFPANYVKA 101
           Y  ALY +DPQ +    L++  GD I+V+ +  N W+ G   R   + G+FP +YV+ 
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTK-GLFPQSYVQV 409

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVKAAY 103
           ++A+Y +  + + DL     D IEV +   N W  GR   N + G FP NYV+  Y
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEVTKVKGN-WLYGRLLRNKKSGYFPVNYVQVLY 66

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 48  EYMEALYQF-DPQQDGDLALSPGDKIEVLEKPSNEWFKGRC---NGRVGMFPANYVKA 101
           +Y++A+Y + +P ++  L  + GD + ++E  +++W+ G     N + G+ P NYVK 
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVKV 605

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 14/87 (16%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKP---SNEWFKGRCNGRV---GMFPANYVKAAYSG 105
           A+ ++  + + +L++ PGDKIEV+      ++ W+ GR N R    G++PA + K     
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK----- 73

Query: 106 SDRPSVPPPPQYEQAQRTNTGQSSGSY 132
             + ++  P    + +   +G +SG+Y
Sbjct: 74  --KTTLNKPESLRKTRTQESGNASGNY 98

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           A Y +D  ++ +L     DKI  +E   ++W+ G    NG  G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFPANYV 99
           A Y +D  +D +L     DKI  +E    +W+ G     G  G+FP+NYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFPANYVKAAYSGSD 107
           ++ALY +  Q  G+L+ + GD   V ++  N+W++     +G+ GM P NY +    G  
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNYFEIF--GRT 124

Query: 108 RP 109
           RP
Sbjct: 125 RP 126

 Score = 32.3 bits (72), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---GMFPANYV 99
           SN G  Y   LY F  ++  +L    G+ + +      EWF  +  GR+   G+ P  +V
Sbjct: 164 SNMGTLYAIVLYDFQAEKADELTAYAGENLFICAHHDFEWFIAKPIGRLGGPGLVPVGFV 223

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           A Y ++  +D +L  S  DKI  +E   ++W+ G    +G  G+FP+NYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKPSN-----EWFKGRC-NGRVGMFPANYVK 100
           E+  A+Y F P+  + ++ L  GD + +L K  +     +W+K R  NG VG  P NY++
Sbjct: 260 EFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYIE 319

Query: 101 A 101
            
Sbjct: 320 V 320

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKG---RCNGRV--GMFPANYVKAAYSGS 106
           A++ ++ +   +L L  GD I V+ K  + W+ G     NG+V  G FP NY ++++S  
Sbjct: 53  AIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRSSHSQI 112

Query: 107 DRPSVPPPPQYEQAQRTNTGQS-SGSYQQP 135
              +     Q   +  + T +  S  YQQP
Sbjct: 113 PFKTKRRASQLRASLSSQTSRRGSLQYQQP 142

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 61  DGDLALSPGDKIEVLEKPSNEWFKGRC-NGRV---GMFPANYVK 100
           D  L  +PGDKI VL K  N W+ G   +G+V   G FP ++VK
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVK 93

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           +  A Y ++  +D +L     DKI  +E   ++W+ G     G  G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRCNGRVGMFPAN 97
           P   S K    +   Y +D Q++ ++ +  GD + VL E   + W     +G  G+ P N
Sbjct: 597 PPRGSKKPSLTLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTN 656

Query: 98  YVK 100
           Y K
Sbjct: 657 YCK 659

 Score = 35.0 bits (79), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 10/73 (13%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGRCN--GRVGMFPANYV----KAAYS 104
            +Y F  + + +++++PGD I+VL   +   W K R N  G  G+ P +Y+    K   S
Sbjct: 526 VVYAFRGRDNDEVSVNPGDSIKVLAPDTGSGWTKLRNNTTGDQGLAPTSYLEINEKPINS 585

Query: 105 GSDR---PSVPPP 114
            ++R   PSVPPP
Sbjct: 586 HAERGVPPSVPPP 598

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +ALY ++PQ   +LA+   + + +LEK   +EW+  K R  G      VG+ P+NYV+ A
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 35.8 bits (81), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 48  EYMEALYQFDPQQDGDLA-LSPGDKIEVLEKPSNEWFKGRC--------NGRVGMFPANY 98
           EY +A+Y     +   LA    GD I + E  + +W+KG          N RVG+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 99  VKAAYSGS 106
           ++  + GS
Sbjct: 656 IQLLHQGS 663

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
          {ON} some similarities with uniprot|P47068
          Saccharomyces cerevisiae YJL020C/YJL021C BBC1 Protein
          possibly involved in assembly of actin patches
          Length = 851

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR---CNGRV--GMFPANYV 99
          +EAL+ +    + DL  S G  I VLE   +EWF G     +G+   G+FP  +V
Sbjct: 7  VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa]
          {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
          YDL117W CYK3 SH3-domain protein located in the
          mother-bud neck and the cytokinetic actin ring mutant
          phenotype and genetic interactions suggest a role in
          cytokinesis
          Length = 905

 Score = 35.8 bits (81), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
          ++A+Y +  +++ DL     D IEV  K    W+ GR   N + G FPANYV
Sbjct: 12 VKAIYSWSGEKEYDLGFIEEDIIEV-TKAKGGWYYGRLLRNKKSGSFPANYV 62

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 35.8 bits (81), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---GMFPANYV 99
           Y   LY F+  ++ +L +  G+ + +      EWF GR  GR+   G+ P ++V
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFV 218

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRC--NGRVGMFPANYV-KAAYSG 105
           A+  +  + + ++++ PGDKI+V+   E  ++ W+ GR    G+ G+FP  +  K     
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFPKIFTQKLDIDA 92

Query: 106 SDRPSVPPPPQYEQAQRTNTG 126
            D PS+      E++QR   G
Sbjct: 93  QDSPSLK-----EKSQRRGDG 108

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 33.9 bits (76), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 48 EYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKG 85
          + +E  YQ+  +    L+L  GD I VL K SN W+ G
Sbjct: 29 DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 39  PQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNE-WFKGR--CNGRVGMFP 95
           PQ +S+   E  + LY +  Q D +++++PGD IE++   S   W + R    G  G+ P
Sbjct: 497 PQASSS--DEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVP 554

Query: 96  ANYVKAAYSGSDRPSVPPPPQYEQAQRTNTGQ 127
             Y+    SG   P+VPPP +   + RT T Q
Sbjct: 555 TTYISVRESGRRPPTVPPPRRNTLSMRTVTAQ 586

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 40  QNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPS---NEWFKG--RCNGRVGMF 94
           +NA  K      A+ ++  + D +L + PGDKI+VL   S   + W+ G        G++
Sbjct: 14  KNAPTKTFPLYMAVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLY 73

Query: 95  PANYVKA 101
           P N+ +A
Sbjct: 74  PLNFTQA 80

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ D +L +   D + VLEK   ++W+  K R  G      VG+ P NY++ A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS---NEWFKGRCNGR---VGMFPANYVKAA 102
            + ++  + + +L L PGD+IEVLE      + W+ G+   R   VG+FP  + K  
Sbjct: 24  VINRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTKVV 80

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVK 100
           + ALY +  +Q  DL     D IEV  K   +W  GR   N + G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKP-----SNEWFKGRCN-GRVGMFPANYVK 100
           E+  A+Y F P+    + AL  GD + V+ K      ++EW++ R   G VG  P+NYV+
Sbjct: 311 EFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYVE 370

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR-CNG-RVGMFPANYVKAAYSGSDRP 109
           ALY F P+ D +L L  GD I +  K    W      +G R G+ P  YV + + G + P
Sbjct: 121 ALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV-SIWKGDELP 179

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 36  QSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---G 92
           ++ P  +   G  Y   LY F  ++  +L +  G+ + +    + EWF  +  GR+   G
Sbjct: 149 RTTPNESIKSGNMYAIVLYDFQAEKSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPG 208

Query: 93  MFPANYV 99
           + P ++V
Sbjct: 209 LVPVDFV 215

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYV 99
           ALY F+P+ D +L L+ GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYV 99
           A+Y F P+ D +LAL  GD + +  K    W       R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYV 99
           ALY F+P+ D +L L+ GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYVKAAYSGSD 107
           ALY F+P+ D +L L   D + +  K    W       R   G+ P  YV    SG +
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLESGEE 168

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYV 99
           ALY F P+ D +L L  GD + +  K    W      GR   G+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVK 100
           A Y ++  +D +L    GD I  ++   ++W+ G     G+ G+FP+NYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           A Y ++  ++ +L  +  DKI  ++   ++W+ G    NG  G+FP+NYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 23/106 (21%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYV------- 99
           + A Y +  Q  GDL    GD +EV  + + +WF GR   N +  G FP N+V       
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIPLEERL 71

Query: 100 --------KAAYSGSDRPSVPPPPQYEQAQRTNTGQSSGSYQQPFP 137
                     + + S + S+PP P    ++  +  QS  +Y Q  P
Sbjct: 72  NEAIPLVADMSNTVSSKVSIPPVP----SRSVHKQQSKMTYSQSSP 113

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +L L   D + +LEK   ++W+  K R  G      VG+ P+NY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANY 98
           SN+    ++ALY +  Q  G+L+ + G+ + V+ +   EWF+     +GR GM P +Y
Sbjct: 62  SNEVPIILKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSY 118

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---GMFPANYV 99
           G  Y   LY F  ++  +L+   G+ + +    + EWF  +  GR+   G+ P  +V
Sbjct: 147 GSLYAIVLYDFKAEKSDELSAFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 203

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFPANYVKAAYSGSD 107
           ++A+Y +  Q  G+L+   GD   VL +   EW+      +G+ GM P +Y +    G  
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPKSYFEIF--GRT 127

Query: 108 RP-------SVPPPPQYEQAQR 122
           RP       S   P Q++Q Q+
Sbjct: 128 RPGSVNGSGSFDSPLQHQQVQQ 149

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 35  NQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV--- 91
           +Q + Q  S  G  Y   LY F  ++  +L    G+ + V    + EWF  +  GR+   
Sbjct: 144 HQQVQQMPSKMGSLYAIVLYDFQAEKSDELTSYAGENLFVCAHHNYEWFIAKPIGRLGGP 203

Query: 92  GMFPANYV 99
           G+ P  +V
Sbjct: 204 GLVPVGFV 211

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 49  YMEALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKG---RCNGRVGMFPANYVKA 101
           Y   LY ++PQ +    L++  GD I+++ +  N W+ G   R   + G+FP +YV+ 
Sbjct: 361 YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTK-GLFPQSYVQV 417

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +L +   D + +LEK   +EW+  K R  G      VG+ P+NY++ A
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 44/120 (36%), Gaps = 35/120 (29%)

Query: 50  MEALYQFDP--QQDGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYVK----- 100
           M+ALY +     Q+ +L     D  +V +    +W   K R +  VG  P NYV+     
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEPVGGA 133

Query: 101 -----------------AAYSGSDRPSVPPPPQ----YEQAQRTNTGQSSGSYQQPFPPP 139
                             A +  D  +  PPPQ     EQ Q T     +   Q+P P P
Sbjct: 134 PATAPGMVPAIVAASPTTATTNVDVSTFLPPPQRVDRVEQKQET-----APKIQEPTPEP 188

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 50  MEALYQF--DPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           ++ALY +  D     +L+   GD ++V +     W   + NG+ G+ P+NYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFPANYV 99
           ALY F P+ D +L L  GD I +  K    W   +   N ++G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYVKAA 102
           ++A Y +  Q  GDL    GD +EV  K + +W+ GR   N +  G FP N+VK  
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFVKIV 69

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 48  EYMEALYQFDPQQDGDLA-LSPGDKIEVLEKPSNEWFKGRC--------NGRVGMFPANY 98
           EY +A+Y     +   LA    GD I + E  + +WFKG          + RVG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 99  VKAAYSG 105
           ++  + G
Sbjct: 661 IQLLHQG 667

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 41  NASNKGGEYME---ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFP 95
           +AS + GE +    A Y  + ++  +LA   GDKI  +    ++W+ G     G  G+FP
Sbjct: 564 SASPEQGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFP 623

Query: 96  ANYVK 100
           +NYV+
Sbjct: 624 SNYVQ 628

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRC--NGRVGMFPANYVKAAYS 104
           ALY F+ +   +L +  GD + V+ +K S +W+      NG+ G+ PA +++ + S
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIEFSKS 432

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +LA+   D + +LEK   ++W+  K R  G       G+ P+NY++AA
Sbjct: 9   KAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNYIEAA 68

>KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {ON}
           Anc_8.539 YBR200W
          Length = 554

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 37  SLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---GM 93
           S+  N  N G  Y   LY F  ++  +L+   G+ + +    + EWF  +  GR+   G+
Sbjct: 139 SVNSNTGNLGSLYAIVLYDFKAEKSDELSSFVGENLFICAHHNYEWFIAKPIGRLGGPGL 198

Query: 94  FPANYV 99
            P  +V
Sbjct: 199 VPVGFV 204

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 33/88 (37%), Gaps = 22/88 (25%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYVKAAYSGSDRP 109
           A+Y F P+ D +L L  GD + +  K    W     + R   G+ P  YV+         
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLI------- 119

Query: 110 SVPPPPQYEQAQRTNTGQSSGSYQQPFP 137
                         + G+ +G Y+ P P
Sbjct: 120 -------------EDDGEDNGRYENPRP 134

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR--CNGRVGMFP---ANYVKAAYSGS 106
           ALY F+P+ D +L L  GD I +  +    W   +     + G+ P    +Y+ +  S S
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFVSYLDSEESDS 160

Query: 107 DRP 109
            RP
Sbjct: 161 VRP 163

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +LA+   D + +LEK   ++W+  K R  G       G+ P+NYV+ A
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVEEA 68

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 50  MEALYQFDPQQ--DGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYVKAAYSG 105
           ++A+Y +D  Q  D +L  +  +  +V +    +W   K R   +VG  P NYV+    G
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEPISGG 133

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 54  YQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           YQ D     +++   G+ ++V +     W   R NG+VG+ P+NYV+
Sbjct: 305 YQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +LAL   D + +LEK   ++W+  K R  G       G+ P+NY++ A
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYVK 100
           A Y  + ++  +LA   GDKI  +    ++W+ G     G  G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYV 99
           ALY F+P+ D +L L+ GD + +  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 51  EALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           EALY +   Q    +++   G+ + V +     W   + NG  G+ P+NYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa]
           {ON} YBL007C (SLA1) - contains 3 SH3 domains, interacts
           with Bee1p [contig 207] FULL
          Length = 1249

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A++Q+ PQ + +LA+   D + +L+K   ++W+  K R  G      VG+ P NY++ A
Sbjct: 9   KAVFQYTPQSEEELAIEEDDLLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
          (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKG---RCNGRVGMFPANYV 99
          + A Y +  Q  GDL    GD +EV +K + +WF G   R     G FP N+V
Sbjct: 10 VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEK--PS---NEWFKGRCN-GRVGMFPANYVK 100
           E+  A+Y F P+    + +L  GD + ++ K  P+   ++W+K R   G VG  P+NY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>Skud_3.35 Chr3 (59658..61187) [1530 bp, 509 aa] {ON} YCL027W (REAL)
          Length = 509

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEW-FKGRCNGRVGMFPANYVKAAYS 104
           GG Y   +  ++P+   ++++S G+K+++L   ++ W    +CN R      +     Y 
Sbjct: 435 GGTYT-VIQDYEPRLTDEISISLGEKVKILATHTDGWCLVEKCNARNNCVRVSVDDKRYL 493

Query: 105 GSDRPSVP 112
             DR  VP
Sbjct: 494 NEDRGIVP 501

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 51  EALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           +ALY +D   +   +++   G+ ++V +     W   R NG  G+ P+NYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
          to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
          SH3-domain protein located in the mother-bud neck and
          the cytokinetic actin ring mutant phenotype and genetic
          interactions suggest a role in cytokinesis
          Length = 886

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYV 99
          ++A Y +  Q  GDL    GD +EV  + + +WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRC--NGRVGMFPANYVK 100
            + ++  + + +L + PGDKIEVL   E+ ++ W+ GR    G  G++P  + +
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYPVVFTQ 99

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +L +   D + +LEK + ++W+  K R  G       G+ P+NYV+ A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369)
           [1659 bp, 552 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 552

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 36  QSLPQNAS----NKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV 91
           Q LP N+S      G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+
Sbjct: 139 QQLPVNSSFISQRSGSLYAIVLYDFRAEKSDELTTYAGENLFICAHHNYEWFIAKPIGRL 198

Query: 92  ---GMFPANYV 99
              G+ P  +V
Sbjct: 199 GGPGLVPVGFV 209

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 42  ASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---GMFPANY 98
           +S  G  Y   LY F  ++  +L +  G+ + +    + EWF  +  GR+   G+ P ++
Sbjct: 149 SSKMGSLYAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDF 208

Query: 99  V 99
           V
Sbjct: 209 V 209

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRC--NGRVGMFPANYVKAAYSGS 106
           A+ ++  + + +L + PGDKIE +   ++ ++ W+ GR    G  G++P  + +    G 
Sbjct: 56  AINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEEGLYPKLFTQVISIGR 115

Query: 107 DRPSV 111
             P++
Sbjct: 116 STPNI 120

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYVKAA 102
           ALY F+P+ D +L L  GD + +  +    W       R   G+ P  +V  A
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGR---CNGRVGMFPANYV 99
            LY F P++  +L  + GDKI +    ++EWF       +G+  + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 48  EYMEALYQFDPQQDGDLA-LSPGDKIEVLEKPSNEWFKGRC--------NGRVGMFPANY 98
           EY +A+Y     +   LA    GD + + E  + +W+KG          N R+G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 99  VKAAYSG 105
           ++  + G
Sbjct: 662 IQLLHQG 668

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 4/70 (5%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGR--VGMFPANYVKAAYS--GSD 107
           ALY F+P+ D +L L+ G+ + +  K    W       R   G+ P  +V    S  G D
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQSEDGED 176

Query: 108 RPSVPPPPQY 117
                  P Y
Sbjct: 177 ELENKARPFY 186

>YCL027W Chr3 (71803..73341) [1539 bp, 512 aa] {ON}  FUS1Membrane
           protein localized to the shmoo tip, required for cell
           fusion; expression regulated by mating pheromone;
           proposed to coordinate signaling, fusion, and
           polarization events required for fusion; potential
           Cdc28p substrate
          Length = 512

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 42  ASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEW-FKGRCNGRVGMFPANYVK 100
           AS + G+    +  ++P+   ++ +S G+K+++L   ++ W    +CN + G    +   
Sbjct: 433 ASVQLGKTYTVIQDYEPRLTDEIRISLGEKVKILATHTDGWCLVEKCNTQKGSIHVSVDD 492

Query: 101 AAYSGSDRPSVP 112
             Y   DR  VP
Sbjct: 493 KRYLNEDRGIVP 504

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 3/70 (4%)

Query: 33  MVNQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV- 91
           +V++    + S  G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+ 
Sbjct: 136 IVSRRSSHDQSKMGTLYAIVLYDFQAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLG 195

Query: 92  --GMFPANYV 99
             G+ P  +V
Sbjct: 196 GPGLVPVAFV 205

>TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {ON}
           Anc_7.413 YER114C
          Length = 1016

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 8/92 (8%)

Query: 26  ISQEIYDMVNQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVL---EKPSNEW 82
           +S E+     QS   ++  K      A+ ++  + + +L + PGDKI+V+   E+ ++ W
Sbjct: 19  LSSELASNTTQSTCSSSGMKPCPMYIAINEYTKRMEDELDMKPGDKIQVITTDEEYNDGW 78

Query: 83  FKGRCNGRV---GMFPANYVKAAYSGSDRPSV 111
           F GR N R    G++P  + +   S   RPS 
Sbjct: 79  FYGR-NLRTKEEGLYPMVFTQ-EISIEQRPSA 108

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           +A+Y ++PQ   +LA+   D + +LEK   ++W+  K R  G       G+ P+NY++ A
Sbjct: 9   KAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKKRVIGSDAEEPSGLIPSNYIEEA 68

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKP---SNEWFKGRCNGRV---GMFPANYVK 100
           A+ ++  + + +L + PGDKIEV+      ++ W+ GR N R    G++PA + K
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 32.7 bits (73), Expect = 0.58,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRCNGRVGMFPANY 98
           A+Y +  +   ++++  GD I+V+ +   N W  G   G  G+FP+NY
Sbjct: 623 AVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNY 670

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC-----NGRVGMFPANYVKA 101
           A Y + P +   L L  GD + VL K  + W+ G           G FP NY K+
Sbjct: 28  ATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSKS 82

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 51  EALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           +ALY +D   D   +++    + ++V +     W   R NG  G+ P+NYV+
Sbjct: 307 KALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]
           {ON} YBR200W (BEM1) - contains two SH3 domains [contig
           24] FULL
          Length = 499

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 3/68 (4%)

Query: 35  NQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV--- 91
           N +   N+   G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+   
Sbjct: 83  NHASMNNSQKSGSLYAIVLYDFRAEKSDELTTYAGENLFICAHHNYEWFIAKPIGRLGGP 142

Query: 92  GMFPANYV 99
           G+ P  +V
Sbjct: 143 GLVPVGFV 150

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKP---SNEWFKGRCNGRV---GMFPANYVK 100
           A+ Q+  + + +L + PGDKI+V+      ++ W+ GR N R    G++PA + K
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 35/59 (59%), Gaps = 6/59 (10%)

Query: 47  GEYMEALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRC--NGRVGMFPANYVK 100
           G Y+ A+ ++  + + +L + PGDKIEV+   ++ ++ W+ GR    G  G++P  + +
Sbjct: 30  GTYI-AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQ 87

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYVKAAYSGS 106
           ++A Y +  Q  GDL    GD +EV  + + +WF G+   N +  G FP N+V       
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFVNVLEEQL 71

Query: 107 DRPSVPPPPQ 116
           ++ ++   P+
Sbjct: 72  NKSTLAESPE 81

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 54  YQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           YQ D     +++   G+ ++V +     W   R NG  G+ P+NYV+
Sbjct: 284 YQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 54  YQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           YQ D     +++   G+ ++V +     W   R NG+ G+ P+NYV+
Sbjct: 317 YQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYV 99
          ++A Y +  Q  GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYV 99
           ALY F+P+ D +L L+ GD + +  +    W   + +   + G+ P  +V
Sbjct: 121 ALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYV 99
          ++A Y +  Q  GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 15/72 (20%)

Query: 41  NASNKGGE------------YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCN 88
           N SN+GG+             ++ALY +  Q  G+L+ + G+  +V      EW++    
Sbjct: 46  NTSNRGGKNGAVAGAVDVPIILKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTST 104

Query: 89  --GRVGMFPANY 98
             GR GM P +Y
Sbjct: 105 EGGRKGMVPKSY 116

>Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W
           (REAL)
          Length = 553

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 33  MVNQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV- 91
           + N+SL     N G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+ 
Sbjct: 149 VTNESL-----NMGSLYAIVLYDFKAEKADELTTFVGENLFICAHHNCEWFIAKPIGRLG 203

Query: 92  --GMFPANYV 99
             G+ P  +V
Sbjct: 204 GPGLVPVGFV 213

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 51  EALYQFDPQQDG--DLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           + LY++   +D   +++   G+ ++V +     W   R  G  G+ P+NYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 54  YQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           YQ D     +++   G+ + V +     W   R NG  G+ P+NYV+
Sbjct: 278 YQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>Suva_4.454 Chr4 (790985..792643) [1659 bp, 552 aa] {ON} YBR200W
           (REAL)
          Length = 552

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 33  MVNQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV- 91
           + N+SL     N G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+ 
Sbjct: 149 VTNESL-----NMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLG 203

Query: 92  --GMFPANYV 99
             G+ P  +V
Sbjct: 204 GPGLVPVGFV 213

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 54  YQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRC--NGRVGMFPANYVK 100
           Y F  +   +L +  GDK+ +L +K S++W+  +   +G+ G+ PA +V+
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVE 403

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           A+Y ++PQ   +LA+   D + +L+K   ++W+  K R  G      VG+ P+ Y++ A
Sbjct: 10  AIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWWTVKRRVIGSDSDEPVGLVPSTYIEEA 68

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
          (REAL)
          Length = 887

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRV-GMFPANYV 99
          ++A Y +  Q  GDL    GD +EV  + +  WF GR   N +  G FP N+V
Sbjct: 14 VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 50  MEALYQFDPQQ--DGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYVK 100
           + ++Y ++  Q  D +L    GD+ +V +    +W   + R +G VG  P NYV+
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVE 128

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 32.0 bits (71), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 10/66 (15%)

Query: 44  NKGGEYME---ALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRCNGRV---GMF 94
           NKG   +    A+ ++  + + +L   PGDKI+VL   E+ ++ W+ GR N R    G++
Sbjct: 69  NKGARSLPIYIAINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGR-NLRTQEEGLY 127

Query: 95  PANYVK 100
           PA + +
Sbjct: 128 PAVFTQ 133

>Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W
           (REAL)
          Length = 558

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 36  QSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---G 92
           + +  ++ N G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+   G
Sbjct: 147 RKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPG 206

Query: 93  MFPANYV 99
           + P  +V
Sbjct: 207 LVPVGFV 213

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 51  EALYQF--DPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           +ALY +  D     +++   G+ + V +     W   R NG  G+ P+NYV+
Sbjct: 284 KALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protein
           containing SH3-domains, involved in establishing cell
           polarity and morphogenesis; functions as a scaffold
           protein for complexes that include Cdc24p, Ste5p,
           Ste20p, and Rsr1p
          Length = 551

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 36  QSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV---G 92
           + +  ++ N G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+   G
Sbjct: 146 RKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPG 205

Query: 93  MFPANYV 99
           + P  +V
Sbjct: 206 LVPVGFV 212

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFK-----GRCNGRV--GMFP 95
           S +  + + A   F P +   L LS GD + VL K  + W+      GR   RV  G FP
Sbjct: 20  STRPVDVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFP 79

Query: 96  ANYVKA 101
            N+ ++
Sbjct: 80  HNFTRS 85

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 54  YQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRC--NGRVGMFPANYVKAAY 103
           Y F  +   +L +  GDK+ +L +K S +W+  +   +G+ G+ PA +++  +
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPVH 411

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           A+Y ++PQ   +LA+   D + +L+K   ++W+  K R  G      VG+ P+ Y++ A
Sbjct: 10  AIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 51  EALYQF--DPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVK 100
           +ALY +  D     +++   G+ + V +     W   R NG  G+ P+NYV+
Sbjct: 285 KALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYVE 336

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWF--KGRCNGRVGMFPANYV 99
           ALY F+P+ D +L L  GD + +  +    W   + +   + G+ P  +V
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV 166

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 3/69 (4%)

Query: 34  VNQSLPQNASNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRV-- 91
            +Q+     S  G  Y   LY F  ++  +L    G+ + +    + EWF  +  GR+  
Sbjct: 144 TSQTSSMEQSKMGSLYAIVLYDFKAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLGG 203

Query: 92  -GMFPANYV 99
            G+ P  +V
Sbjct: 204 PGLVPVGFV 212

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 54  YQFDPQQDGDLALSPGDKIEVL-EKPSNEWFKGRC--NGRVGMFPANYVK 100
           Y F  +   +L +  GDK+ +L +K S +W+  +   +G+ G+ PA +++
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIE 411

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPS-NEWF--KGRCNGR-----VGMFPANYVKAA 102
           A+Y ++PQ   +LA+   D + +L+K   ++W+  K R  G      VG+ P+ Y++ A
Sbjct: 10  AVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 48  EYMEALYQFDPQQ-DGDLALSPGDKIEVLEKPS-----NEWFKGRC-NGRVGMFPANYVK 100
           E+  ALY F P+    +  +  G+ + +L++       +EW+K R  NG  G  P NY++
Sbjct: 332 EFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYNYIE 391

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRC--NGRVGMFPANYV 99
           A Y ++  +D +L     ++I  ++   ++W+ G    +G  G+FP+NYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVLEKP---SNEWFKGRCNGRV---GMFPANYVK 100
           A+ ++  + + +L + PGDKI+V+      ++ W+ GR N R    G++PA + K
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTEEEGLYPAVFTK 73

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 52  ALYQFDPQQDGDLALSPGDKIEVL---EKPSNEWFKGRC--NGRVGMFPANYVK 100
            + ++  + D +L + PGDKI+V+   E+ ++ W+ G+    G  G++P  + +
Sbjct: 54  VINEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEGLYPVVFTQ 107

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 55  QFDPQQDGDLALSPGDKIEVLEKP---SNEWFKGRC--NGRVGMFPANYVK 100
           ++  + + ++ + PGDKIEVL       + W++G+     +VG++PA + +
Sbjct: 10  EYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQ 60

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON}
          Anc_2.319 YDL117W
          Length = 919

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 50 MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKG---RCNGRVGMFPANYV 99
          + A Y +  Q  GDL    GD +EV  + + +WF G   R     G FP N+V
Sbjct: 15 VRAKYGWSGQAKGDLGFLEGDIMEV-TRVAGDWFYGKLLRNRKCAGYFPNNFV 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,119,865
Number of extensions: 838661
Number of successful extensions: 3195
Number of sequences better than 10.0: 309
Number of HSP's gapped: 3014
Number of HSP's successfully gapped: 355
Length of query: 201
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 97
Effective length of database: 41,556,135
Effective search space: 4030945095
Effective search space used: 4030945095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)