Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056803.500ON1401407128e-98
NCAS0F035903.500ON1401405062e-66
YPR153W3.500ON1401404984e-65
ZYRO0D09724g3.500ON1391284941e-64
Smik_16.4053.500ON1391394914e-64
Skud_16.4473.500ON1401404827e-63
Suva_16.4813.500ON1391394802e-62
CAGL0L08382g3.500ON1401404751e-61
SAKL0F02508g3.500ON1401404723e-61
TPHA0A057103.500ON1411384523e-58
Kpol_480.93.500ON1411414377e-56
KNAG0A079803.500ON1471404342e-55
TBLA0C045203.500ON1401404314e-55
KLTH0G02354g3.500ON1401404202e-53
KAFR0G037303.500ON1441353961e-49
KLLA0E03895g3.500ON1401403639e-45
AFR319W3.500ON1411332692e-30
Kwal_47.189033.500ON113441621e-14
KLLA0E14587gsingletonON108263671.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05680
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   278   8e-98
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   199   2e-66
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   196   4e-65
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   194   1e-64
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   193   4e-64
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   190   7e-63
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   189   2e-62
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   187   1e-61
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   186   3e-61
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   178   3e-58
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   172   7e-56
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   171   2e-55
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   170   4e-55
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   166   2e-53
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   157   1e-49
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   144   9e-45
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   108   2e-30
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    67   1e-14
KLLA0E14587g Chr5 complement(1297636..1300884) [3249 bp, 1082 aa...    30   1.6  

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  278 bits (712), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
           VIVQILFDFSVSYLSSGTIM
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  199 bits (506), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 113/140 (80%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           MRSFITNND+PIGY+TP FPSL+WPI+N K+ +  LY++  IWKFTLYW+LIFN AFYG 
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AGL AS+SHRR  GG+WIM IYL + G+Q +A GT++GFLIG+IY AGLF+MSTWIP CC
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            + QILFD  ++Y S   I+
Sbjct: 121 AVAQILFDVIMAYSSVSGIL 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  196 bits (498), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 116/140 (82%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           MRSF+TNND+P+GYVTP FPSL+WPI+N K++ A LY +  IWKF+LYW+LIFNGAFY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AG++AS +HR++AG +WI  +Y++YGG+Q +  GTV+GFLIG+IY +GLFSMSTW+P CC
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +VQILFD  +SY   G++M
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  194 bits (494), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (83%), Gaps = 1/128 (0%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           MRSFIT NDVP+GY TPSFPSL+WP +  + SL V+YDV  IWKFTLYWSLIFN  FY +
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
            GLWAS+SHR++AGGLWIMA+Y  YGG+Q VA GT+ GFLIG+IYS+GLFSMSTWIP CC
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 VIVQILFD 128
            + Q+L+D
Sbjct: 120 AVAQVLYD 127

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  193 bits (491), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 86/139 (61%), Positives = 115/139 (82%)

Query: 2   RSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIA 61
           RSF+TNND+P+GYVTP FPSL+WPI+N +++ A LY +  IWKF+LYW+LIFNGAFY + 
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCV 121
           GL+AS +HR++AG LWI ++Y++YGG+Q +  GTV+GFLIG+IY +GLFSMSTWIP CC 
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 IVQILFDFSVSYLSSGTIM 140
           +VQILFD  + Y   G++M
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  190 bits (482), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 114/140 (81%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           MRSF+TNND+P+GYVTP FPSL+WPI++ ++++A LY +  IWKF+LYW+LIFNGAFY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
            GL+AS +HR++ G +WI  +Y++YGG+Q +  GTV+GFLIG+IY +GLFSMSTWIP CC
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +VQILFD  + Y   G++M
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  189 bits (480), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 114/139 (82%)

Query: 2   RSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIA 61
           RSFITNND+P+GY+TP FPSL+WPI++ +++ A LY +  IWKF+LYW+LIFNGAFY  A
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCV 121
           GL+AS +HR++AG +WI  +Y+ +GG+Q + AGT++GFLIG+IY +GLFSMSTWIP CC 
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 IVQILFDFSVSYLSSGTIM 140
           +VQILFD  + Y   G+IM
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  187 bits (475), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 112/140 (80%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           M+SFIT+ DVPIGY TPSFPSL+WPI++ ++  A LY +  IWKFTLYW+ IFNGAFYG 
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AGL+AS +H +R GGLWI  IY++Y G+Q +  GTV+GFLIG+IY +GLFSMSTW+P CC
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +VQIL D ++SY   G+IM
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  186 bits (472), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 111/140 (79%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           M+SF+T  DVP+GYVTPSFPSL+WP++N KFSL+ LY    IW+FT+YW+LI    FYG 
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AGL ASYSHR+ AGG+WIM  YLV GGIQA+A+GTV+G LI  IY AGLF+MSTW+P  C
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            ++QILF+ S SYL +G I+
Sbjct: 121 ALMQILFNVSTSYLMAGVII 140

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  178 bits (452), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 107/138 (77%)

Query: 3   SFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAG 62
           +F+T+ND+P+GYVTPSFPSL+WPI+N K++ A LYD   IW FT+YWSLI NG FYG+AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  LWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCVI 122
             A ++HR++ GG WI+AIYLV GG+Q +  GT+IG++I + Y + LFSMSTWIP CC +
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 VQILFDFSVSYLSSGTIM 140
            Q+LF+ + SY   G +M
Sbjct: 124 AQVLFEVTTSYSLVGNLM 141

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  172 bits (437), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (73%), Gaps = 1/141 (0%)

Query: 1   MRS-FITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYG 59
           MRS F+T+ D+P+GY  P FPSL+WPIS+ K+ ++ LYD   IW+FT+YWS+I NG FY 
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60

Query: 60  IAGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPC 119
           I+GL ASY+HR+RAGGLWIM IYL  G  Q V  GTV G+L+  IY +GLF+MSTWIP C
Sbjct: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120

Query: 120 CVIVQILFDFSVSYLSSGTIM 140
           C I Q+LFD   S+   G +M
Sbjct: 121 CAITQVLFDLCSSFSLGGMVM 141

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  171 bits (434), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 105/140 (75%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           +R+F+ NN++P+GY TPSFPSL+WPISN  +SLA LY++  IWKFT+YW LI NGAFYG 
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           +GL A+ SH +    + I+ +YL+Y GIQ V  G + G L+G+IY AGLF+MSTWIP CC
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            + QILFD  +SY   G+++
Sbjct: 128 AVAQILFDVVMSYSHVGSLL 147

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  170 bits (431), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 103/140 (73%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           M+SFITNND+P+GYVTP FPSL+WPI+N K++ + LYD   IWKF++YW +I N  FYG+
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
            G  A  SHR + G +WI+ IYL  G +Q + AGT++G++I +IY++GLF MSTWIP CC
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +VQILFD   S+  S   M
Sbjct: 121 AVVQILFDVVQSFPISNLTM 140

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  166 bits (420), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           M+SF+T  DVPIGY TP FPSL WPI+N +++L+ LY    IWKFT++W+LI    FY  
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
           AGLWAS SHR++A GLWIMA Y++ GG QA+AAGTV G ++   Y AGLF MSTWIP C 
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +V ILF  S +Y  +G I+
Sbjct: 121 AVVLILFHVSTTYSMAGIII 140

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  157 bits (396), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 79/135 (58%), Positives = 95/135 (70%), Gaps = 1/135 (0%)

Query: 7   NNDVPIGYVTPSFPSLHWPIS-NGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAGLWA 65
              VPIGY+TP FPSL+WPI  +  F  A LY VV IWKFTLYWSLIFNGAFY  AG  A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 66  SYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCVIVQI 125
             + ++++  L I A Y V+GG+Q V  GTV+GFL+G+IY AGLF MS WIP CC + QI
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 126 LFDFSVSYLSSGTIM 140
           L+D  VSY + G IM
Sbjct: 130 LYDVLVSYSTVGRIM 144

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  144 bits (363), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 68/140 (48%), Positives = 96/140 (68%)

Query: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60
           M++F    DVP+GY  P FPSL+WP++NGKFS+A LY +  IW+FT++W++I     YG 
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120
            G  A  +H++   G W++ +Y++ G  QA  +GTV+G LI  IY AGLF+MSTWIP CC
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 VIVQILFDFSVSYLSSGTIM 140
            +VQILF+ S SY  +  I+
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  108 bits (269), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 83/133 (62%), Gaps = 1/133 (0%)

Query: 8   NDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAGLWASY 67
            + P GY++PSFPSL W  ++ + + A+LY    I +FT++W+LI  G  YG  GL A Y
Sbjct: 10  GNPPAGYISPSFPSLLWT-ADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGY 68

Query: 68  SHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCVIVQILF 127
           SHRR  GG+ I+AIYL+ G + A+  GT  G +  +IY A L +MSTWIP    +VQ L+
Sbjct: 69  SHRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128

Query: 128 DFSVSYLSSGTIM 140
               ++++   ++
Sbjct: 129 LLCAAFVAQSKLI 141

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 67.0 bits (162), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/44 (72%), Positives = 35/44 (79%)

Query: 57  FYGIAGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFL 100
           FY  AGLWAS SHRR AGGLWIMA Y++ GG QAVAAGTV G +
Sbjct: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>KLLA0E14587g Chr5 complement(1297636..1300884) [3249 bp, 1082 aa]
            {ON} similar to uniprot|Q01896 Saccharomyces cerevisiae
            YDR039C ENA2 P-type ATPase sodium pump involved in Na
            efflux to allow salt tolerance likely not involved in Li
            efflux
          Length = 1082

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 12   IGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAGLWASYSHRR 71
            +G     FP ++ P+ N K  L   YD+   W F+L +SL    AF+  A L+  Y  RR
Sbjct: 986  VGGFCSVFPVVYIPVINDKVFLH--YDITYEWGFSLGFSL----AFWAGAELY-KYGKRR 1038

Query: 72   RAG 74
              G
Sbjct: 1039 YFG 1041

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.143    0.478 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,098,995
Number of extensions: 581499
Number of successful extensions: 1699
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1696
Number of HSP's successfully gapped: 37
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)