Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056703.499ON25525513380.0
ZYRO0D09746g3.499ON25325312051e-169
Skud_7.4463.499ON25825611881e-166
SAKL0F02530g3.499ON25225111841e-166
Kpol_480.103.499ON25924611671e-163
TPHA0A057003.499ON25625111661e-163
YGR135W (PRE9)3.499ON25824711621e-162
Smik_6.2313.499ON25824711591e-162
Suva_7.4233.499ON25824711561e-161
KAFR0C020203.499ON25825211431e-159
NDAI0G008903.499ON25425411421e-159
KLTH0G02376g3.499ON25125111321e-158
Ecym_12303.499ON25124911271e-157
NCAS0E007603.499ON25924711251e-157
Kwal_47.188983.499ON25125111211e-156
KLLA0E03917g3.499ON24924911141e-155
KNAG0B007603.499ON25925511101e-154
CAGL0I10406g3.499ON25725211011e-153
AFR318W3.499ON25125110911e-152
TBLA0D029203.499ON25825310381e-144
KLTH0E16324g8.871ON2502134162e-49
KNAG0J001808.871ON2502214092e-48
CAGL0H07007g8.871ON2502134092e-48
Ecym_81518.871ON2502474082e-48
ADL354W8.871ON2502214057e-48
NDAI0E001608.871ON2502134049e-48
KLLA0D10373g8.871ON2502134041e-47
NDAI0C034005.64ON2632544032e-47
KAFR0L020808.871ON2502134012e-47
Smik_13.438.871ON2502193989e-47
Kpol_455.58.871ON2492143962e-46
Suva_13.568.871ON2502133962e-46
Skud_13.518.871ON2502133943e-46
YML092C (PRE8)8.871ON2502193943e-46
TPHA0C049308.871ON2502143943e-46
Kwal_56.247805.64ON2622263936e-46
NCAS0B001508.871ON2502153917e-46
NCAS0D013405.64ON2612383928e-46
TBLA0C066205.64ON2622263929e-46
SAKL0D00440g8.871ON2502153891e-45
SAKL0H02068g5.64ON2612383902e-45
TPHA0H011905.64ON2602263892e-45
KLLA0B11836g7.120ON2542233882e-45
NCAS0F010307.120ON2532233883e-45
Kpol_1062.25.64ON2602383883e-45
KAFR0B044405.64ON2602263866e-45
TDEL0B004008.871ON2502133856e-45
KLTH0H00528g5.64ON2612263867e-45
TBLA0J019807.120ON2542043841e-44
CAGL0I02442g5.64ON2602523841e-44
KAFR0G030307.120ON2542043831e-44
SAKL0F04224g7.120ON2522043831e-44
AER296W5.64ON2602383813e-44
Ecym_12727.120ON2512233804e-44
Ecym_51005.64ON2612033804e-44
ZYRO0A00616g8.871ON2502133804e-44
KLLA0A05093g5.64ON2622193796e-44
AAR012C7.120ON2512233788e-44
TDEL0G008805.64ON2602383789e-44
KLTH0F13574g7.120ON2542183771e-43
KNAG0K004505.64ON2672263772e-43
Kwal_YGOB_Anc_7.1207.120ON2542043743e-43
TBLA0C063408.871ON2562193734e-43
ZYRO0C11770g5.64ON2602383744e-43
CAGL0F01199g7.120ON2542053726e-43
TPHA0I020707.120ON2562043727e-43
Suva_15.1317.120ON2542233719e-43
YOL038W (PRE6)7.120ON2542043692e-42
Smik_15.1297.120ON2542043682e-42
Skud_15.1197.120ON2542233683e-42
NDAI0H015207.120ON2522233683e-42
Suva_7.5495.64ON2602383665e-42
ZYRO0G04136g7.120ON2542503665e-42
YGR253C (PUP2)5.64ON2602383666e-42
Smik_16.545.64ON2602383641e-41
Skud_7.5865.64ON2602263641e-41
Kpol_1023.1087.120ON2542233631e-41
TDEL0H033007.120ON2562043613e-41
KNAG0L010207.120ON2661843501e-39
ZYRO0C00792g7.20ON2901723163e-34
TBLA0E006907.20ON2781723102e-33
Kpol_538.407.20ON2741723092e-33
Smik_15.5467.20ON2881723103e-33
CAGL0H06105g7.20ON2901723085e-33
KLTH0D00902g7.20ON2771723059e-33
Suva_8.4197.20ON2921723051e-32
KAFR0C050007.20ON2811723042e-32
Skud_15.5307.20ON2881723042e-32
YOR362C (PRE10)7.20ON2881723032e-32
KNAG0E002307.20ON2792023022e-32
AGL089W4.110ON2462023002e-32
NCAS0I002507.20ON2921723033e-32
KLLA0A03487g7.20ON2751722996e-32
ADR401C7.20ON2791723006e-32
Kwal_47.174934.110ON2462472952e-31
Ecym_72334.110ON2462152942e-31
TPHA0N002407.20ON2771722962e-31
Ecym_50197.20ON2851722953e-31
TDEL0H043107.20ON2741722919e-31
KLLA0A05027g4.110ON2462172891e-30
TBLA0C040804.110ON2532012891e-30
Kwal_27.97208.871ON1731382822e-30
SAKL0D14476g7.20ON2811722883e-30
NDAI0A087707.20ON2921722875e-30
Kpol_1061.454.110ON2561772812e-29
NCAS0A016404.110ON2532122803e-29
ZYRO0G10164g4.110ON2532432785e-29
KLTH0E07788g4.110ON2461822769e-29
SAKL0H21956g4.110ON2481842742e-28
YGL011C (SCL1)4.110ON2521972742e-28
TPHA0F006704.110ON2572162742e-28
Suva_7.2704.110ON2521972723e-28
Smik_7.2794.110ON2521772672e-27
TDEL0F023604.110ON2532442663e-27
Skud_7.2764.110ON2521972663e-27
YMR314W (PRE5)5.1ON2342222635e-27
KNAG0E011805.1ON2331922611e-26
KLTH0B09504g5.1ON2332192602e-26
CAGL0A00407g4.110ON2541772612e-26
Skud_13.4885.1ON2342202592e-26
Smik_13.5315.1ON2342202592e-26
Kpol_1060.15.1ON2332192574e-26
CAGL0M14003g5.1ON2332212574e-26
Kwal_26.94835.1ON2332212574e-26
KNAG0D035404.110ON2522002575e-26
NCAS0D023105.1ON2332192566e-26
Ecym_56505.1ON2332192557e-26
TPHA0A056705.1ON2332212557e-26
Suva_13.5075.1ON2342202558e-26
AGL336W5.1ON3062282581e-25
KAFR0F034304.110ON2522422542e-25
KLLA0A10153g5.1ON2331922532e-25
NDAI0I026405.1ON2332192471e-24
ZYRO0C01144g5.1ON2332192471e-24
KAFR0I027205.1ON2352232461e-24
TBLA0C071905.1ON2332192382e-23
SAKL0H00946g5.1ON2332192321e-22
TDEL0G002405.1ON2382242201e-20
Kwal_26.68197.20ON1961501556e-12
NDAI0D035604.110ON1721031547e-12
SAKL0G04290g5.507ON2612211359e-09
KNAG0B038005.507ON2612051278e-08
YOR157C (PUP1)5.507ON2611611252e-07
NDAI0C011705.507ON2631991242e-07
KLLA0A02233g5.507ON2621991242e-07
Smik_15.3375.507ON2611991223e-07
Skud_15.3215.507ON2611991207e-07
TDEL0A037105.507ON2611891199e-07
KAFR0C053005.507ON2612211199e-07
Suva_8.2085.507ON2611991181e-06
TPHA0E020505.507ON2612101171e-06
Ecym_54585.507ON2582061162e-06
NCAS0H024805.507ON2642221172e-06
AGL324W7.480ON2431711162e-06
TBLA0D017505.507ON2592201162e-06
CAGL0L04312g5.507ON2611691153e-06
Kwal_47.187485.507ON2631681145e-06
Kpol_534.575.216ON2152091125e-06
Kpol_2002.1095.216ON2152091126e-06
Kpol_218.15.507ON2611611136e-06
NDAI0J006007.480ON2411921128e-06
AAL172C5.216ON2152061119e-06
NCAS0A148807.480ON2411921111e-05
KLTH0G03168g5.507ON2631741092e-05
ZYRO0D12034g5.507ON2611981092e-05
KAFR0B006507.480ON2411911082e-05
KLTH0E01826g7.480ON2422251073e-05
Kwal_33.151935.216ON1932051053e-05
CAGL0F04477g7.480ON2421731064e-05
KNAG0F035907.480ON2482211064e-05
KLLA0E05633g7.480ON2401541064e-05
Ecym_82765.216ON2152061054e-05
Kpol_1028.927.480ON2421731048e-05
TBLA0F026807.480ON2411721012e-04
Smik_10.2785.216ON2162091002e-04
Suva_2.777.480ON2411731012e-04
Kwal_55.198827.480ON2422061012e-04
TDEL0C034407.480ON2412061002e-04
SAKL0F15092g7.480ON2611741002e-04
Ecym_71717.480ON2422101003e-04
ZYRO0B10142g5.216ON215209993e-04
AAR119W5.507ON259226993e-04
Suva_12.805.216ON215209993e-04
YJL001W (PRE3)5.216ON215209993e-04
KLLA0F12936g5.216ON215210983e-04
TDEL0C055403.417ON287198994e-04
ZYRO0G17842g7.480ON244173985e-04
TDEL0E041305.216ON219205975e-04
Suva_16.4293.417ON287198977e-04
Skud_16.3883.417ON287198969e-04
Skud_2.617.480ON241173950.001
Skud_10.2225.216ON215209940.001
YBL041W (PRE7)7.480ON241173940.001
Smik_2.737.480ON241173940.001
KLTH0B03102g5.216ON215209940.001
TPHA0N007405.216ON216210930.002
KLTH0D03058g3.417ON287185940.002
TPHA0E004207.480ON241173930.002
KNAG0A075203.417ON287185930.002
Smik_16.3433.417ON287198930.002
TBLA0C062005.216ON216208920.002
TPHA0E029905.216ON216210910.003
AEL326C3.417ON285198910.004
KNAG0H024505.216ON216207900.004
TBLA0F017603.417ON287198910.004
SAKL0G12584g5.216ON215209900.004
CAGL0D03058g5.216ON215208900.005
YPR103W (PRE2)3.417ON287198900.005
SAKL0B09262g3.417ON287201900.006
NCAS0A114403.417ON287169890.007
CAGL0G01804g3.417ON286198890.007
Kwal_26.72733.417ON287169870.011
ZYRO0C17688g3.417ON287185870.014
TPHA0M017503.417ON286169860.018
NDAI0A048603.417ON287200850.020
KLLA0F08228g3.417ON285169840.031
Ecym_26143.417ON285169830.037
NCAS0A014805.216ON216211820.041
KAFR0D042103.417ON287171800.083
KLTH0G00550g3.574ON265191790.11
KAFR0C063505.216ON216207790.11
Kpol_1018.1443.417ON288171780.16
Smik_7.1736.159ON34942750.44
NDAI0C024205.216ON216207740.49
KLTH0C07348g3.269ON316127711.4
KAFR0D030502.449ON14748681.8
TDEL0B071102.618ON88856684.2
CAGL0L05742g1.219ON305170664.8
TBLA0E001503.574ON265160656.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05670
         (255 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   520   0.0  
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   468   e-169
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   462   e-166
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   460   e-166
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   454   e-163
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   453   e-163
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   452   e-162
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   451   e-162
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   449   e-161
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   444   e-159
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   444   e-159
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   440   e-158
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   438   e-157
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     437   e-157
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   436   e-156
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   433   e-155
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   432   e-154
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   428   e-153
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   424   e-152
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   404   e-144
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   164   2e-49
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   162   2e-48
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   162   2e-48
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   161   2e-48
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   160   7e-48
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   160   9e-48
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   160   1e-47
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   159   2e-47
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   159   2e-47
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   157   9e-47
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   157   2e-46
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   157   2e-46
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   156   3e-46
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   156   3e-46
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   156   3e-46
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   155   6e-46
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   155   7e-46
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      155   8e-46
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   155   9e-46
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   154   1e-45
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   154   2e-45
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   154   2e-45
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   154   2e-45
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     154   3e-45
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   154   3e-45
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   153   6e-45
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   152   6e-45
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   153   7e-45
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   152   1e-44
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   152   1e-44
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   152   1e-44
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   152   1e-44
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   151   3e-44
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   150   4e-44
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   150   4e-44
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   150   4e-44
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   150   6e-44
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   150   8e-44
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   150   9e-44
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   149   1e-43
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   149   2e-43
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   148   3e-43
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   148   4e-43
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   148   4e-43
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   147   6e-43
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   147   7e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   147   9e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   146   2e-42
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   146   2e-42
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   146   3e-42
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     146   3e-42
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   145   5e-42
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   145   5e-42
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   145   6e-42
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   144   1e-41
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   144   1e-41
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   144   1e-41
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   143   3e-41
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   139   1e-39
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   126   3e-34
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   124   2e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   123   2e-33
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   124   3e-33
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   123   5e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   122   9e-33
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   122   1e-32
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   121   2e-32
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   121   2e-32
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   121   2e-32
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   120   2e-32
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   120   2e-32
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   121   3e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   119   6e-32
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   120   6e-32
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   118   2e-31
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   117   2e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   118   2e-31
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   118   3e-31
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   116   9e-31
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   115   1e-30
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   115   1e-30
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   113   2e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   115   3e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   115   5e-30
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   112   2e-29
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   112   3e-29
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   111   5e-29
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   110   9e-29
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   110   2e-28
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   110   2e-28
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   110   2e-28
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   109   3e-28
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   107   2e-27
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   107   3e-27
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   107   3e-27
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   105   5e-27
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   105   1e-26
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   104   2e-26
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   105   2e-26
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   104   2e-26
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   104   2e-26
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   103   4e-26
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   103   4e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   103   4e-26
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   103   5e-26
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   103   6e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   102   7e-26
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             102   7e-26
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   102   8e-26
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   103   1e-25
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   102   2e-25
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   102   2e-25
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       100   1e-24
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   100   1e-24
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    99   1e-24
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    96   2e-23
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    94   1e-22
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    89   1e-20
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    64   6e-12
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    64   7e-12
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    57   9e-09
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    54   8e-08
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    53   2e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    52   2e-07
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    52   2e-07
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    52   3e-07
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    51   7e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    50   9e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    50   9e-07
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    50   1e-06
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    50   1e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    49   2e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      50   2e-06
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    49   2e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    49   2e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    49   3e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    49   5e-06
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    48   5e-06
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    48   6e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    48   6e-06
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    48   8e-06
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    47   9e-06
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    47   1e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    47   2e-05
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    47   2e-05
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    46   2e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    46   3e-05
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    45   3e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    45   4e-05
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    45   4e-05
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    45   4e-05
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    45   4e-05
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    45   8e-05
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    44   2e-04
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    43   2e-04
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    44   2e-04
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    44   2e-04
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    43   2e-04
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    43   2e-04
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    43   3e-04
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    43   3e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    43   3e-04
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    43   3e-04
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    43   3e-04
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    42   3e-04
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    43   4e-04
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    42   5e-04
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    42   5e-04
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    42   7e-04
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    42   9e-04
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    41   0.001
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    41   0.001
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    41   0.001
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    41   0.001
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    41   0.001
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    40   0.002
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    41   0.002
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    40   0.002
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    40   0.002
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    40   0.002
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    40   0.002
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    40   0.003
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    40   0.004
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    39   0.004
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    40   0.004
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    39   0.004
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    39   0.005
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    39   0.005
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    39   0.006
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    39   0.007
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    39   0.007
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    38   0.011
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    38   0.014
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    38   0.018
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    37   0.020
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    37   0.031
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    37   0.037
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    36   0.041
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    35   0.083
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    35   0.11 
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    35   0.11 
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    35   0.16 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.44 
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    33   0.49 
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    32   1.4  
KAFR0D03050 Chr4 complement(602858..603301) [444 bp, 147 aa] {ON...    31   1.8  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    31   4.2  
CAGL0L05742g Chr12 complement(632841..633758) [918 bp, 305 aa] {...    30   4.8  
TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574 ...    30   6.5  

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/255 (100%), Positives = 255/255 (100%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 HGITKKHHDDEQDDE 255
           HGITKKHHDDEQDDE
Sbjct: 241 HGITKKHHDDEQDDE 255

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  468 bits (1205), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/253 (89%), Positives = 244/253 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKI VAVAGLT+DAEILINTAR++AQNYL+TYNEDIPVEILVKRLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+K++GAIELALKTLSKTTDSSALT DR+EFATI+   +GKLYQK+FKPEEIQ+LLVK
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 HGITKKHHDDEQD 253
           +GITK   D++++
Sbjct: 241 NGITKAGEDEDEE 253

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  462 bits (1188), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/256 (88%), Positives = 245/256 (95%), Gaps = 1/256 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARV+AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239
           K+D+K++GAI+LALKTLSKTTDSSALT DR+EFATI+K P DG++YQKIFKP+EI+ LLV
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KHGITKKHHDDEQDDE 255
           K GI+KK  DDE D E
Sbjct: 241 KTGISKKDEDDEADQE 256

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  460 bits (1184), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/251 (88%), Positives = 242/251 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLY+LND ITVAVAGLTADAEILINTARVYAQNYL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KD + L+GAIELALKTLSKTTDSSALT+DRIEFATI+K  +G+LYQKI+KP+EIQ+LL K
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 HGITKKHHDDE 251
            GITKK  +DE
Sbjct: 241 TGITKKDDEDE 251

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  454 bits (1167), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/246 (89%), Positives = 237/246 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEK+YRLNDKITVAVAGLTADAEILINTARV+AQ YL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+K++ AIELALKTLSKTTDSSALT DR+EFATI+K  + K+YQKIFKPEEI+ LL+K
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 HGITKK 246
            GITKK
Sbjct: 241 TGITKK 246

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  453 bits (1166), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/251 (87%), Positives = 237/251 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LND ITVAVAGLTADAEILINTARV+AQNYL+TYNEDIPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQ+++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+KLEGAIELALKTLSKTTDSSALT DR+EFATI+K  + K+YQKI+KPEEI+ LL K
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 HGITKKHHDDE 251
            GITKK  D E
Sbjct: 241 AGITKKSEDGE 251

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  452 bits (1162), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/247 (89%), Positives = 239/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK-APDGKLYQKIFKPEEIQSLLV 239
           KDD+K++ AIELALKTLSKTTDSSALT DR+EFATI+K A DG++YQKIFKP+EI+ +LV
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KHGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  451 bits (1159), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 239/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI+VAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PDGKLYQKIFKPEEIQSLLV 239
           KDD+K++ AI+LALKTLSKTTDSSALT DR+EFATI+K   DG++YQKIFKP+EI+ LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KHGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  449 bits (1156), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 239/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARV+AQNYL++YNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK-APDGKLYQKIFKPEEIQSLLV 239
           KDD+K++ AI+LALKTLSKTTDSSALT DR+EFATI+K A DG++YQKIFKP+EI+ LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KHGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  444 bits (1143), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 237/252 (94%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS EKLY+LNDKITVAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239
           KD++ L+ A+ELALKTLSK TDSS LT DR+EFATI+K   + K+YQKIF P+EI+SLLV
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KHGITKKHHDDE 251
           K GI+KK ++DE
Sbjct: 241 KTGISKKENEDE 252

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  444 bits (1142), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 239/254 (94%), Gaps = 1/254 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS EKLY+LNDKITVAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239
           KDD++L+ AIELALKTLSKTTDSS+LT D++EFATI+K   DG++YQKI+KP+EI+ LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KHGITKKHHDDEQD 253
           K G+TKK  D+ ++
Sbjct: 241 KTGVTKKKDDETEE 254

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  440 bits (1132), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 209/251 (83%), Positives = 235/251 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +S+EKLY+LND ITVAVAGLTADAEILINTAR++AQNYL++YNE+IPVEILV+RLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+ +E A ELALKTLSKTTDSS LT +R+EF+TI K  +GK+ QKIFKP+EI++LL K
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 HGITKKHHDDE 251
            G+TKK +DDE
Sbjct: 241 TGVTKKENDDE 251

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  438 bits (1127), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/249 (84%), Positives = 232/249 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLYRLND ITVAVAGLTADAEILINTAR++AQNYL+ YNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KD++  E AIELALKTLSKTTD+S+LT+DR+EFATI++  +GKL QKI+KP EI+ LL K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 HGITKKHHD 249
            GI K+  +
Sbjct: 241 SGIMKQEEN 249

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  437 bits (1125), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/247 (87%), Positives = 235/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LNDKITVAVAGLTADAEILINTARVYAQ+YL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PDGKLYQKIFKPEEIQSLLV 239
           KD++KL+ AIELALKTLSKTTDSS+LT D++E ATI+K     ++YQKI+KPEE++ LL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KHGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  436 bits (1121), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 207/251 (82%), Positives = 234/251 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +S+EKLY+LND ITVAVAGLTADAEILINTAR++AQNYL+TYNE+IPVEILV+RLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+ ++ A ELALKTLSKTTDSS LT++R+EFATI K  +GK+ QKIFKP EI++LL +
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 HGITKKHHDDE 251
            GI KK +++E
Sbjct: 241 TGINKKENEEE 251

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  433 bits (1114), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/249 (84%), Positives = 230/249 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM   GIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLY+LND ITVAVAGLTADAEILINTARV AQ+YL+TYNE+IPVE+LV+RLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+ L+GAIELALKTLSKTTDSS LT++R+EFATI K  +GK+YQKI+KP EI +LL K
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 HGITKKHHD 249
             I KK  D
Sbjct: 241 TEIVKKDDD 249

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  432 bits (1110), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/255 (82%), Positives = 232/255 (90%), Gaps = 1/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLYRLNDKI VAVAGLTADAEILINTARV+ QNYL+TY EDIPVE+LVKR+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239
           KD++ LE A ELALKTLSKTTDSSALT DR+EF+TI++   +G++ QKI+KP EI+ LLV
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KHGITKKHHDDEQDD 254
           K GITKK  +D   D
Sbjct: 241 KSGITKKDAEDGDAD 255

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 236/252 (93%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM ++GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TSTEKLY+LND+ TVAVAGLTADAEILINTAR++AQNYL+TYNE+IPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY-QKIFKPEEIQSLLV 239
           KD++ L+ A+ELALKTLSKTTDSS+LT DR+EFAT++K  + + + QKIFKP EI+ LL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KHGITKKHHDDE 251
           K GI+KK  +DE
Sbjct: 241 KTGISKKSDEDE 252

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  424 bits (1091), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 205/251 (81%), Positives = 230/251 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           TS+EKLYRLND ITVAVAGLTADAEIL+NTAR++AQNYL+ YNE+IPVE+LV+RLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240
           KDD+  + AI+LALKTLSKTTDSS+L+++R+EFATIQ+  DGK+ QKI+K  EI+ LL K
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 HGITKKHHDDE 251
            GI K+   ++
Sbjct: 241 TGINKQEEKED 251

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  404 bits (1038), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 199/253 (78%), Positives = 221/253 (87%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
              EKLY+L+DKIT+AVAGLTADAEILIN AR +AQNYL TYNE+IPVEILVK+LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQ+DY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQ--KAPDGKLYQKIFKPEEIQSLL 238
           KDD+ L  A+EL LKTLSKTTDSS LT DR+E + I+  K  D K+ QKI+ P EI+ LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 VKHGITKKHHDDE 251
           +K GI KK+ +DE
Sbjct: 241 IKFGINKKNDEDE 253

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+++A E+K TS L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R  A  +Y R YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 135/221 (61%), Gaps = 3/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y R YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
           ++LE AI +AL TL ++ +      D IE   I +  + +L
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGEPNNDQL 222

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  161 bits (408), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 144/247 (58%), Gaps = 16/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K  S L   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYA-QNYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y++TY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPD------------GKLYQKIFKP 231
           ++LE AI +AL TL ++ +      + IE A I +  D            G  ++K F P
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVIGEENDDLLGYKGDATARGPRFRK-FTP 240

Query: 232 EEIQSLL 238
           +EI   L
Sbjct: 241 QEINDRL 247

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  160 bits (405), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 135/221 (61%), Gaps = 3/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K  + L  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYA-QNYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y + Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
           ++LE AI +AL TL ++ +      + IE A + +  D  L
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIELAVVGEENDDML 222

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  160 bits (404), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI AT+GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  NY R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  160 bits (404), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI +T+GIV+A E+K +S L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR  A  NY R Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  159 bits (403), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 146/254 (57%), Gaps = 10/254 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLTADA  +I  ARV A N+   Y+ED+ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLV 239
           +   + L  A  L LK L +  +   L  +  + + I K    ++Y      E I+ +  
Sbjct: 187 WHSSLTLREAEVLVLKILKQVMEEK-LDENNAQLSCITKDNGFQIYDNAKTAEIIKEMKE 245

Query: 240 KHGITKKHHDDEQD 253
           K   T++H + E++
Sbjct: 246 KE--TQEHPEGEEE 257

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  159 bits (401), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 132/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y R YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE   I
Sbjct: 183 LELEDAIHIALLTLKESIEGE-FNGDTIEIGVI 214

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  157 bits (398), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 133/219 (60%), Gaps = 4/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI-QKAPD 221
           ++LE AI +AL TL ++ +      D IE A I  + PD
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIIGDENPD 220

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 131/214 (61%), Gaps = 5/214 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY R Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DVKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           +++LE AI +AL TL ++ +      D IE A +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIV 214

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  156 bits (394), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI +AL TL ++ +      D IE A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  156 bits (394), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 133/219 (60%), Gaps = 4/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI-QKAPD 221
           ++LE AI +AL TL ++ +      D IE A I  + PD
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIIGDENPD 220

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  156 bits (394), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 131/214 (61%), Gaps = 5/214 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY R Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DVKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           +++LE AI +AL TL ++ +      D IE A +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  155 bits (393), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 134/226 (59%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLTADA  +I  ARV A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L L+ L +  +   L  D  + +++ K    K+Y
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTKEDGFKVY 231

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  155 bits (391), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 131/215 (60%), Gaps = 3/215 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI AT+G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  NY R Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
           ++LE AI +AL TL ++ +      D IE   I +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVISE 216

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  155 bits (392), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 137/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +   I  A++GLTADA  +I  ARV A N+   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L     + + + K    ++Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNAQLSCVTKENGFQIYDDAKTAEIIKEL 243

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  155 bits (392), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 133/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS+LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +   I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L LK L +  +   L  + ++ + + K    K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTKEEGFKIY 231

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  154 bits (389), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 130/215 (60%), Gaps = 3/215 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI AT+G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y R Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
           ++LE AI +AL TL ++ +      D IE A + +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIVSE 216

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 139/238 (58%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  ARV A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + +++ +    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTRDEGFKIYSDEKTAEIIKEL 243

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  154 bits (389), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L LK L +  +   L  +  + ++I K    K+Y
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVMEEK-LDENNTQLSSITKDEGFKIY 231

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  154 bits (388), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 133/223 (59%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ + ++ AGL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
                +  ++L +K+L +   + A     IE   ++  PD K+
Sbjct: 184 PPADEKECVKLTIKSLLEVVQTGARN---IEITVVK--PDSKI 221

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 132/223 (59%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  TD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
               +E  + L +K+L +   + A     IE   ++  PD ++
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQTGA---KNIEITVVK--PDSEI 221

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 136/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +++ I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L     + ++I K    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNTQLSSITKENGFKIYNDDKTAELIKEL 243

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 135/226 (59%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  +  A++GLTADA  +I  ARV A ++   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L LK L +  +   L  +  + + + K+   K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCVTKSDGFKIY 231

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  152 bits (385), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI AT+G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI + L TL ++ +      D IE A +
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVV 214

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  153 bits (386), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  +   +  A++GLTADA  +I  ARV +  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L LK L +  +   L     + + + K    K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDEGNAQLSCVTKEDGFKVY 231

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI  TD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ I ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSA 205
                E  I+L +K+L +   + A
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQTGA 207

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 144/252 (57%), Gaps = 16/252 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++ ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  +  A++GLTADA  ++  ARV A  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQ--------KIFKP 231
           +   + L+ A +L LK L +  +   L  +  + ++I K    ++Y         K FK 
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVMEEK-LDENNAQLSSITKDDGFQIYSDSKTAEIIKEFKE 245

Query: 232 EEIQSLLVKHGI 243
            E Q    +H +
Sbjct: 246 TEAQENPEQHDV 257

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  152 bits (383), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  T+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ I ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +K+L +   + A
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQTGA 207

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  152 bits (383), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  TD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  ARV AQ++  T  + + ++ L + ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSA 205
                + A++L +K+L +   + A
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQTGA 207

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 139/238 (58%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR+ +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + +++ K    ++Y +    E I+ L
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTKEQGFRIYPESETAEIIKEL 243

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 129/223 (57%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+  TD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  ARV AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 182 DDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
                E  ++L +K+L +   + A     IE   ++  PD ++
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQTGA---KNIEITVVR--PDAEI 221

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR+ +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTD 202
           +   + L+ A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 127/213 (59%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ AT+G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R  A  +Y R Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 VKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
           ++LE AI   L TL ++ +      D IE A I
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVI 214

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 130/219 (59%), Gaps = 8/219 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +GIVL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  ++  ARV A  +   Y+E I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
           +   + L+ A  L LK L +  +   L  +  + ++I K
Sbjct: 187 WHSSLTLKEAESLVLKILKQVMEEK-LDENNAQLSSITK 224

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  150 bits (378), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 129/223 (57%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + R+++ + ++ AGL AD+ ILI  ARV AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 KL---EGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
                +  ++L +K+L +   + A     IE   ++  PD ++
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQTGA---KNIEITVVR--PDARI 221

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  150 bits (378), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 134/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + ++  K    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSTTKEDGFKIYDDSKTAEIIKEL 243

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 127/218 (58%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  ARV AQ++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 185 KL---EGAIELALKTLSKTTDSSALTNDRIEFATIQKA 219
                +  ++L +K L +   + A     IE   ++ A
Sbjct: 184 PPATEQECVKLTVKALLEVVQTGA---KNIEITVVRPA 218

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  149 bits (377), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 129/226 (57%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + +  A  L LK L +  +   L  + ++   I K    ++Y
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCITKDGGFEIY 231

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  ARV AQ++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 185 KL---EGAIELALKTLSKTTDSSA 205
                +  ++L +K L +   + A
Sbjct: 184 PPATEQDCVKLTVKALLEVVQTGA 207

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 123/219 (56%), Gaps = 9/219 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI AT+G+VLA E+K  S L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A  NY R Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 VDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
             + D+++LE A+ +AL  L +  +      D +E A +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVV 220

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 137/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + ++I K    K+Y      E I++L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSITKEEGFKIYDDKKTAEIIKAL 243

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  147 bits (372), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 120/205 (58%), Gaps = 5/205 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +      K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKLQDTRVIASK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  + ++ AGL AD+ IL+N ARV AQ++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  VLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD 183
           GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y  +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYNRE 183

Query: 184 ---VKLEGAIELALKTLSKTTDSSA 205
                 E  I L +K L +   + A
Sbjct: 184 EPPSNKEECIRLTVKALLEVVQTGA 208

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + +E L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSA 205
                E  I+L +K+L +   + A
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQTGA 207

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 132/223 (59%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
               +E  ++L +++L +   + A     IE   ++  PD ++
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA---KNIEITVVR--PDSEI 221

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDVKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  146 bits (368), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDVKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +++L +   + A
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQTGA 207

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 131/223 (58%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
               +E  ++L +++L +   + A     IE   ++  PD  +
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA---KNIEITVVK--PDSNI 221

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 130/223 (58%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 185 KLEG---AIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
             E     + L +++L +   + A     IE   ++  PD ++
Sbjct: 184 PPENVDECVRLTVRSLLEVVQTGA---KNIEITVVK--PDSEI 221

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + + I K    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDSKTAELIKEL 243

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 139/250 (55%), Gaps = 11/250 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVKH 241
                +  + L  ++L +   + A     IE   ++  P  K+  +I   E+I   + + 
Sbjct: 184 PPATADECVRLTTRSLLEVVQTGA---KNIEITVVR--PGSKI--EILSSEQIGKYVEEI 236

Query: 242 GITKKHHDDE 251
              KK H ++
Sbjct: 237 EQEKKEHQEQ 246

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  145 bits (366), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + + I K    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKQDGFKIYDNEKTAELIKEL 243

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   + L+ A  L LK L +  +   L  +  + + I K    K+Y      E I+ L
Sbjct: 187 WHSSLTLKEAELLILKILKQVMEEK-LDENNAQLSCITKQDGFKIYDDKKTAELIKEL 243

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 129/226 (57%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK----QG 121
           +  ++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           +   + L+ A  L LK L +  +   L  +  + + I K    K+Y
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCITKEDGFKIY 231

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 133/223 (59%), Gaps = 9/223 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           + ++++ + ++ +GL AD+ ILI  AR+ AQ++  T  + I VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 185 K---LEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKL 224
               +E  ++L +K+L +   + A     IE   ++  PD ++
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGA---KNIEITVVK--PDSEI 221

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 121/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  + ++ +GL AD+ ILI  ARV AQ++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDD- 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --VKLEGAIELALKTLSKTTDSSA 205
                E  ++L +++L +   + A
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGA 207

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  139 bits (350), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 110/184 (59%), Gaps = 1/184 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T KL +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR  AQ++  T  + + VE + + ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNYAGES 183

Query: 185 KLEG 188
              G
Sbjct: 184 TTAG 187

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  126 bits (316), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ V+SKLL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQ++ +T+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A N+ + Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  123 bits (309), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  123 bits (308), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TSKLL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +QN+ + Y   IPV+   +R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  122 bits (305), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+   DGIVLA E+ VTSKLL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A ++ +TY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELE 177

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKL+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ + Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  121 bits (303), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  120 bits (302), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 14/202 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++  DG+VLA E+ V SKLL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYRLNDKIT-------VAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDI 118
               N KI         A +GL  D   L+N AR  +Q + + Y  DIP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --VDYKDD----VKLEGAIELA 193
             +  +DD      LE   ELA
Sbjct: 188 KLISSRDDNSPITTLEAVKELA 209

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  120 bits (300), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 101/202 (50%), Gaps = 9/202 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I      VL  ++KV  KLLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
            T T  L+ +   I +   G  ADA  +    R  A  +   Y  D+PV +L KR +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK-------DDVKLEGAIELAL 194
           +K       D+   E  +E A+
Sbjct: 180 FKKLQKDRLDEDSWEKVVEFAI 201

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  121 bits (303), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A N+ + Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  119 bits (299), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+VLA E+ +TSKLL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  120 bits (300), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  118 bits (295), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 122/247 (49%), Gaps = 15/247 (6%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I  TD  V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  D+P ++L KR++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGAN----TSAAQTL 175
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G      TSA +  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 176 LQVDYKDDV---KLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPE 232
            +    D V     E  +EL +  +      S  TN  +E     K   GK +     P+
Sbjct: 180 FKKRKGDHVAGESYEKVVELGITQMIDAL-GSEFTNKELEIGVAVK---GKFF--CLTPD 233

Query: 233 EIQSLLV 239
           +I+  LV
Sbjct: 234 QIEERLV 240

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  117 bits (294), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 110/215 (51%), Gaps = 11/215 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +VL  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A  +   Y  DIPV +L KRL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ-- 177
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 178 -----VDYKDDVKLEGAIELALKTLSKT--TDSSA 205
                VD   +   E  +E A+  +S +  TD S+
Sbjct: 180 FKKLNVDCLQEETSEKVVEFAITQMSASLGTDFSS 214

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  118 bits (296), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI  TDG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + N+ + Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ + SKLL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  116 bits (291), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI   DG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ + Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 106/217 (48%), Gaps = 9/217 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +    V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
            T    ++ +   I     G   DA  +    +  A  +   Y  DIP  +L KR++++ 
Sbjct: 61  KT-VSYIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK-------DDVKLEGAIELALKTLSKTTDSSALTND 209
           +K       D+   E  +E  + TL  +  +    ND
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTLIDSLGTDFSKND 216

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 104/201 (51%), Gaps = 10/201 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I      V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P ++L KR+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY-KDD 183
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G       T L+  + K+D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 184 VK-------LEGAIELALKTL 197
           VK        E  +E A+  L
Sbjct: 191 VKEKINEDAWEKVVEFAITQL 211

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  113 bits (282), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 80  LTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYA 138
           +  D  +LI+ +R  A   Y R YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLS 198
           GYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+++LE AI +AL TL 
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTLK 120

Query: 199 KTTDSSALTNDRIEFATI 216
           ++ +      D IE A +
Sbjct: 121 ESVEGE-FNGDTIEIAVV 137

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  115 bits (288), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTSKLL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  115 bits (287), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ + Y+  IP+    +RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELE 177

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I   +  V+  ++KV  KLL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV++L KR++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 108/212 (50%), Gaps = 9/212 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  T+  V+  ++KV  KLL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFKKKT 191

Query: 178 VDYKDDVKLEGAIELALKTLSKTTDSSALTND 209
            D+ ++   E  +E A+  L  +  +    ND
Sbjct: 192 TDHLEEESWEKVVEFAIAHLIDSLGTEFTNND 223

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  111 bits (278), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 117/243 (48%), Gaps = 16/243 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I + + G   DA      A+     +   +  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -VDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQS 236
             DY  +   E  +E  + TL   TDS      + +       PD         P+EI+ 
Sbjct: 191 SQDYMQEESWEKVVEFGITTL---TDSLGTEFSKKDLEVGIAVPDNFF---TLTPDEIEE 244

Query: 237 LLV 239
            LV
Sbjct: 245 RLV 247

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  110 bits (276), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   D  V+  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  D+P ++L KR++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 101/184 (54%), Gaps = 2/184 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  T+ +V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIK 119
           +T +  +++++  + +   G   DA      A+  A  +   Y  D+P ++L KR++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDD 183
           +K +
Sbjct: 180 FKKN 183

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 104/197 (52%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+ +++KV  KLL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 178 VDYKDDVKLEGAIELAL 194
           +D+ ++   E  +E A+
Sbjct: 191 IDHINEESWEKVVEFAI 207

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 105/216 (48%), Gaps = 13/216 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   D  V+  ++KV  KLL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+       
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFKKQK 191

Query: 178 ----VDYKDDVKLEGAIELALKTLSKTTDSSALTND 209
                D+ D+   E  +E A+  L  +  +    ND
Sbjct: 192 NPSKKDHYDEDTWEKVVEFAITQLIDSLGTEFTKND 227

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV  KLL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 178 VDYKDDVKLEGAIELAL 194
           +D+ ++   E  +E A+
Sbjct: 191 IDHINEESWEKVVEFAI 207

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  107 bits (267), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV  KLL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 119/244 (48%), Gaps = 19/244 (7%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV  KLLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK--- 181
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K   
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNNS 191

Query: 182 ----DDVKLEGAIELALKTL--SKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQ 235
               D+   E  +E  +  L  S  TD    T   IE      A +GK +  +   E+I+
Sbjct: 192 LNVVDEESWEKVVEFGISHLIDSLGTD---FTKKDIEVGV---AIEGKFF--VLTEEQIE 243

Query: 236 SLLV 239
             LV
Sbjct: 244 ERLV 247

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 104/197 (52%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK--- 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 182 -DDVK---LEGAIELAL 194
            D +K    E  +E A+
Sbjct: 191 IDHIKEESWEKVVEFAI 207

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  105 bits (263), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 110/222 (49%), Gaps = 8/222 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEG----AIELALKTLSKTTDSSALTNDRIEFATIQK 218
              +K++G     I+  ++ +S++    +LT D +  A + K
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGK 218

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++    L A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R +       YN ++ +E +   LSD  Q
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHCNYSKLVYNRELSMEKIGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERVM 176

Query: 181 KDDVKLEGAIEL 192
            D + +E A EL
Sbjct: 177 DDFLPVEDATEL 188

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEGA---IELALKTLSKTTDSSALTNDRIEFATI 216
           +D ++L+ A   I +A++ L +      L+   +  A +
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVV 215

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  105 bits (261), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV  KLL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            +++++  I +   G   DA      A+  A  +   Y  D+P ++L KR++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEG----AIELALKTLSKTTDSSALTNDRIEFATI 216
              +K++G     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVV 216

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEG----AIELALKTLSKTTDSSALTNDRIEFATI 216
              +K++G     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIV 216

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
            + V LE   EL    ++ L ++     LT + +  A +
Sbjct: 177 DNFVDLEDPEELIKTCVEALRQSLKDETLTTENLSIAIV 215

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 106/221 (47%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + D  VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATIQK 218
            D + +  A EL    ++ L ++     L  D +  A + K
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVVGK 217

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 107/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATIQK 218
            + +++E   EL   A++ L +      L+   +  A + K
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIVSK 217

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  103 bits (257), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 102/200 (51%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I      V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L KR++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYK--- 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 182 -DDVK---LEGAIELALKTL 197
            D +K    E  +E A+  L
Sbjct: 191 TDTLKEDAWEKVVEFAITHL 210

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
              V++E A EL    ++ L ++     L+ D +  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  102 bits (255), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 109/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN ++ +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
           ++ +K+E A EL    ++ L  +     L+   +  A +
Sbjct: 177 EEYLKIETADELIKHGVEALKHSLKDDTLSTKNLSIAVV 215

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  102 bits (255), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 108/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + +  V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ R ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATIQK 218
              +++E   EL    ++ L ++     LT D +  A + K
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIVGK 217

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  102 bits (255), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDVKLEG----AIELALKTLSKTTDSSALTNDRIEFATI 216
              +K++G     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 7/228 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++   +L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R         Y  D+ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDVKLEGA---IELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLY 225
           ++ +++E A   I+  ++ L  +     L+   +  A + K     LY
Sbjct: 250 EEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIVGKDMPFTLY 297

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 120/242 (49%), Gaps = 15/242 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMATDGIVLAAERKVTSKLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV  KLL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  D+P + L KR++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKNN 190

Query: 178 VDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           VD+ ++   E  +E A+  L  +   +  T   +E      A +GK +  +   +EI+  
Sbjct: 191 VDHLEEESWEKVVEFAITHLIDSL-GTEFTKKDLEVGV---AVEGKFF--VLNADEIEER 244

Query: 238 LV 239
           LV
Sbjct: 245 LV 246

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  102 bits (253), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +T   V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + V++AGL  DA +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERVL 176

Query: 181 KDDVKLEGAIEL 192
            D  ++E A EL
Sbjct: 177 DDFREIEDADEL 188

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score = 99.8 bits (247), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
              +++E   EL    +++L ++     L+ + +  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 99.8 bits (247), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         YN  + VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDVKLEGA---IELALKTLSKTTDSSALTNDRIEFATI 216
           +  +++E     I+L ++ L ++     L+   +  A +
Sbjct: 177 EQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVV 215

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 99.4 bits (246), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 109/223 (48%), Gaps = 9/223 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ + +   + A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R         +N D+ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSKLVFNRDLSVEKAGFLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQV-- 178
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLERVL 176

Query: 179 -DYK--DDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
            ++K  +D   E  I++ ++ + ++     L  D +    + K
Sbjct: 177 DEFKELEDEDPESIIKVGVQAIQQSLKDEVLNTDNLSIGIVGK 219

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 96.3 bits (238), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +  +K+ + +  + +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQV-- 178
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 179 -DYKDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATI 216
            D+ +   +E  I++ ++ L ++     LT   +  A +
Sbjct: 177 DDFLEIDNVEELIKVGVEALKQSLKDEDLTTQNLSIAFV 215

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 94.0 bits (232), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120
           +   K+ + ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
           ++ +++E A EL    ++ L ++     L+   +  A +
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIV 215

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 89.4 bits (220), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 105/224 (46%), Gaps = 12/224 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMATDGIVLAAERKVTSK 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +    VL A ++   +
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRL 115
           L    +   K+ + ++ + +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQVDYKDDVKLEGAIEL---ALKTLSKTTDSSALTNDRIEFATI 216
           L+      +++E   EL    ++ L ++     L+N+ +  A +
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIAIV 220

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 64.3 bits (155), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 83  DAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A ++ +TY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDDVKLEGAIELALKTLSKT 200
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K D+  + A++ A + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSALTNDRIEFATIQKAPDGKLYQKIFK 230
            D +      +E +    +    L++ + K
Sbjct: 122 HDDNKEKEFELEMSWCSVSETNGLHKAVPK 151

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 102 YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK 161
           Y  D+P ++L KR++++ Q YTQ   +RP GV   +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLL-------QVDYKDDVKLEGAIELALKTL 197
           A + G       T L       +  Y ++   E  +E A+  L
Sbjct: 88  ATATGPKQQEITTNLENYFKKKETSYLEEDSWEKVVEFAIAHL 130

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 101/221 (45%), Gaps = 16/221 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L + SHA       GT I G+    G+V+AA+ + T   +  D + EKL+R++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K ++  E AI
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 ELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKP 231
           ELA   +     +   +   ++   ++   D +L +    P
Sbjct: 182 ELASNAIEAGIWNDLGSGSNVDICVMEVGKDAELLRNYLTP 222

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 92/205 (44%), Gaps = 20/205 (9%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEIL------ 87
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ +I  A AG  AD E +      
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGS 91

Query: 88  -INTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
            +    +YA+   R          +V  L  +KQ   ++ G    G   I AG D   G 
Sbjct: 92  NVELHSLYAKRQPR----------VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GA 138

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSAL 206
            L++    G+      +S+G+ + AA  +L+ ++K+D+  E AI+LA   +     +   
Sbjct: 139 HLFSVQAHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLASDAIQAGIWNDLG 198

Query: 207 TNDRIEFATIQKAPDGKLYQKIFKP 231
           +   ++   ++   D +  +    P
Sbjct: 199 SGSNVDLCVMETGKDAEYLRNYITP 223

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  E AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (46%), Gaps = 8/199 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  KL+R++ KI  A AG  AD E +  T  +
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+      +S+G+ + AA  +L+  ++ ++  E AIELA + +     +   +   ++
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAIQAGIWNDLGSGSNVD 204

Query: 213 FATIQKAPDGKLYQKIFKP 231
              ++   D +  +    P
Sbjct: 205 VCVMEVGKDAEYLRNYVTP 223

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 91/199 (45%), Gaps = 8/199 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+++AA+ + T   +  D + EKL+R+  +I  A AG  AD E +  T  +
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  SSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+       S+G+ + AA  +L+ ++  D+  E AI+LA   +     +   +   ++
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVD 204

Query: 213 FATIQKAPDGKLYQKIFKP 231
              ++   D +L +    P
Sbjct: 205 VCVMEVGKDAQLLRNYLCP 223

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 92/199 (46%), Gaps = 8/199 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  KL+R++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+      +S+G+ + AA  +L+  +K D+  + A++LA   +     +   +   ++
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIQKAPDGKLYQKIFKP 231
              ++   D +  +    P
Sbjct: 204 VCVMEIGKDAEYLRNYLTP 222

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 92/199 (46%), Gaps = 8/199 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+      +S+G+ + AA  +L+  +K D+  + AI+LA   +     +   +   ++
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIQKAPDGKLYQKIFKP 231
              ++   D +  +    P
Sbjct: 204 VCVMEVGKDAEYLRNYLTP 222

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 84/189 (44%), Gaps = 28/189 (14%)

Query: 20  YQVEYALESISHA--------GTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SHA         T +G+   +G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEIL-------INTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQ 124
           +I  A AG  AD E +       +    +YA    R          +V  L  +KQ   +
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNLELHSLYASREPR----------VVSALQMLKQHLFK 118

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDV 184
           + G    G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+
Sbjct: 119 YQG--HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDL 175

Query: 185 KLEGAIELA 193
             E AI LA
Sbjct: 176 TKEEAINLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 96/221 (43%), Gaps = 16/221 (7%)

Query: 20  YQVEYALESISH--------AGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQ-NYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +        + + L T  E      +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHSLSTRRE----PRVVTTLQMLKQHLFRYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAI 190
            G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ D+  + AI
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKDEAI 181

Query: 191 ELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKP 231
           ELA + +     +   +   ++   +Q   D +  +    P
Sbjct: 182 ELASEAIEAGIWNDLGSGSNVDVCVMQIGQDAQYLRNHRTP 222

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 92/199 (46%), Gaps = 8/199 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL+R++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+      +S+G+ + AA  +L+  +K D+  + AI+LA   +     +   +   ++
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIQKAPDGKLYQKIFKP 231
              ++   D +  +    P
Sbjct: 204 VCVMEIGKDAEYLRNYLTP 222

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 95/210 (45%), Gaps = 9/210 (4%)

Query: 24  YALESISHAGTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTA 82
           YA    +  GT I G+    G+V+AA+ + T   +  D +  KL+R+  +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
           D E +  T  + +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 80  DTEAV--TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTT 201
              G  L++ +  G+       ++G+ + AA  +L+  +K D+  E AI+LA + +    
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLASEAILAGI 192

Query: 202 DSSALTNDRIEFATIQKAPDGKLYQKIFKP 231
            +   +   ++   ++   D +  +    P
Sbjct: 193 WNDLGSGSNVDLCVMEVGKDAEYLRNYITP 222

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 97/206 (47%), Gaps = 8/206 (3%)

Query: 27  ESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEI 86
           ++ S   T +G+   +G+V+AA+ + T   +  + + EKL++++ +I  A AG  AD + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 87  LINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
           +  T  + +   L + +    P   +V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 84  V--TGLIGSNLELHSLFTGREPR--VVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSA 205
             L++ +  G+       S+G+ + AA  +L+ ++K+ +  E AI+LA   +     +  
Sbjct: 137 AHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLAADAIEAGIWNDL 196

Query: 206 LTNDRIEFATIQKAPDGKLYQKIFKP 231
            +   ++   ++   D +L +    P
Sbjct: 197 GSGSNVDVCVMEVGKDAELLRNYITP 222

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 102/222 (45%), Gaps = 17/222 (7%)

Query: 20  YQVEYALESISHA--------GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLN 70
           YQ   AL + SH+        GT I G+   +G+++AA+ + T   +  + +  KL+R++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITVAVAGLTADAEILINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLR 129
            +I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ ++  E A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKP 231
           +ELA + +     +   +   ++   ++   D +  +    P
Sbjct: 182 VELASQAIQAGIFNDLGSGSNVDVCVMEVGKDAEYLRNYLTP 223

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 78/171 (45%), Gaps = 8/171 (4%)

Query: 32  AGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           AGT +GI   D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+ + ++   + +  +  G      + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKLE--GAIELALKTLS 198
           +P G+Y   +  + GA  S     L  QV++K+  + +  G  + AL+ LS
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLS 197

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 95/220 (43%), Gaps = 20/220 (9%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+++AA+ + T   +  D +  KL+R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLVGS 90

Query: 94  YAQ-NYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDR----YGYQL 148
             + + L T+ E      +V  L  +KQ   ++ G    G   I AG D      +  Q 
Sbjct: 91  NLELHSLYTHRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFAVQA 144

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           + S   G Y      S+G+ + AA  +L+ ++K D+  E A++LA   +     +   + 
Sbjct: 145 HGSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAMKLASDAIQAGIWNDLGSG 199

Query: 209 DRIEFATIQKAPDGKLYQKIFKPE----EIQSLLVKHGIT 244
             ++   ++   D +  +    P     + QS   K G T
Sbjct: 200 SNVDLCVMEVGKDAEYLRNYITPNVREPKQQSYKFKRGTT 239

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 83/169 (49%), Gaps = 8/169 (4%)

Query: 26  LESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAE 85
           +++ S   T +G+    G+V+AA+ + T   +  D +  KL+R++ +I  A AG  AD E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ILINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
            +  T  + +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   
Sbjct: 83  AV--TQLIGSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT- 135

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELA 193
           G  L++ +  G+       S+G+ + AA  +L+  +K D+  E AI+LA
Sbjct: 136 GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 27  ESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEI 86
           ++ S   T +G+    G+V+AA+ + T   +  + +  KL+R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 87  LINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
           +  T  + +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 84  V--TKLIGSNLELHSLYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELA 193
             L++ +  G+       S+G+ + AA  +L+  +K+D+  E A++LA
Sbjct: 137 AHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLA 184

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 87/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y+    G+         G+ ++        ++K+D+  E  IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + K    +L   IF P+E + L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 87/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y+    G+         G+ ++        ++K+D+  E  IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + K    +L   IF P+E + L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  KL+R+  +I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELA 193
             G+       S+G+ + AA  +L+ ++K D+  E AI+LA
Sbjct: 144 AHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 86/192 (44%), Gaps = 10/192 (5%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E     +E+A    + + GT +GI   D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD E L+   +    N L+ Y+ D   + L  + +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--L 186
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 187 EGAIELALKTLS 198
           +G ++  LK LS
Sbjct: 184 DGKVKKPLKYLS 195

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 86/206 (41%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + Y + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRI 211
              G+         G+ ++         +++D+  E  I+    +LS+       +   I
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIQKAPDGKLYQKIFKPEEIQSL 237
               + +A   +L   IF PE+ ++L
Sbjct: 193 RMVVLTEAGAERL---IFYPEDYENL 215

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 10/192 (5%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E R   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD E L+   +    N L+ Y+ D   + L    +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--L 186
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGT 183

Query: 187 EGAIELALKTLS 198
           +G ++  LK L+
Sbjct: 184 DGKVKRPLKYLT 195

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 82/174 (47%), Gaps = 20/174 (11%)

Query: 27  ESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEI 86
           ++ S   T +G+    G+++AA+ + T   +  + +  KL+R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 87  L-------INTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAG 139
           +       +    +YA    R          +V  L  +KQ   ++ G    G   I AG
Sbjct: 84  VTKLIGSNLELHSMYASREPR----------VVSALQMLKQHLFKYQG--HIGAYLIVAG 131

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELA 193
            D   G  L++ +  G+       S+G+ + AA  +L+ +++ D+K E A++LA
Sbjct: 132 ADPT-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 87/198 (43%), Gaps = 6/198 (3%)

Query: 34  TAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  KL+R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  YAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
             + + +  N +  V   V  L  +KQ   ++ G    G   I AG D   G  L++   
Sbjct: 91  NLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLFSVQA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIEF 213
            G+      +S+G+ + AA   L+ ++K ++  + A++LA   +     +   +   ++ 
Sbjct: 145 HGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLASDAIQAGIWNDLGSGSNVDV 204

Query: 214 ATIQKAPDGKLYQKIFKP 231
             ++   D +  +    P
Sbjct: 205 CVMEVGKDAEYLRNYITP 222

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 81/191 (42%), Gaps = 15/191 (7%)

Query: 20  YQVEYALESISH--------AGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           Y  E A + I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPF 131
            I ++  G  AD E L+   +   + Y   +N+    ++ +K  +   Q         P+
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDK---KLSIKSAARNIQHLLYGKRFFPY 124

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKL--E 187
            V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+  +   +
Sbjct: 125 YVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGSD 184

Query: 188 GAIELALKTLS 198
           G ++  LK L+
Sbjct: 185 GKVKRPLKYLN 195

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 90/225 (40%), Gaps = 23/225 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD   L+       QN L+ Y+ D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+      
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDS 184

Query: 184 ----------VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
                     + +E  ++L     S  T+      D +E   + K
Sbjct: 185 HGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 84/205 (40%), Gaps = 15/205 (7%)

Query: 36  IGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARVYA 95
           + +   DG++L A+ + T+     +  T+KL R++DK+    +G  AD + + +  + Y 
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYL 60

Query: 96  QNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
           + Y   + E        I      + K   T            I AG+DD+   ++Y+  
Sbjct: 61  ELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGFDDKNKGEVYSIP 111

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+    K    G+ ++        ++K+D+  +  I     +LS+       +   I 
Sbjct: 112 LGGSVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQAIKWDGSSGGVIR 171

Query: 213 FATIQKAPDGKLYQKIFKPEEIQSL 237
              + K    +L   IF PEE ++L
Sbjct: 172 MVVLTKEGAERL---IFYPEEYENL 193

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDV--KLEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+      +G ++  LK LS
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLS 196

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 88/221 (39%), Gaps = 21/221 (9%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKI 73
           P      +E+     S + GT +GI   D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARVYAQNYLRTYNED-IPVEILVKRLSDIKQGYTQHGGLRPFG 132
            ++  G  AD+  L+   R   + Y    NE  + +    + +  +  G        P+ 
Sbjct: 79  VISANGFAADSTALVKRFRNSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----FFPYY 134

Query: 133 VSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDD------- 183
           V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+        
Sbjct: 135 VHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTGE 194

Query: 184 ------VKLEGAIELALKTLSKTTDSSALTNDRIEFATIQK 218
                 + +E  ++L   + +  T+      D +E   + K
Sbjct: 195 KRPITYLSVEEVVKLVRDSFTSATERHIHVGDGLEILIVTK 235

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 6/154 (3%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+ + ++   + +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QVDYKD 182
            +P G+Y   +  + G+  S     L  QV+ K+
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKN 176

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + +   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLTA---GIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRI 211
              G+         G+ ++        ++K+++  E  I     +LS+       +   I
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIQKAPDGKLYQKIFKPEEIQSL 237
               + K    +L   IF PE+ +SL
Sbjct: 193 RMVVLTKEGVERL---IFYPEDYESL 215

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGFAADGEALVKR 87

Query: 91  ARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
            +    N ++ Y+ D   + L    +     +  +G    P+ V  I AG D+     +Y
Sbjct: 88  FK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKL--EGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   +G ++  LK LS
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVKRPLKFLS 196

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 7/172 (4%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +   + Y   +N+    ++ +K  +   Q         P+ V  I AG D+     +Y+
Sbjct: 87  FKNSIKWYHFDHNDK---KLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYS 143

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKLE--GAIELALKTLS 198
            +P G+Y   +  + GA  S     L  QV++K+    E  G ++  LK L+
Sbjct: 144 FDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLT 195

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 87/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQNYLRTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           YT    G+         G+ ++        +++D++  E  +     +LS+       + 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    +  A   +L   +F P+E + L
Sbjct: 190 GVIRMVVLTAAGVERL---VFYPDEYEQL 215

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 82/206 (39%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD   L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGTALVKR 87

Query: 91  ARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
                QN L+ Y+ D   + L  + +     +  +G    P+ V  I AG D+     +Y
Sbjct: 88  ----FQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDD---------------VKLEGAIEL 192
           + +P G+Y   +  + GA  S     L  QV++K+                + +E  ++L
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSKGTKRKELKFLSVEEVVQL 203

Query: 193 ALKTLSKTTDSSALTNDRIEFATIQK 218
                S  T+      D +E   + K
Sbjct: 204 VRDAFSSATERHIHVGDGVEILIVTK 229

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 81/206 (39%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGDNIVMSANGFAADGEALVKR 86

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDD---------------VKLEGAIEL 192
           + +P G+Y   +  + GA  S     L  QV++K+                + +E  I+L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGTNGKVRRPQTYLSIEEVIKL 202

Query: 193 ALKTLSKTTDSSALTNDRIEFATIQK 218
                +  T+      D +E   + K
Sbjct: 203 VRDAFTSATERHIQVGDGLEILIVTK 228

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + +    + +  +  G        P
Sbjct: 88  NILISANGFAADGEALVKRFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR----FFP 143

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKD 182
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  QV++K+
Sbjct: 144 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 85/210 (40%), Gaps = 30/210 (14%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  V+A + + T+       +  K++   D I ++  G  AD + L+  
Sbjct: 28  NGGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKK 87

Query: 91  ARVYAQNYLRTY-----NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
            +    N L+ Y     N+ + ++   + +  +  G      + P+ V  I AG D+   
Sbjct: 88  FK----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGK 139

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDD---------------VKLEG 188
             +Y+ +P G+Y   +  + GA  S     L  QV++K+                + L+ 
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDE 199

Query: 189 AIELALKTLSKTTDSSALTNDRIEFATIQK 218
            IEL     +  T+      D ++   I K
Sbjct: 200 VIELVRDAFTSATERHIHVGDSLQIMIITK 229

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 85/209 (40%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNED---IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + Y   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y+    G+    K    G+ ++        +YKD +  +  ++    +LS+       + 
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + K    +L   I  PEE ++L
Sbjct: 190 GVIRMVVLTKNGVERL---IVYPEEFENL 215

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 96/226 (42%), Gaps = 26/226 (11%)

Query: 20  YQVEYALESISH--------AGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  + + EKL+R+  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQNYLRT-YNEDIPVEILVKRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAI 190
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  ++     EG  
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWR-----EGMG 176

Query: 191 ELALKTLSKTTDSSALTND-----RIEFATIQKAPDGKLYQKIFKP 231
                 L+     + + ND      ++   ++   D +L++    P
Sbjct: 177 RADAMALAAAAIEAGIWNDLGSGSNVDLCVMEVGKDAELFRNYITP 222

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 89/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + +    I  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           YT    G+         G+ ++        ++++++  E  ++    +LS+       + 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + +A   +L   IF P+E + L
Sbjct: 190 GVIRMVVLTEAGVERL---IFYPDEYERL 215

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 88/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQNYLRTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           YT    G+         G+ ++        ++++++  E  ++    +LS+       + 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    +  A   +L   IF P+E + L
Sbjct: 190 GVIRMVVLTAAGVERL---IFYPDEYEQL 215

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 89/210 (42%), Gaps = 18/210 (8%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E    +   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALT 207
           Y S P G     ++ S+  + SA        +YK+D+  E  IE    +LS+       +
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQAIKWDGSS 188

Query: 208 NDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
              I    +      +L   I  P+E ++L
Sbjct: 189 GGVIRMVVLTAEGVERL---IVYPDEYENL 215

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 80/198 (40%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK ++ +E A+EL  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAATHRDAYSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             +    + +  DG +Y 
Sbjct: 248 GSVNLYHVTE--DGWVYH 263

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKLE--GAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++ +    E  G ++  LK LS
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLS 198

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 84/205 (40%), Gaps = 13/205 (6%)

Query: 35  AIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARVY 94
           ++ +   DG++L A+ + T+     +  T+KL R+++KI    +G  AD + + +  + +
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLRTYNEDI--PVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
              Y   Y E        + K L      Y     L       I AGYD++   ++Y+  
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELC-----YENKDNLTA---GIIVAGYDEKNKGEVYSIP 137

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDRIE 212
             G+    K    G+ ++        ++KDD+  +  +     +LS+       +   I 
Sbjct: 138 LGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQAIKWDGSSGGVIR 197

Query: 213 FATIQKAPDGKLYQKIFKPEEIQSL 237
              + K    +L   IF PE+ + L
Sbjct: 198 MVVLTKEGAERL---IFYPEDYEKL 219

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAFSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             I    + +  DG +Y 
Sbjct: 248 GSINLYHVTE--DGWIYH 263

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 78/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAFSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             +    + +  DG +Y 
Sbjct: 248 GSVNLYHVTE--DGWIYH 263

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 89/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQNYLRTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + +    +  +   + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           YT    G+         G+ ++        ++++++  E  ++    +LS+       + 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    +    DG + + IF P+E + L
Sbjct: 190 GVIRMVVL--TADG-VERLIFYPDEYERL 215

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +    G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQNYLRTYNE-DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    + +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  QV++K+  +    G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 87/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R+++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + Y + Y   + E        I      + K   T            I AGYD++   ++
Sbjct: 79  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y+    G+    K    G+ ++        +YK+++  +  +     +LS+       + 
Sbjct: 130 YSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + K    +L   IF PE+ ++L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPEDYENL 215

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 88/210 (41%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDD+  +  +     +LS+       +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQAIKWDGSS 189

Query: 208 NDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
              I    + K  DG + + IF P+E ++L
Sbjct: 190 GGVIRMVVLTK--DG-VERLIFYPDEYENL 216

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 73/185 (39%), Gaps = 4/185 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAATHRDAYSG 247

Query: 209 DRIEF 213
             +  
Sbjct: 248 GSVNL 252

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 74/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKR 86

Query: 91  ARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
            +    N ++ Y+ D   + L    +     +  +G    P+ V  I AG D+     +Y
Sbjct: 87  FK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QVDYKDDVKLE--GAIELALKTLS 198
           + +P G+Y      + GA  S     L  QV++K+    +  G ++   K LS
Sbjct: 143 SFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVKRPFKHLS 195

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 72/185 (38%), Gaps = 4/185 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    K L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  + +   T   A + 
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAATHRDAYSG 247

Query: 209 DRIEF 213
             I  
Sbjct: 248 GSINL 252

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 78/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSILAAAHRDAYSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             +    + +  DG +Y 
Sbjct: 248 GSVNLYHVTE--DGWIYH 263

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 89/208 (42%), Gaps = 13/208 (6%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + + + Y   Y   IP     +  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISV-GANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTND 209
           S P G     +  ++ G+ ++        +YK D+  +  +E    +LS+       +  
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQAIKWDGSSGG 191

Query: 210 RIEFATIQKAPDGKLYQKIFKPEEIQSL 237
            I    + K+   +L   IF PE+ ++L
Sbjct: 192 VIRLVVLTKSGVERL---IFYPEDYENL 216

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 89/210 (42%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        +YK+++  +  ++    +LS+       +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQAIKWDGSS 189

Query: 208 NDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
              I    + K  DG + + IF P+E ++L
Sbjct: 190 GGVIRMVVVTK--DG-VERLIFYPDEYENL 216

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 79/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +Y+ D+ +E A+ L  +++       A + 
Sbjct: 186 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSILAAAHRDAYSG 245

Query: 209 DRIEFATIQKAPDGKLYQ 226
             +  + + +  +G +Y 
Sbjct: 246 GSVNLSHVTE--NGWVYH 261

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 89/207 (42%), Gaps = 11/207 (5%)

Query: 33  GTAIGIMATDG-IVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  DG ++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + + + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDR 210
               G+    K    G+ ++        +Y++++  E  +E    +LS+       +   
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQAIKWDGSSGGV 192

Query: 211 IEFATIQKAPDGKLYQKIFKPEEIQSL 237
           I    + ++   +L   IF P+E ++L
Sbjct: 193 IRLVILTESGVERL---IFYPDEYENL 216

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 79/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAATHRDAYSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             I    + +  +G +Y 
Sbjct: 248 GSINLYHVTE--NGWIYH 263

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 88/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNE---DIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E        +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y+    G+         G+ ++        ++K+ +  E  I+    +LS+       + 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQAIKWDGSSG 189

Query: 209 DRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
             I    + K  DG + + +F P+E ++L
Sbjct: 190 GVIRMVVLTK--DG-VERLVFYPDEYENL 215

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 86/208 (41%), Gaps = 14/208 (6%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNED--IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
           + Y   Y   + E        + K L      Y     L       I AGYD++   ++Y
Sbjct: 79  QYYLDMYEGQFGEPDTYTAANMFKTLC-----YQNKDALT---AGIIVAGYDEKNKGEVY 130

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTND 209
           +    G+         G+ ++        ++++++  +  I+    +LS+       +  
Sbjct: 131 SIPLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQAIKWDGSSGG 190

Query: 210 RIEFATIQKAPDGKLYQKIFKPEEIQSL 237
            I    + K    +L   IF PEE ++L
Sbjct: 191 VIRMVVLTKDGPERL---IFYPEEYENL 215

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 78/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSG 247

Query: 209 DRIEFATIQKAPDGKLYQ 226
             +    + +  DG +Y 
Sbjct: 248 GSVNLYHVTE--DGWIYH 263

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/201 (19%), Positives = 78/201 (38%), Gaps = 6/201 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     + I V    K L ++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSILAAAHRDAYSG 247

Query: 209 DRIEFATIQKAPDGKLYQKIF 229
             I    +  A DG ++   F
Sbjct: 248 GSINLYHV--AEDGWVFHGNF 266

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 77/198 (38%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K L ++   Y   G      +  +  GY  + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKEGPTI 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A + 
Sbjct: 187 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAAAHRDAYSG 246

Query: 209 DRIEFATIQKAPDGKLYQ 226
             I    + +  DG +Y 
Sbjct: 247 GSINLYHVTE--DGWVYH 262

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           ++H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/185 (19%), Positives = 73/185 (39%), Gaps = 4/185 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + ++       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K L ++   Y  +G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTN 208
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAATHRDAYSG 247

Query: 209 DRIEF 213
             +  
Sbjct: 248 GSVNL 252

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       +  K+ R+N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
           Y  +  G         VG+  + A  +L  +YK D+ ++ A+ L  +++
Sbjct: 187 YYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 235

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 80/200 (40%), Gaps = 10/200 (5%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARVYAQNYLRTYNED--IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
               + +Q  L    E   I V    K LS++   Y   G      +  +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKNRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSAL 206
            +Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++       A 
Sbjct: 186 TIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAAAHRDAY 245

Query: 207 TNDRIEFATIQKAPDGKLYQ 226
           +   I    I +  +G +Y 
Sbjct: 246 SGGSINLYHITE--EGWVYH 263

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K LS++   Y   G      +  +  GY  + G  +
Sbjct: 129 TWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 184

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
           Y  +  G         VG+  + A  +L  +Y+ D+ +E A+ +  +++
Sbjct: 185 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSI 233

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 68/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    K L ++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
           Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++
Sbjct: 186 YYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSI 234

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 88/211 (41%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTY---NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDD--RYGY 146
           + Y   Y   Y   +      +      + K   T            I AG+DD  + G 
Sbjct: 79  QYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDDTKKG- 128

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSAL 206
           ++Y+    G+    K    G+ ++        ++K+D+  +  I     +LS+       
Sbjct: 129 EVYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQAIKWDGS 188

Query: 207 TNDRIEFATIQKAPDGKLYQKIFKPEEIQSL 237
           +   I    + ++   +L   IF P+E ++L
Sbjct: 189 SGGVIRMVILTESGVERL---IFYPDEYENL 216

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.4 bits (80), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 8/171 (4%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARVYAQNYLRTYNED--IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
               + +Q  L    E   I V    K LS++   Y   G      +  +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
            +Y  +  G         VG+  + A  +L  +YK D+ +E A+ L  +++
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 83/191 (43%), Gaps = 16/191 (8%)

Query: 20  YQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAG 79
           Y   +  + I    + I +   DG+++AA+R  +   L + +  E+L+ +     V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINTARVY--AQNYLRTYNED---IPVEILVKRLSDIKQGYTQHGGLRPFGVS 134
             +D + L N         NY   Y ED   +    + + L+++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--VDYKDDVK------L 186
            I AG +D   +  Y +     Y+   +++ G     A  LL+  VD + DVK       
Sbjct: 147 LIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLRKIVDSESDVKKTSAEDA 205

Query: 187 EGAIELALKTL 197
           E +I+ A+K L
Sbjct: 206 EKSIKEAMKVL 216

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 85/207 (41%), Gaps = 11/207 (5%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + + + Y   Y     ++        I   Y     L       I AG+DD+    ++Y+
Sbjct: 79  QYHLELYESQYGAP-SIKTAASVFKSI--CYENKDNLSA---GIIVAGFDDKNEKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDR 210
               G+    K    G+ ++         +K+D+  +  +     +LS+       +   
Sbjct: 133 IPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNFIKHSLSQAIKWDGSSGGV 192

Query: 211 IEFATIQKAPDGKLYQKIFKPEEIQSL 237
           I    + K    +L   IF P+E + L
Sbjct: 193 IRMVILTKEGVERL---IFYPDEYEKL 216

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 71/171 (41%), Gaps = 8/171 (4%)

Query: 29  ISHAGTAIGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARVYAQNYLRTYNED--IPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
               + +Q  L    E   I V    K LS++   Y   G      +  +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTL 197
            +Y  +  G         VG+  + A  +L  +YK D+ ++ A+ L  +++
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 236

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 86/207 (41%), Gaps = 11/207 (5%)

Query: 33  GTAI-GIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADI- 77

Query: 92  RVYAQNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
               Q +L  Y+            S  K    ++      G+  I AG+DD     ++Y+
Sbjct: 78  ---VQYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDATNKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQVDYKDDVKLEGAIELALKTLSKTTDSSALTNDR 210
               G+    K    G+ ++        ++KDD+  +  +     +LS+       +   
Sbjct: 133 VPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQAIKWDGSSGGV 192

Query: 211 IEFATIQKAPDGKLYQKIFKPEEIQSL 237
           I    +      +L   IF P+E ++L
Sbjct: 193 IRMVVLTSEGVERL---IFYPDEYENL 216

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERK----VTSKLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYR-----LNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSD 117
             KL R     L  K+ V +  LT + +   + A++    Y R+  + I +E++ +   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>KAFR0D03050 Chr4 complement(602858..603301) [444 bp, 147 aa] {ON}
           Anc_2.449 YKL122C
          Length = 147

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 39  MATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEI 86
           +   G+ +  +RK+T KLL  D +++K+  +N   TV ++   A+ ++
Sbjct: 73  LGPRGVTIIPKRKITKKLLHADKTSKKIKTIN---TVGLSAFMANTKV 117

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 111 LVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL-----YTSNPSGNYTGWK 161
           L+K L D K+    HGGL     +F  AGY+ +  +       Y SNP    +GW+
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQ 747

>CAGL0L05742g Chr12 complement(632841..633758) [918 bp, 305 aa] {ON}
           similar to uniprot|P10566 Saccharomyces cerevisiae
           YJL133w MRS3 or uniprot|P23500 Saccharomyces cerevisiae
           YKR052c MRS4
          Length = 305

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 68/170 (40%), Gaps = 27/170 (15%)

Query: 36  IGIMATDGIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEILINTARVYA 95
           +G      +  A    V S L+++ TST K +      + A A + ADA  L+N   V  
Sbjct: 89  LGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADA--LMNPFDVIK 146

Query: 96  QNYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRP--FGVSFIYAGYDDRYGYQLYTS-- 151
           Q      N +I V    KR+   K+G+       P    ++  +A ++    + +Y +  
Sbjct: 147 QRI--QLNTNISVWDTAKRIYS-KEGFQAFYSSYPTTLAINIPFAAFN----FGIYDTAT 199

Query: 152 ---NPSGNYTGWKAISVGANTSAA-----------QTLLQVDYKDDVKLE 187
              NPSG Y  +     G  + AA           +T LQV   + V +E
Sbjct: 200 RYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSME 249

>TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 69/160 (43%), Gaps = 15/160 (9%)

Query: 43  GIVLAAERKVTSKLLEQDTSTEKLYRLNDKITVAVAGLTADAEIL------INTARVYAQ 96
           G+V+AA+   +   L +    E+L ++     V V+G  +D + +      I T   Y  
Sbjct: 52  GVVIAADNLASYGSLLRFNGIERLIKVGQNTVVGVSGDVSDMQHIERLLEEIETDNNYDN 111

Query: 97  NYLRTYNEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGN 156
            Y  ++ +  P  +  K LS +   Y++   + P   + I AG ++   +  Y +     
Sbjct: 112 TYSESFEQLQPSYVF-KYLSAVM--YSRRSKMNPLWNAIIVAGVENGAPFMRYVNLLGVT 168

Query: 157 YTGWKAISVGANTSAAQTLLQ--VDYKDDVK---LEGAIE 191
           YT    ++ G     A  L++  VD ++DV     E A+E
Sbjct: 169 YTS-PTLATGFGAHLANPLMRRVVDREEDVANTTREAAVE 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,394,165
Number of extensions: 1082650
Number of successful extensions: 3064
Number of sequences better than 10.0: 257
Number of HSP's gapped: 2874
Number of HSP's successfully gapped: 257
Length of query: 255
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 148
Effective length of database: 41,212,137
Effective search space: 6099396276
Effective search space used: 6099396276
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)