Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056603.498ON44244219630.0
Kpol_480.113.498ON4634657032e-87
SAKL0F02552g3.498ON4784826573e-80
KLTH0G02398g3.498ON4624546232e-75
Kwal_47.188953.498ON4434636194e-75
Suva_16.4803.498ON4524496119e-74
KAFR0G037203.498ON4094376002e-72
ZYRO0D09768g3.498ON4602425734e-68
Skud_16.4463.498ON4564565562e-65
Smik_16.4043.498ON4604675543e-65
KNAG0A079703.498ON3884415406e-64
YPR152C (URN1)3.498ON4654605441e-63
KLLA0E03939g3.498ON4354415141e-59
TPHA0A056903.498ON4782444925e-56
Ecym_12313.498ON3292314153e-46
AFR317C3.498ON3282333681e-39
CAGL0L08404g3.498ON4104433671e-38
NDAI0B059003.498ON5222592831e-26
NCAS0F035803.498ON4132382614e-24
TBLA0D029303.498ON2762512062e-17
KAFR0A002302.649ON556801188e-06
KNAG0M024702.649ON606991044e-04
Smik_11.2432.649ON57981980.002
YKL012W (PRP40)2.649ON58381970.003
Kpol_1073.42.649ON53084930.007
Suva_11.2162.649ON58580910.014
Skud_11.2172.649ON583125910.015
NCAS0C051102.649ON60482890.023
TBLA0C009302.649ON65891890.026
CAGL0L05368g2.649ON59082880.029
Ecym_33972.649ON57581810.20
KLLA0E18239g2.649ON57180810.21
ZYRO0E00682g2.649ON57086800.31
Kwal_14.9392.649ON56292800.31
NDAI0G046002.649ON64796800.34
TPHA0L020202.649ON583103790.38
Ecym_83948.134ON84197770.82
CAGL0K02255g8.134ON82297760.83
NDAI0B024608.134ON83697760.84
TBLA0G027908.134ON84497760.85
KAFR0B021008.134ON80097760.85
Kpol_1031.398.134ON81597760.87
Skud_5.2538.134ON80997760.87
TPHA0D010308.134ON82297760.88
KLTH0E06908g8.134ON79197760.88
Smik_5.2718.134ON80897760.88
Suva_5.2468.134ON80997760.88
ZYRO0G18920g8.134ON81997760.88
NCAS0B045408.134ON83597760.89
YER125W (RSP5)8.134ON80997760.94
TDEL0F009908.134ON78997761.00
KNAG0D021808.134ON81197761.0
Kwal_47.173028.134ON78797761.0
SAKL0H24552g8.134ON79097761.0
KLLA0E13575g8.134ON81997761.1
SAKL0G19360g2.649ON56882751.1
ADL055C8.134ON81797751.4
ADR159C2.649ON56927713.3
TDEL0B074402.649ON57078713.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05660
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   760   0.0  
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   275   2e-87
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   257   3e-80
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   244   2e-75
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   243   4e-75
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   239   9e-74
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   235   2e-72
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   225   4e-68
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   218   2e-65
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   218   3e-65
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   212   6e-64
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   214   1e-63
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   202   1e-59
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   194   5e-56
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   164   3e-46
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   146   1e-39
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   145   1e-38
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   113   1e-26
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   105   4e-24
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    84   2e-17
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    50   8e-06
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    45   4e-04
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    42   0.002
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    42   0.003
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    40   0.007
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    40   0.014
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    40   0.015
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    39   0.023
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    39   0.026
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    39   0.029
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    36   0.20 
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    36   0.21 
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    35   0.31 
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    35   0.31 
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    35   0.34 
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    35   0.38 
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    34   0.82 
CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa] ...    34   0.83 
NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134     34   0.84 
TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.1...    34   0.85 
KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.1...    34   0.85 
Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON} (93761....    34   0.87 
Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON...    34   0.87 
TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.1...    34   0.88 
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    34   0.88 
Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W ...    34   0.88 
Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W ...    34   0.88 
ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} high...    34   0.88 
NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134     34   0.89 
YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3 ubi...    34   0.94 
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    34   1.00 
KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {O...    34   1.0  
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    34   1.0  
SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} high...    34   1.0  
KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} high...    34   1.1  
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    33   1.1  
ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON} S...    33   1.4  
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    32   3.3  
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    32   3.7  

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/442 (85%), Positives = 380/442 (85%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW
Sbjct: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120
           FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY
Sbjct: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120

Query: 121 QEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXXXX 180
           QEVIDDLKALRKGSAV                       KRPSGLIAGY           
Sbjct: 121 QEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEENEID 180

Query: 181 XXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI 240
               KLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI
Sbjct: 181 SDVEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI 240

Query: 241 TDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSK 300
           TDDSIRESMFEEWCEKAINRTTNPQ                        PFHYLAHIVSK
Sbjct: 241 TDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEPLPFHYLAHIVSK 300

Query: 301 ANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHD 360
           ANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHD
Sbjct: 301 ANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHD 360

Query: 361 LLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDP 420
           LLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDP
Sbjct: 361 LLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDP 420

Query: 421 KYYVLGIKDKMIELMHYLTSYI 442
           KYYVLGIKDKMIELMHYLTSYI
Sbjct: 421 KYYVLGIKDKMIELMHYLTSYI 442

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  275 bits (703), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/465 (36%), Positives = 242/465 (52%), Gaps = 30/465 (6%)

Query: 3   RLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           ++W  F AP G KYYYN+++KESTW +P+S Y D    +    R   P +  PL+N W L
Sbjct: 4   KIWKEFNAPDGRKYYYNIKSKESTWTKPDSLY-DTEKGKVGSDRAGAPLFVFPLLNGWHL 62

Query: 63  VIDDIGGKYYFDSSTEEA-SWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVYQ 121
           +I   G KYY++    +  S  L D  S +LL+ +DK+K+ILL+A+ARGYN    +++Y 
Sbjct: 63  IICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEKLYD 122

Query: 122 EVIDDLKALRKG---SAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXX 178
           E++ + + +      +                            +GLI GY         
Sbjct: 123 ELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIGGYLSSDDEESS 182

Query: 179 XXXXXXKLNNLG-DDDLPK---ENHEDES-----------------QIRNDFFQLLQRHQ 217
                    N   ++DL K   +N  DE+                 + ++ F +L +  Q
Sbjct: 183 DENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSKSLFTRLFEEFQ 242

Query: 218 CDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXX 277
            DPYS+W +Q +KIQ  P +++ITD+S RE +FE WC    N                  
Sbjct: 243 LDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFN--GGKSNVTNFEGEDEET 300

Query: 278 XXXXXXXXXXXXPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQET 337
                        FHYLAHI+SKA+I   TIF DIK+ NK+ FK++KIK F+KSK  QE 
Sbjct: 301 LTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIKDFIKSKKDQEA 360

Query: 338 FVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIE 397
           F SKLLF+YKKF L+ERK +F  LL+ +   I  N+    E +R  +  +   ++AY IE
Sbjct: 361 FSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKNDV--DEAYEIE 418

Query: 398 TKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442
           T+LL++E +IGL   + +LANDPKYY+LGIKDK+I L  YL   I
Sbjct: 419 TQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLKDKI 463

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  257 bits (657), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 164/482 (34%), Positives = 238/482 (49%), Gaps = 46/482 (9%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           M   W  FT PSG+KYYYNL TK+ST ++P  F +    KR KL  +P+  Y +PL   W
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQKLQHKPK--YLVPLDKGW 58

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120
            LV+ + G K+Y +  T E+ WTL+DP S ELL  +DK K++LL+ I+RGY     + VY
Sbjct: 59  SLVLCNTGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRN-VY 117

Query: 121 QEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXXXX 180
            E+I+DLK L+  S                         ++  GL+ GY           
Sbjct: 118 DEIINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENI 177

Query: 181 XXXXK---------------------LNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCD 219
               +                     ++    D+L   +   +   +N F  L  ++  D
Sbjct: 178 EEEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTILFDKYNLD 237

Query: 220 PYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRT-----------TNPQXXX 268
           PYS W  Q+RKI +DP FY +T+ S R+ +FE+WC + I  +            +     
Sbjct: 238 PYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQRQ 297

Query: 269 XXXXXXXXXXXXXXXXXXXXXP---------FHYLAHIVSKANITPSTIFQDIKDQNKAD 319
                                P         FHYL+HI+SK++I  +TIF DIK +NKA 
Sbjct: 298 ESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKAL 357

Query: 320 FKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESES 379
           FK ++IK  +K K  QE F SKLLFYYK+  L++RK IF  LL S    I+ NL +  E 
Sbjct: 358 FKTFRIKSSLKKKD-QEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRSNL-RNVEK 415

Query: 380 MRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLT 439
           +R   +E++   D+YAIET+LL ME+ + +   +  L  +  YY+LGIKDK I+L  +L 
Sbjct: 416 LRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQLKQFLQ 475

Query: 440 SY 441
            +
Sbjct: 476 KF 477

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  244 bits (623), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 235/454 (51%), Gaps = 20/454 (4%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           M R W  +  P G KYYYN+ TK ST  +P+ F E    +      +P   + +PL NDW
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDW 65

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDR-V 119
            L + + G ++++ SSTEE+ W +ED ES  +LS +DKNK++LL+A ARG++  +G+R V
Sbjct: 66  VLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFD--IGERDV 123

Query: 120 YQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXX-XXXXKRPS----GLIAGYXXXXX 174
           YQE+++D+  L++   V                        + PS     LI+ Y     
Sbjct: 124 YQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYESSDE 183

Query: 175 --------XXXXXXXXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSI 226
                             + +N   +DL   +H+     +  F  L   +  DPYSTW++
Sbjct: 184 DGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYSTWNM 243

Query: 227 QARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXX 286
           Q++KI ++PLFY++  D+ R  +FE+WC   +      +                     
Sbjct: 244 QSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDDTSTD 303

Query: 287 XXXP--FHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLF 344
              P  +HYLAHIVSKA + PST+ +D++ + K  FK++KIK+ +  K QQ+ F+SKLLF
Sbjct: 304 ELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESL-GKKQQDEFLSKLLF 362

Query: 345 YYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKME 404
           YYK  T ++R E+    L++  + I K   +  E + S LS++      +AIE++LL++E
Sbjct: 363 YYKNMTEEQRLEVLVKFLKTRRKLIMKGF-RNIEQLESVLSQQDLPTSGFAIESQLLRLE 421

Query: 405 NLIGLARDMEELANDPKYYVLGIKDKMIELMHYL 438
           + I +    + L ++ +YYVLGIK K   L  +L
Sbjct: 422 DCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFL 455

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  243 bits (619), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 158/463 (34%), Positives = 244/463 (52%), Gaps = 41/463 (8%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           M R W  +  P G KYYYNL TK+ST++ P+ F ED  + R     + +P +A+ L NDW
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDR-V 119
            L+I + G +++++S +  + W L+D  S ELL+ +D+ K++LLV +A+G++   GDR V
Sbjct: 61  ALIICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFDP--GDRNV 118

Query: 120 YQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGY---------- 169
           YQE+ D +  L++ S                              L++GY          
Sbjct: 119 YQELSDSISELKEDS--------NNRDFRKETAEESIPTAVPGQSLVSGYGSSDESDKDE 170

Query: 170 -XXXXXXXXXXXXXXXKLNNLGDDD-------LPKENHEDESQIRNDFFQLLQRHQCDPY 221
                              N+ D D       LP+ ++ ++++    F  L  ++  DPY
Sbjct: 171 DEEEEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAE----FISLFSKYAVDPY 226

Query: 222 STWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXX 281
           STW++Q+RKI++DPLFY+IT+D+ R+ +FE WC   +N  +N Q                
Sbjct: 227 STWNMQSRKIRDDPLFYKITNDADRKELFENWC---MNECSN-QSEVPAIDEQIISSDDE 282

Query: 282 XXXXXXXXP--FHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFV 339
                   P  +HYLAHIVSK+ IT ST+ +DI+   K  FK+++IK  + SK +Q+ F+
Sbjct: 283 DPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFL 341

Query: 340 SKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETK 399
           SKLLFYYK+ T ++R  IF   LE   +++KK L+ + E + + LS  +   + YAIET+
Sbjct: 342 SKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKNQ-ERLSTILSTPSLPQENYAIETQ 400

Query: 400 LLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442
           LL +E+ I        L  D +YYVLGIKDK + L   L   I
Sbjct: 401 LLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDLI 443

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  239 bits (611), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 145/449 (32%), Positives = 231/449 (51%), Gaps = 32/449 (7%)

Query: 4   LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR-EPEPFYAIPLVNDWFL 62
           +W  F  P+G++Y+YN  TKES W +P+     G   R K+ + E +P +A+ L++DW L
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65

Query: 63  VIDDIGGKYYFDSSTEEASWTLED---PESAELLSTIDKNKIILLVAIARGYNTNVGD-- 117
           +I + G K+Y++  +  + + +++    + A L++++DK K+ILL+ +ARGYN    D  
Sbjct: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125

Query: 118 RVYQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXX 177
           ++++ + +++   +K   V                          +GL++GY        
Sbjct: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANS--AGLVSGYGSSSEEEE 183

Query: 178 XXXXXXXKLNNLGDDDLPKENHEDESQI--RNDFFQLLQRHQCDPYSTWSIQARKIQEDP 235
                      + DD     N  D   +  R  FFQL  R++ D +STWS+Q +KI+ DP
Sbjct: 184 EEEEPENDDAGIIDD----LNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDP 239

Query: 236 LFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLA 295
            FY++ D ++RES+FEEWC  A    +  +                         FHYLA
Sbjct: 240 DFYKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEPTK-----------FHYLA 288

Query: 296 HIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERK 355
            IV+KA I P  I QDI+ Q KA FK Y+IK++V SK  Q+ FVS+LLFYYK F+L++RK
Sbjct: 289 QIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRK 348

Query: 356 EIFHDLLESHSRSIKKNLEQESESMRSTLSEEA----GSNDAYAIETKLLKMENLIGLAR 411
           EIF + L  H R     ++   + +      +A     + D  ++E  LL +E+  G+  
Sbjct: 349 EIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVG- 407

Query: 412 DMEELANDPKYYVLGIKDKMIELMHYLTS 440
               LA DP+YYVLGI DK    + +L +
Sbjct: 408 -AIALA-DPRYYVLGILDKTAGWVRWLAA 434

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  235 bits (600), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/437 (35%), Positives = 224/437 (51%), Gaps = 38/437 (8%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           M ++W  + AP+G+KYYYN  TK++TW++PE+       KR     E EP + I L+NDW
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEA------AKRE----EIEPVFVIRLMNDW 50

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120
            LVI + G KYY D+  E     L D ES  L+   DK K++ L+ IARGY     +++Y
Sbjct: 51  KLVICNNGMKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIY 109

Query: 121 QEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXXXX 180
             ++++++ L++                            R + +               
Sbjct: 110 GNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSSESEEEEEEE 169

Query: 181 XXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI 240
                LNN+ D+ L        S  +  F +L  R+  D +S WS++  K+ +DP FY +
Sbjct: 170 DDYEFLNNVADEGL--------SGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLV 221

Query: 241 TDDSIRESMFEEWCE-KAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVS 299
           TDD  RE +FE WC  + I+ T++ +                         FHYL+ IVS
Sbjct: 222 TDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLEPT------KFHYLSQIVS 275

Query: 300 KANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKF-TLDERKEIF 358
           K+ I  +TIFQDIK QNK  FK+YKIK F++S  +QE FVSKLLFYYK F  +++R + F
Sbjct: 276 KSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQF 335

Query: 359 HDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELAN 418
           +D L       +KN    S S  +TLSE    ND YAIET LL++E      +D   + +
Sbjct: 336 NDFLR------EKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE--CNFPQD---VLS 384

Query: 419 DPKYYVLGIKDKMIELM 435
           D +YY+L +K K IEL+
Sbjct: 385 DVRYYILDLKQKTIELV 401

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  225 bits (573), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 155/242 (64%), Gaps = 6/242 (2%)

Query: 201 DESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINR 260
           D S  +   + L  R+  +PYS W  + +KI++DP F R+ DDS+RE +FEEWC  AI+ 
Sbjct: 225 DISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS- 283

Query: 261 TTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSKANITPSTIFQDIKDQNKADF 320
                                         +HYLAHIVSK+NITP+TIF DIK+ NK+ F
Sbjct: 284 -----GDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSF 338

Query: 321 KKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESM 380
           KKY IK F+ SK  QE+FVSKLLFYYK+  L+ERKE+F  LL+ + ++I++NL  + + +
Sbjct: 339 KKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKV 398

Query: 381 RSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTS 440
           R  L++E  SND YA+ETKL KME  +GL  ++ +L  +PKYY+LGI+DKM+EL  YL  
Sbjct: 399 RHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLKI 458

Query: 441 YI 442
           Y+
Sbjct: 459 YV 460

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 83/134 (61%), Gaps = 3/134 (2%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR--EPEPFYAIPLVN 58
           M R+W  + AP G KYYYN  TK+STW +PES  E   N+  K  +  E +P  A+ L +
Sbjct: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60

Query: 59  DWFLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDR 118
            W LVI D G K+Y++  T E++W L D  S  L+  +DKNK++ L+ +ARGY+   G  
Sbjct: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPG-GLH 119

Query: 119 VYQEVIDDLKALRK 132
           +Y+E++ DL  LR+
Sbjct: 120 IYEELVTDLVKLRQ 133

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  218 bits (556), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 233/456 (51%), Gaps = 40/456 (8%)

Query: 4   LWTTFTAPSGEKYYYNLRTKESTWKRPE-SFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           +W  F  P+G +YYYN +TK+S W+ P+   + D  N    L  E +P +++ L++ W L
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 63  VIDDIGGKYYFDSSTEEASWTL---EDPESAELLSTIDKNKIILLVAIARGYNTNVG--D 117
           VI + G K+Y++S ++     +    D + + L+ ++DK K++LL+ +ARGY+      D
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 118 RVYQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXX 177
           ++++ + +++   +K                           +  +GLI+GY        
Sbjct: 121 KIFESLNEEINLFKKNQ----NEAGRVDEANEEPGDVNPPLKEHHTGLISGY--GSSSEE 174

Query: 178 XXXXXXXKLNNLGDDDLPKENH--EDESQI-------RNDFFQLLQRHQCDPYSTWSIQA 228
                  +  + G+ DL K+    +D +QI       R  FF+L  R++ D +STWS+Q+
Sbjct: 175 EEEEEEEEEEDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQS 234

Query: 229 RKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXX 288
           +KI+ DP FY I DD++RE  FEEWC    + +   +                       
Sbjct: 235 KKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVGDVLEPTK-------- 286

Query: 289 XPFHYLAHIVSKAN-ITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYK 347
             +HYLA I++KA  I P  + QDI+ Q K  +K Y+IK++V SK +Q+ FVS+LLFYYK
Sbjct: 287 --YHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYK 344

Query: 348 KFTLDERKEIFHDLLESHSRSIK---KNLEQESESMRSTLSEEAGSNDAYAIETKLLKME 404
            F+L++RKEIF D L  H R      K++ +ES  +    +      D  ++E  LL +E
Sbjct: 345 TFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIE 404

Query: 405 NLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTS 440
               +      +A DP+YYV+GI DK +  + +L +
Sbjct: 405 YRCNIV-----VAADPRYYVVGILDKTMVWVRWLAA 435

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  218 bits (554), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 234/467 (50%), Gaps = 55/467 (11%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR-EPEPFYAIPLVND 59
           M  +W  F  P+GEKYYYN  TK+S W++P            K+++ E  P +A+ L++ 
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 60  WFLVIDDIGGKYYF--DSSTEEASWTLEDP-ESAELLSTIDKNKIILLVAIARGYNTNVG 116
           W L+I + G K YF  DS   ++    E   +   L+ ++DK+K++LL+ IARGY+    
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 117 D--RVYQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXX- 173
           D  ++++ + +++   +K                           +  +GLI+GY     
Sbjct: 121 DIDKIFESLNEEIDLFKKNQ----DGFEREIETREEAGVVKSLLSESHTGLISGYGSSSE 176

Query: 174 ----------------XXXXXXXXXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQ 217
                                       LN++  DD+      DE + R+ FFQL  R++
Sbjct: 177 EEEEEEEEEEEEDHAEQGVNQNVSIIDDLNHIDADDI------DEGRERSLFFQLCDRYK 230

Query: 218 CDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXX 277
            D +STWS+Q++KI+ DP FY+I DD++RE +FEEWCEK   + ++ +            
Sbjct: 231 LDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNVLEPTK-- 288

Query: 278 XXXXXXXXXXXXPFHYLAHIVSKA-NITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQE 336
                        +HYLA IV+KA NI P  I QDI+ + KA +K Y+IK++V  K +Q+
Sbjct: 289 -------------YHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQD 335

Query: 337 TFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIK---KNLEQESESMRSTLSEEAGSNDA 393
            FVS+LLFYYK F L++RK IF D L  H R       +L Q+++ +    +      D 
Sbjct: 336 RFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDG 395

Query: 394 YAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTS 440
            +IE  LL +EN   ++     +  DP+YYV+GI +K +  + +L +
Sbjct: 396 TSIEDVLLSIENRCCVS---AIVVADPRYYVVGILEKTVVWVRWLAA 439

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  212 bits (540), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 214/441 (48%), Gaps = 59/441 (13%)

Query: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
           M  +W  + AP+G+KYY+N  T E+TW  P +       ++P+     +P Y IPL+N W
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYT-------RKPQRELSIKPQYVIPLLNAW 53

Query: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120
            LVI + G K+Y +   +    TL+D +S+ELLS +D+ K+ILL+ +ARGY+   GD+VY
Sbjct: 54  NLVICNNGAKFYLNPDGDPV-LTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDKVY 112

Query: 121 QEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXXXX 180
             V++++  L+   A                          PS L++GY           
Sbjct: 113 NSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSALVSGYGSSSDGSDDEE 172

Query: 181 XXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI 240
                        +P +   +    R  +F L   +  D YS WSI++ KI  DP F+ I
Sbjct: 173 E------------VPPDTDAN----RISYFNLFSEYGLDKYSVWSIESLKISNDPRFHII 216

Query: 241 TDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSK 300
           +DD  RE +FEEWC   +   +  +                         +HYL+ IV+K
Sbjct: 217 SDDRQREEIFEEWCCSGVVDDSEDEGYSSGDDDLSPTK------------YHYLSQIVAK 264

Query: 301 ANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHD 360
           + +TP+TIFQDIK +  + FK+Y IKQF+ SK +QE FVS+LLFYYKKFTL+ER ++F  
Sbjct: 265 STVTPTTIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTK 323

Query: 361 LLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYA---IETKLLKMENLIGLARDMEELA 417
            +              +ES   T+       D+     IET LL+ME+ +        + 
Sbjct: 324 FI--------------AESRTGTVPSPTSPADSATPEDIETNLLQMESHLP-----PTVL 364

Query: 418 NDPKYYVLGIKDKMIELMHYL 438
           ++  YY L IK K   L   L
Sbjct: 365 DNTVYYTLDIKTKQSVLHRML 385

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  214 bits (544), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 144/460 (31%), Positives = 230/460 (50%), Gaps = 40/460 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR---EPEPFYAIPLVNDWF 61
           W  F  P+G+KYYYN  TK+S W++P    + G N          E +P +++ LVN W 
Sbjct: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPN--LKKGSNLESNAKESQTERKPTFSLELVNGWH 62

Query: 62  LVIDDIGGKYYFDSSTEEASWTL---EDPESAELLSTIDKNKIILLVAIARGYNTNVGD- 117
           L+I + G K YF+  ++E    +   +D     L+ ++DK K++LL+ +ARGY     D 
Sbjct: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDI 122

Query: 118 -RVYQEVIDDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXX 176
            ++ +   +++   ++                           +  +GL++GY       
Sbjct: 123 DKILESCNEEIHLFKRNQ----DEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEE 178

Query: 177 XXXXXXXXKLNNLGD---------DDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQ 227
                      N            DDL + + +D  + RN FF+L  R++ D +STWS+Q
Sbjct: 179 DEEEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDE-RNIFFELFDRYKLDKFSTWSLQ 237

Query: 228 ARKIQEDPLFYRITDDSIRESMFEEWC-EKAINRTTNPQXXXXXXXXXXXXXXXXXXXXX 286
           ++KI+ DP FY+I DD++RES+FEEWC E++ N T                         
Sbjct: 238 SKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTK---- 293

Query: 287 XXXPFHYLAHIVSKAN-ITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFY 345
               +HYLA IV+ A  I P TI QDI+ Q KA +K YKIK+++ SK  Q+ FVS+LLFY
Sbjct: 294 ----YHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFY 349

Query: 346 YKKFTLDERKEIFHDLLESHSRSIK---KNLEQESESMRSTLSEEAGSNDAYAIETKLLK 402
           YK F L++RKEIF D L  H R      ++L Q+ E +    +      D+ +IE  LL 
Sbjct: 350 YKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLS 409

Query: 403 MENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442
           +E+   ++     +  +P+YYV+GI +K +  + +L + +
Sbjct: 410 IEHRCCVS---PIVVTEPRYYVVGILEKTVVWVRWLAAEV 446

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  202 bits (514), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/441 (31%), Positives = 223/441 (50%), Gaps = 22/441 (4%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
           W  F  PSG  YY+N R+K ST ++P+ F    G+++  +     P + +PL N W LVI
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEF----GSQQAGMKELRVPVFCLPLRNYWNLVI 59

Query: 65  DDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVYQEVI 124
              G K++ +  +  + + L D ES  LL  +D + + LL+ +ARG+N      VY E+ 
Sbjct: 60  CKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIR 119

Query: 125 DDLKALRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIAGYXXXXXXXXXXXXXXX 184
           D L+A    +                         +  + L++GY               
Sbjct: 120 DVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSSSDDSGEESEVEE 179

Query: 185 K-----LNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYR 239
           K     ++   +D LP  N+   ++I + F QLL   Q DPYSTWSIQA++I  DP +Y 
Sbjct: 180 KNDPSSIDVKEEDTLPSLNN---TEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYL 236

Query: 240 ITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVS 299
           IT +  R+ +F+ WC + +N + N                           +HYLAHI+S
Sbjct: 237 ITSNDKRDELFQTWCSQQLNNSNN-DNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIIS 295

Query: 300 KANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFH 359
           KANITP T+F +IK +NK+ FK+ +I + + +K +QE F SK++ YYK+    +R E+F 
Sbjct: 296 KANITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQRTELFK 354

Query: 360 DLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEE--LA 417
            ++++  R         SE +   + EE  S D++ +ET+LL++EN + +  +++   + 
Sbjct: 355 KMMKNKLR-----FPPISEKLSQLMLEETPS-DSFKLETQLLQLENALLILDNLQNSYMQ 408

Query: 418 NDPKYYVLGIKDKMIELMHYL 438
           N+  YY+LGIKDK+  L   L
Sbjct: 409 NEIMYYILGIKDKLAALKEIL 429

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  194 bits (492), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 154/244 (63%), Gaps = 16/244 (6%)

Query: 209 FFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEK---------AIN 259
           +FQL +++Q + +STWS Q++ + +DP FY ITD+S+RE +FEEWC +         +++
Sbjct: 233 YFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVD 292

Query: 260 R-----TTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSKANITPSTIFQDIKD 314
           +     ++                            +HYL+HI+SKANI+P TIFQDIK 
Sbjct: 293 KDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIKK 352

Query: 315 QNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLE 374
            NK  FK++KI +F+ SK   E+F SKL+FYYKKF   +R++IF  +LE +  +I K++ 
Sbjct: 353 DNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVV 412

Query: 375 QESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIEL 434
           + S+ +  TL+     N+ +  ET+LLK+E+++GL+  +E+LANDPKYY+LGIKDK+  L
Sbjct: 413 EHSDKVLETLN--TSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECL 470

Query: 435 MHYL 438
            +YL
Sbjct: 471 KNYL 474

 Score =  122 bits (305), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 55/129 (42%), Positives = 87/129 (67%), Gaps = 2/129 (1%)

Query: 3   RLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           R+W  F AP+G+KYYYNL+TK++TW  PES +E  GN   +  ++  P +A PL NDW+L
Sbjct: 4   RVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFE--GNAVSQGQKDESPVFAFPLFNDWYL 61

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVYQE 122
           VI  +G K+YF++    +   L D  + +LL +IDK K+ILLV +ARG+  +   +VY+E
Sbjct: 62  VISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEE 121

Query: 123 VIDDLKALR 131
           ++++L  ++
Sbjct: 122 IMENLDFVK 130

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  164 bits (415), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 130/231 (56%), Gaps = 6/231 (2%)

Query: 209 FFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTT-NPQXX 267
           F  L  R++ +PYS+WS+Q+RK+Q DP FY + DD  R  +FE+WC   + +   +    
Sbjct: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149

Query: 268 XXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQ 327
                                  FHYL+HIVSK+ I P T+F D+K +NK  FK + I +
Sbjct: 150 LTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDE 209

Query: 328 FVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEE 387
               K +Q  FVS LLFYYKK +  ER EIF +LL++    +K  +  E + ++  L +E
Sbjct: 210 -THPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDT---KVKHEINNEDQ-LQQILDQE 264

Query: 388 AGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYL 438
              NDAY IE++L+ ME  IG+   + +L  D KYYV+G++DK I +  +L
Sbjct: 265 NLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFL 315

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYED 36
          +W       GE YYY   + E TW+RPE+F E+
Sbjct: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEEE 34

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  146 bits (368), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 120/233 (51%), Gaps = 11/233 (4%)

Query: 206 RNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQ 265
           + + + L +R + DPYS W  ++ KI  D  FY + DD  R+ +FE+WC + I    N  
Sbjct: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNA- 155

Query: 266 XXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKI 325
                                    FHYLAHIVSK+ + P T++ D++ ++K  F + ++
Sbjct: 156 --------VLEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEV 207

Query: 326 KQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLS 385
              +  K +Q  FV+ LLFYYKK     R E+F  LL +H  +I     +    +R  L 
Sbjct: 208 D--ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLE 265

Query: 386 EEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYL 438
            +    D+Y+IET L  +E  IGL   + +L ++ KYYVLG+KDK++ +   L
Sbjct: 266 YDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVL 318

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPE 49
          +W    +  G+ YYYN  T E+TW +P++     G +R      P+
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDERARPQ 47

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  145 bits (367), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/443 (27%), Positives = 215/443 (48%), Gaps = 67/443 (15%)

Query: 2   GRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWF 61
            +LW  +TAP+G KYYYN +T+E+TW +P++  +D    +     E +P  A  L+  W 
Sbjct: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEI---EIKPLVAFELLAGWA 62

Query: 62  LVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGY--NTNVGDRV 119
           L+I   G K Y++ +  + S  +  PE  +L+  ++K++++LL+ I RGY   TN  D V
Sbjct: 63  LIIFSDGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKDLV 122

Query: 120 --YQEVID----DLKA------LRKGSAVXXXXXXXXXXXXXXXXXXXXXXXKRPSGLIA 167
              +E ID    D+ A      ++ GS V                       KR    + 
Sbjct: 123 NEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQAVV 182

Query: 168 GYXXXXXXXXXXXXXXXKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQ 227
                            + N L   D+ +E  +D   I++ +F L  +H+ + YSTW I+
Sbjct: 183 -------------EEPDETNTLEVPDITQELGQD---IKDSYFALFAKHELNKYSTWRIE 226

Query: 228 ARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQXXXXXXXXXXXXXXXXXXXXXX 287
           + K+ +DP FY+I DD++RE++FEEWC  A +  +N +                      
Sbjct: 227 SEKVSQDPEFYKIIDDAVRENIFEEWC-NAGSVESNEESGDPGDDQFEPTK--------- 276

Query: 288 XXPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYK 347
              +HYL+ +V+  ++ P TI  +   ++K   KKY+IK +  +KS+Q  F+SK+L +YK
Sbjct: 277 ---YHYLSQLVANYDLKPDTI-PEDIIKDKKLIKKYRIKDYT-TKSEQRQFLSKMLAWYK 331

Query: 348 KFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLI 407
             +L++RK++F   ++        +++ +++                 +E++LL++EN +
Sbjct: 332 HMSLEDRKQMFQTYIDRIPVGKYTDIDSDAQE---------------DVESQLLELENQL 376

Query: 408 GLARDMEELANDPKYYVLGIKDK 430
           G+        ND +YY + ++ K
Sbjct: 377 GIPTS----ENDLEYYCIDLRSK 395

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  113 bits (283), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 137/259 (52%), Gaps = 26/259 (10%)

Query: 204 QIRNDFFQLLQRHQCDPYSTWSIQARKIQEDP-LFYRITDDSIRESMFEEWCEKAINRT- 261
           +++  FF+LL +++ D YSTWS+Q+R+I E P +FY I++DS RE +FE+WC   ++ T 
Sbjct: 254 KVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTG 313

Query: 262 ---TNPQXXXXXXXXXXXXXXXXXXXXXXX---------XPFHYLAHIVSKA--NITPST 307
              +N +                                  +HYL+ ++ K   +I   +
Sbjct: 314 LYSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERS 373

Query: 308 IFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESH-S 366
           IFQDIK Q K+ FK Y+IK ++  K + E  VS LLFYYKK +  ER + F + +  H  
Sbjct: 374 IFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKHYG 433

Query: 367 RSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARD----MEELANDP-- 420
             IK + E+ ++ +  + S +A +     IE ++L++EN+I  + D    +    + P  
Sbjct: 434 EKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGL 493

Query: 421 KYYVLGIKDK---MIELMH 436
           +YY++G++ K   +  L+H
Sbjct: 494 EYYIIGLRAKHSALATLIH 512

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 84/142 (59%), Gaps = 12/142 (8%)

Query: 3   RLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKR-----PKLTREPEPFYAIPLV 57
           R+W  +  P+G+KYYYN+ TK+STW++P SFY+   N        +   E E  +A  L+
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 58  NDWFLVIDDIGGKYYFDSSTEEASWTL-EDPE----SAELLSTIDKNKIILLVAIARGYN 112
           N+W+L++   G K+Y+++ +  +   L ED E    S +L+  +DKN +I L+ + RGYN
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYN 129

Query: 113 TNVGD--RVYQEVIDDLKALRK 132
               D   +Y+E++ ++  L++
Sbjct: 130 DPSIDIKGLYEEIVANIGFLKQ 151

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  105 bits (261), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 114/238 (47%), Gaps = 36/238 (15%)

Query: 205 IRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNP 264
           +++  F L +    D YSTWS+Q+RKI     ++ + DD+ RE MFE+WC   + +    
Sbjct: 186 VKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPED 245

Query: 265 QXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVS--KANITPSTIFQDIKDQNKADFKK 322
           +                         +HYL+ I+   +  I   T+  DI   ++  FK+
Sbjct: 246 ESEAEDDDYEPTK-------------YHYLSEIMYQLRDEINADTVADDILRGHRPLFKQ 292

Query: 323 YKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRS 382
           Y IKQF+  + +    VS+LLFYYK+FT  ER+ +FHD +      +             
Sbjct: 293 YHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGE---------D 343

Query: 383 TLSEEAGSNDAYAIETKLLKMENLIGLARDMEELAN---DP---KYYVLGIKDKMIEL 434
             +++AGS     +ET++L+ E      RD +   N   DP   +YYV+G+++K I L
Sbjct: 344 VDNDDAGSLSGEQMETRILQWE------RDRQTEGNSSWDPTALEYYVVGLREKYIGL 395

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 77/142 (54%), Gaps = 22/142 (15%)

Query: 2   GRLWTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVND 59
           G+LW  + AP+G KYYYN++TKE+TW +P  E   E G NK  K        +A  L + 
Sbjct: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK--------FAFELFDG 55

Query: 60  WFLVIDDIGGKYYFDSSTEEASWTLEDPESAE----LLSTIDKNKIILLVAIARGYNTNV 115
           W+L+I   GGK ++DS  E++       +  E    ++  +DK KIILL+ + RG+    
Sbjct: 56  WYLLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRD-- 113

Query: 116 GDR-----VYQEVIDDLKALRK 132
            DR     VY ++  D+  L++
Sbjct: 114 -DRYHIKGVYDDIAQDINFLKQ 134

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 111/251 (44%), Gaps = 62/251 (24%)

Query: 191 DDDLPKENHED----ESQIRN---DFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDD 243
           +DD+ KE  ED    E +I N    FF+LL R   D YS W ++A+KI +DP+FY I  D
Sbjct: 50  EDDVLKELLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTD 109

Query: 244 SIRESMFEEWCEKAIN----RTTNPQXXXXXXXXXXXXXXXXXXXXXXXXPFHYLAHIVS 299
             RE +FE+WC   ++     TT PQ                        P+H LA ++ 
Sbjct: 110 VEREKLFEQWCYGKLHSREEETTQPQ-------------------LALALPYHDLAEMIC 150

Query: 300 KANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFH 359
             +I  +TI++DI+  NK   ++   K    SK++QE F +KLL   K          +H
Sbjct: 151 CFDIQSNTIYKDIRKANKKMVRQIDEK---ISKNEQEKFGTKLLGILK----------YH 197

Query: 360 DLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDM-----E 414
           D             +   + +   + EE G  D   + T    + +L+ L R M      
Sbjct: 198 D-------------DASCQGLFEQVLEENGV-DRVDVNTSFETLADLVDLERRMGITTEN 243

Query: 415 ELANDPKYYVL 425
            ++ D +Y+ L
Sbjct: 244 SVSRDARYFCL 254

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 16/80 (20%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W     P G  YYYN  TK+STW++P++F             EP+     P  NDW    
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNF------------AEPDQ----PSANDWKTGK 47

Query: 65 DDIGGKYYFDSSTEEASWTL 84
             G  YY++  T E+ WTL
Sbjct: 48 TKDGKTYYYNVKTRESRWTL 67

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query: 1  MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESF-------YEDGGNKRPKLTREPEPFYA 53
          MG+ W     P G  YY+N  T++S W++P  +          GG    K+ +  +    
Sbjct: 1  MGK-WEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSSG 59

Query: 54 IPLVNDWFLVIDDIGGKYYFDSSTEEASWTLEDPESAEL 92
           P+   W       G  Y+++S+T ++SWTL  P   +L
Sbjct: 60 EPVKGTWKSAKTKDGKVYFYNSATGKSSWTL--PAGVQL 96

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 186 LNNLGDDDLPKENHEDESQIRNDFFQLLQ-RHQCDPYSTWSIQARKIQEDPLF-YRITDD 243
           L++   + L KE H + S+ +  F ++L  R +   Y+ W+   R + E+P++ + +  +
Sbjct: 218 LSSRTKEQLMKE-HSEVSKFQAAFLKMLAGRKEIKSYTRWATARRILSEEPIYKHSVVSE 276

Query: 244 SIRESMFEEWCE 255
           SI+   F E+ E
Sbjct: 277 SIKRQTFLEYVE 288

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 14/81 (17%)

Query: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLV 63
          +W      +G  YYYN  TK+STW++P+    +      +L RE          N W   
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKPKELVSE----EEQLLRE----------NGWRAA 48

Query: 64 IDDIGGKYYFDSSTEEASWTL 84
              G  YY++ +T E SWT+
Sbjct: 49 KTKEGKVYYYNPATRETSWTI 69

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 186 LNNLGDDDLPKENHEDESQIRNDFFQLLQRH-QCDPYSTWSIQARKIQEDPLF-YRITDD 243
           L+N   D L KE H + S+ +  F ++LQ +     Y+ WS   R I ++P++ + + ++
Sbjct: 183 LSNRSADQLLKE-HNETSKFKEAFIKMLQENSHIKYYTRWSTAKRLIADEPIYKHSVVNE 241

Query: 244 SIRESMFEEWC 254
             ++  F+++ 
Sbjct: 242 KTKKQTFQDYI 252

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 14/81 (17%)

Query: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLV 63
          +W      SG  YYYN  TK+STW++P+       ++   L RE          N W   
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKPKELI----SQEELLLRE----------NGWKAA 48

Query: 64 IDDIGGKYYFDSSTEEASWTL 84
              G  YY++ +T E SWT+
Sbjct: 49 KTADGKVYYYNPTTRETSWTI 69

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 14/84 (16%)

Query: 1  MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
          M  +W      +G  YYYN +T ES W++P     +  +K+ +L ++          N W
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKP----VEAPSKQEQLLKK----------NGW 46

Query: 61 FLVIDDIGGKYYFDSSTEEASWTL 84
           +     G  YY+++ T E+SW L
Sbjct: 47 SIGKSKAGKIYYYNTKTGESSWEL 70

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 14/80 (17%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W      +G  YYYN  TK+S W++PE       +++ +L +E          N W    
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEELV----SQQEQLLQE----------NGWKAAK 49

Query: 65 DDIGGKYYFDSSTEEASWTL 84
             G  YY++ ST + SWT+
Sbjct: 50 TAEGKIYYYNPSTRQTSWTI 69

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 186 LNNLGDDDLPKENHEDESQIRNDFFQLLQRH-QCDPYSTWSIQARKIQEDPLF-YRITDD 243
           L+N   D L KE H + S+ ++ F ++LQ +     Y+ WS   R I ++P++ + + ++
Sbjct: 186 LSNRSADQLLKE-HNETSKFKDAFLKMLQNNSHIKYYTRWSTAKRLIADEPIYKHSVVNE 244

Query: 244 SIRESMFEEWCEKAIN 259
             +   F+E+ +   N
Sbjct: 245 KTKRQTFQEYIDTLTN 260

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
           (REAL)
          Length = 583

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
           W      +G  YYYN  TK+STW++P        +K+ +L +E          N W    
Sbjct: 4   WKEAKDANGRVYYYNTLTKKSTWEKPTQLV----SKQEQLLQE----------NGWRAAK 49

Query: 65  DDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKI-ILLVAIARGYNTNVGDRVYQEV 123
              G  YY++++T + SW +  P   +    I K +  ++L A A  Y T   D   +E+
Sbjct: 50  TAEGKVYYYNTTTRKTSWAI--PIFEKKTEDIAKKEPDVILSAQASKYRTVSTDEEKKEL 107

Query: 124 IDDLK 128
             ++K
Sbjct: 108 RQNIK 112

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 186 LNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYST-WSIQARKIQEDPLF-YRITDD 243
           L+N   D L KE H + S+ ++ F ++L+ +    Y T WS   R I ++P++ + + ++
Sbjct: 186 LSNRSADQLLKE-HNETSKFKDAFLEMLRNNSNIKYYTRWSTAKRLIADEPIYKHSVVNE 244

Query: 244 SIRESMFEEWCEKAIN 259
             ++  F+ + +   N
Sbjct: 245 KTKKQTFQNYIDTLAN 260

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 8/82 (9%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W +    +G  YYYN+ TKES W RP S      N         +  +   + N+     
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDSDKMLLEQIGWKSNVTNE----- 65

Query: 65 DDIGGKYYFDSSTEEASWTLED 86
             G  YY++  T E+ W + D
Sbjct: 66 ---GKVYYYNLKTGESRWDVND 84

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 11/91 (12%)

Query: 1  MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNK-----RPKLTREPEPFYAIP 55
          M   W     P G  YYYNL+TKES W  P+S    G NK     +    ++ E    I 
Sbjct: 1  MENDWKQAKDPKGRVYYYNLKTKESRWDLPKS--STGTNKSISTEKQVSVKKNELKNKID 58

Query: 56 L----VNDWFLVIDDIGGKYYFDSSTEEASW 82
          L    ++ W       G  YY++  T+E+ W
Sbjct: 59 LEFLKLHGWRTAQTKEGRIYYYNVDTKESRW 89

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRP 30
          W T     G  YYYN+ TKES W  P
Sbjct: 67 WRTAQTKEGRIYYYNVDTKESRWDPP 92

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
          M   W   T  +G+ YYYN  TKES W +P    ED  + + KL R+            W
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKP---VEDTTDLKQKL-RDA----------GW 46

Query: 61 FLVIDDIGGKYYFDSSTEEASW 82
           +     G  YY++  T+E+ W
Sbjct: 47 NVAKTKEGKVYYYNVKTKESRW 68

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRP 30
          W       G+ YYYN++TKES W  P
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNP 71

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 17/81 (20%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFY-AIPLVNDWFLV 63
          W     P G  YYYN +  E+TW +P               +E E    AI L   W + 
Sbjct: 4  WKETIDPEGRVYYYNSKG-ETTWHKP---------------KEMEVVLDAILLKQGWKVA 47

Query: 64 IDDIGGKYYFDSSTEEASWTL 84
            + G  YY++ +T E++W L
Sbjct: 48 STEDGKVYYYNKNTNESTWEL 68

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRP---ESFYEDGGNK 40
          W   +   G+ YYYN  T ESTW+ P   E   ++GG K
Sbjct: 44 WKVASTEDGKVYYYNKNTNESTWELPVVREEKKDEGGEK 82

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 15/80 (18%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W     P G  YYYN  T ++TW++PE  + +              F    L   W   +
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKPEELFTE--------------FERKLLKYGWKTAL 47

Query: 65 DDIGGKYYFDSSTEEASWTL 84
           + G  YY+ S T E +W +
Sbjct: 48 AEDGRVYYYKSDTGETTWNV 67

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 15/86 (17%)

Query: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLV 63
          LW      SG  YYYN +T ES W++P            +L  E E   A    + W   
Sbjct: 6  LWKEAKDTSGRIYYYNAKTGESKWEKPR-----------ELLSEQELILA---KHGWKSS 51

Query: 64 IDDIGGKYYFDSSTEEASWTLED-PE 88
              G  YY+++ T+ + W L D PE
Sbjct: 52 KTSDGKLYYYNAQTKTSRWELPDLPE 77

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 17/92 (18%)

Query: 1  MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60
          MG  W     P G  YYYN  + E+TW +P   Y +                 + L    
Sbjct: 1  MGN-WNEAHDPEGRVYYYNSESGETTWDKPRELYSE---------------LELQLEKHG 44

Query: 61 FLVIDDIGGK-YYFDSSTEEASWTLEDPESAE 91
          +   +  GGK YY++ S+ E+ W +   ES E
Sbjct: 45 WKTGETEGGKLYYYNESSGESRWEVPTFESDE 76

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 38/96 (39%), Gaps = 13/96 (13%)

Query: 2   GRLWTTFTAPSGEKYYYNLRTKESTWKRPESFY----EDGGNKRPKLTREPEPFYAIPLV 57
           G  W +     G  YYYNL TKES W++P+             R            I + 
Sbjct: 11  GNQWRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIE 70

Query: 58  NDWFLVIDDIGGK---------YYFDSSTEEASWTL 84
            D   ++++IG K         YY++  T E+ W +
Sbjct: 71  KDDASIMENIGWKSNVTADGKTYYYNLKTGESRWDI 106

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {ON}
           Anc_2.649 YKL012W
          Length = 583

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 42/103 (40%), Gaps = 30/103 (29%)

Query: 4   LWTTFTAPSGEKYYYNLRTKESTWKRP------ESFYEDGGNKRPKLTREPEPFYAIPLV 57
           LW T    +G+ YYYN +T  S W++P      E+  + G                    
Sbjct: 6   LWRTAKDSNGKVYYYNTKTGVSQWEKPGVSADIETLKQHG-------------------- 45

Query: 58  NDWFLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNK 100
             W +     G  YY++SST E+ W  E P+  +  + + + K
Sbjct: 46  --WGVARTKDGKLYYYNSSTGESRW--EAPKFEDATTEVSRGK 84

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANNTIQQQPVSQLG-PLPSGWEM 427

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 428 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 459

>CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa]
           {ON} highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125w Ubiquitin--protein ligase
          Length = 822

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 408

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 409 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 440

>NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134
          Length = 836

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 364 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 422

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 423 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 454

>TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.134
           YER125W
          Length = 844

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 372 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 430

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 431 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 462

>KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.134
           YER125W
          Length = 800

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 328 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 386

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 387 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 418

>Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON}
           (93761..96208) [2448 nt, 816 aa]
          Length = 815

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 343 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 401

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 402 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 433

>Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON}
           YER125W (REAL)
          Length = 809

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 395

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 396 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 427

>TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.134
           YER125W
          Length = 822

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 408

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 409 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 440

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLG-PLPSGWEM 377

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 378 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 409

>Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W
           (REAL)
          Length = 808

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 336 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 394

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 395 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 426

>Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W
           (REAL)
          Length = 809

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 395

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 396 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 427

>ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 405

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 406 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 437

>NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134
          Length = 835

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 363 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 421

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 422 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 453

>YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3
           ubiquitin ligase of the NEDD4 family; involved in
           regulating many cellular processes including MVB
           sorting, heat shock response, transcription,
           endocytosis, and ribosome stability; human homolog is
           involved in Liddle syndrome; mutant tolerates
           aneuploidy; ubiquitylates Sec23p
          Length = 809

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 395

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 396 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 427

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPASTTIQQQPVSQLG-PLPSGWEM 375

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 376 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 407

>KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {ON}
           Anc_8.134 YER125W
          Length = 811

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 339 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 397

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 398 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 429

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLG-PLPSGWEM 373

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 374 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 405

>SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 790

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 318 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLG-PLPSGWEM 376

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 377 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 408

>KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSTNTIQQQPVSQLG-PLPSGWEM 405

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 406 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 437

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 33/82 (40%), Gaps = 18/82 (21%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W       G  YYYN  T E+TW +P+  Y +   +               L + W   +
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQELYSELERRL--------------LAHGW--KV 49

Query: 65 DDIGGK--YYFDSSTEEASWTL 84
              GK  YY++ ++ E+ W L
Sbjct: 50 GSTAGKQTYYYNEASGESRWEL 71

>ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER125W
           (RSP5)
          Length = 817

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 5   WTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62
           W     P G  Y+ +  T+ +TW  P  + +    G     + ++P      PL + W +
Sbjct: 345 WEQRYTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSNNTIQQQPVSQLG-PLPSGWEM 403

Query: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKN 99
            + +    Y+ D +T+  +W  +DP    L S++D+N
Sbjct: 404 RLTNTARVYFVDHNTKTTTW--DDP---RLPSSLDQN 435

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPE 31
          W   T   G  YYYN  T ES W++PE
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPE 70

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 14/78 (17%)

Query: 5  WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64
          W       G  YYYN +  ES W++P+  +          T E      + L + W    
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQELF----------TEEE----LVLLKHGWKSSR 52

Query: 65 DDIGGKYYFDSSTEEASW 82
             G  YY++S T+E+ W
Sbjct: 53 TAEGKIYYYNSITKESRW 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,885,592
Number of extensions: 1824831
Number of successful extensions: 7401
Number of sequences better than 10.0: 98
Number of HSP's gapped: 7571
Number of HSP's successfully gapped: 132
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)