Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056403.496ON1241245594e-75
NCAS0F035703.496ON2301042646e-29
Suva_16.4793.496ON2121382453e-26
KLTH0F14938g3.496ON2291442412e-25
SAKL0F02618g3.496ON2531442412e-25
YPR151C (SUE1)3.496ON2061372304e-24
Kwal_55.212483.496ON2221412314e-24
TPHA0D033003.496ON1961412295e-24
Smik_16.4033.496ON2031382296e-24
Kpol_1017.43.496ON1841522277e-24
Skud_16.4453.496ON2151372288e-24
KNAG0A079603.496ON1771382242e-23
NDAI0B058903.496ON2781432181e-21
KLLA0E03983g3.496ON1911422094e-21
CAGL0L08426g3.496ON1401291977e-20
ZYRO0D09812g3.496ON185501963e-19
TBLA0D029403.496ON71471683e-16
Ecym_12333.496ON87601554e-14
KLLA0D06061g8.682ON249891574e-13
ZYRO0F07480g8.682ON236931574e-13
KAFR0G037103.496ON79431484e-13
SAKL0H06380g8.682ON219911451e-11
NDAI0K013208.682ON2581081462e-11
Kpol_1072.128.682ON222911452e-11
CAGL0M02101g8.682ON267981435e-11
TPHA0D012908.682ON218951408e-11
Suva_16.1518.682ON253951391e-10
KNAG0J017608.682ON2581021382e-10
YPL159C (PET20)8.682ON253921382e-10
Smik_6.3568.682ON253921382e-10
Skud_16.1238.682ON255921364e-10
KLTH0D11396g8.682ON225941345e-10
TDEL0A062708.682ON242911339e-10
TPHA0G015708.682ON255981312e-09
Kwal_26.88288.682ON223941293e-09
NCAS0C013108.682ON2571171286e-09
TBLA0B038008.682ON324981251e-08
Kpol_1013.98.682ON261951242e-08
AFR315C3.496ON77431162e-08
Ecym_23908.682ON227891119e-07
KAFR0H023808.682ON220921065e-06
Kpol_1066.443.62ON47927760.074
KLLA0A07447g3.62ON486123750.088
TDEL0E007103.62ON47628720.22
Skud_2.577.484ON45773710.29
YNL295W3.62ON52439700.43
TPHA0G015608.683ON109659690.58
NCAS0A099403.62ON49427671.0
ZYRO0C02244g3.62ON46028671.1
KNAG0K023503.62ON49190642.3
Skud_14.423.62ON52439633.7
Suva_14.443.62ON52540616.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05640
         (124 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...   219   4e-75
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...   106   6e-29
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    99   3e-26
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    97   2e-25
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    97   2e-25
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    93   4e-24
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    94   4e-24
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    93   5e-24
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    93   6e-24
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    92   7e-24
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    92   8e-24
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    91   2e-23
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    89   1e-21
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    85   4e-21
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    80   7e-20
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    80   3e-19
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   3e-16
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    64   4e-14
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    65   4e-13
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    65   4e-13
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    62   4e-13
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    60   1e-11
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    61   2e-11
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    60   2e-11
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    60   5e-11
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    59   8e-11
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    58   1e-10
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    58   2e-10
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    58   2e-10
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    58   2e-10
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    57   4e-10
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    56   5e-10
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    56   9e-10
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    55   2e-09
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    54   3e-09
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    54   6e-09
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    53   1e-08
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    52   2e-08
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    49   2e-08
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    47   9e-07
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    45   5e-06
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    34   0.074
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    33   0.088
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    32   0.22 
Skud_2.57 Chr2 complement(117906..119279) [1374 bp, 457 aa] {ON}...    32   0.29 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    32   0.43 
TPHA0G01560 Chr7 (316294..319584) [3291 bp, 1096 aa] {ON} Anc_8....    31   0.58 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    30   1.0  
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    30   1.1  
KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {...    29   2.3  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    29   3.7  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    28   6.7  

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score =  219 bits (559), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 110/124 (88%), Positives = 110/124 (88%)

Query: 1   MNIKTXXXXXXXXXXXXXXVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV 60
           MNIKT              VWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV
Sbjct: 1   MNIKTRSSSLMRRFSTSSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV 60

Query: 61  MYPVRENPLFGRGTKTEAPASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120
           MYPVRENPLFGRGTKTEAPASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFD
Sbjct: 61  MYPVRENPLFGRGTKTEAPASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120

Query: 121 RHHR 124
           RHHR
Sbjct: 121 RHHR 124

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score =  106 bits (264), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 10/104 (9%)

Query: 27  TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESNL 86
           ++++FR LP+VP TR+LET++LS +ILF+GY+P+MYPVRENPLF    K E       N 
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNE 173

Query: 87  PRY----------DLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120
            R            +WST+ +GL+ +PEW+NVP   ++ L+PFD
Sbjct: 174 KRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFD 217

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 99.0 bits (245), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 48/138 (34%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTK--------------T 76
           FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF    K              T
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 77  EAPASLESN---------------------------------LPRYDLWSTTTMGLERFP 103
           EA A+ +S                                  LP Y+ WST++MG+E FP
Sbjct: 122 EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLP-YNWWSTSSMGMEYFP 180

Query: 104 EWSNVPREVVRKLRPFDR 121
           EW NVP  ++RKL+PFDR
Sbjct: 181 EWKNVPSYMMRKLKPFDR 198

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 76/144 (52%), Gaps = 43/144 (29%)

Query: 24  KSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR-GTKTE----- 77
           K  + ++FR+LP+VPTT++LE   L+ DIL+SGYRPV+YPV+ENPLF   G KT+     
Sbjct: 16  KRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGE 75

Query: 78  --------APASLESNL----------------------PR-------YDLWSTTTMGLE 100
                    P S E N                       PR       Y+LWS T+M +E
Sbjct: 76  RGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWSCTSMAME 135

Query: 101 RFPEWSNVPREVVRKLRPFDRHHR 124
             PEW  VPR VV KLRPF+  HR
Sbjct: 136 YHPEWLAVPRTVVNKLRPFESPHR 159

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score = 97.4 bits (241), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 71/144 (49%), Gaps = 47/144 (32%)

Query: 24  KSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPAS-- 81
           K    D+FR LP+VPTT+FLE + L+ DILFSGYRPV YPV+ENP F  GT+ +  A   
Sbjct: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGET 75

Query: 82  ---------------------------------------------LESNLPRYDLWSTTT 96
                                                        + + L  Y+LWS++T
Sbjct: 76  SAKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSST 135

Query: 97  MGLERFPEWSNVPREVVRKLRPFD 120
           M +E +PEW NVP+ +  KL+PFD
Sbjct: 136 MAMEYYPEWLNVPKTIANKLKPFD 159

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score = 93.2 bits (230), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 73/137 (53%), Gaps = 46/137 (33%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------------GRGTKTEA 78
           FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF                KT A
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 79  PA----------------------------------SLESNLPRYDLWSTTTMGLERFPE 104
            A                                  ++ + L  ++ WST++MG+E FPE
Sbjct: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174

Query: 105 WSNVPREVVRKLRPFDR 121
           W NVP  ++RKL+PFD+
Sbjct: 175 WKNVPPYMMRKLKPFDK 191

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 93.6 bits (231), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 74/141 (52%), Gaps = 43/141 (30%)

Query: 27  TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR------------GT 74
           + D+FR+LP+VPTT++LE   L+ DIL+SGYRPV+YPV+ENPLF              G+
Sbjct: 19  SSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGS 78

Query: 75  KTEAPASLESNL------------------------PR-------YDLWSTTTMGLERFP 103
            T   A+ ES+                         PR       + LWS+T+M +E  P
Sbjct: 79  DTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMAMEYHP 138

Query: 104 EWSNVPREVVRKLRPFDRHHR 124
           EW  VPR VV KLRPF+   R
Sbjct: 139 EWLAVPRTVVNKLRPFNSPER 159

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score = 92.8 bits (229), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 72/141 (51%), Gaps = 49/141 (34%)

Query: 28  DDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF----------------- 70
           + +F+ LPRVPTTR+LE+ +L++DILFSGYRP+ YPV+ENPLF                 
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 71  -------------------------------GRGTKTEAPASLESNLPRYDLWSTTTMGL 99
                                            GT    P   E+ LP Y+ WST+ MG+
Sbjct: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLP-YNWWSTSIMGM 166

Query: 100 ERFPEWSNVPREVVRKLRPFD 120
           E +PEW+NVPR  ++ L+PF+
Sbjct: 167 EYYPEWNNVPRRFLKTLKPFE 187

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score = 92.8 bits (229), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (52%), Gaps = 48/138 (34%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTK--------------T 76
           FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF    K              T
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112

Query: 77  EAPASLESN---------------------------------LPRYDLWSTTTMGLERFP 103
           EA  + +S                                  LP ++ WST++MG+E FP
Sbjct: 113 EAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLP-FNWWSTSSMGMEYFP 171

Query: 104 EWSNVPREVVRKLRPFDR 121
           EW N+P  + RKL+PFD+
Sbjct: 172 EWRNIPSYMTRKLKPFDK 189

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 92.0 bits (227), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 73/152 (48%), Gaps = 54/152 (35%)

Query: 22  RRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF----------- 70
           +  S T+ +FR+LPRVPTT+FLE+  L++DILFSGYRP+ YPV+ENPLF           
Sbjct: 27  KMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFG 86

Query: 71  ---------------------------------GRGTKTEAPASLE----------SNLP 87
                                             RGT       +           S L 
Sbjct: 87  QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLL 146

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
            Y  WST+ MG+E +PEW N+PR+VV+ L+P+
Sbjct: 147 PYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 92.4 bits (228), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 72/137 (52%), Gaps = 46/137 (33%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF-------------------- 70
           FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF                    
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 71  ----------------GRGTKTEAPASLE----------SNLPRYDLWSTTTMGLERFPE 104
                            RGT   +   +           + L  ++ WST++MG+E FPE
Sbjct: 122 EAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 181

Query: 105 WSNVPREVVRKLRPFDR 121
           W NVP  ++RKL+PFD+
Sbjct: 182 WKNVPSYMMRKLKPFDK 198

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score = 90.9 bits (224), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 70/138 (50%), Gaps = 47/138 (34%)

Query: 29  DLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------------------ 70
            +FR LP+VP T++LET+ L+ DIL+SGYRPVMYPVRENPLF                  
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89

Query: 71  ----------------------------GRGTKTEAPASLESNLPRYDLWSTTTMGLERF 102
                                         GT   AP   +  LP ++ WS +++ +E +
Sbjct: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLP-FNWWSASSLAMEVY 148

Query: 103 PEWSNVPREVVRKLRPFD 120
           PEWS+VP+ VV+ L+PFD
Sbjct: 149 PEWSSVPKHVVKGLKPFD 166

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 71/143 (49%), Gaps = 48/143 (33%)

Query: 26  VTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFG-------------- 71
           + +++FRT+P+VP T++LET+ LS D+L+SGYRP+MYPV+ENPLF               
Sbjct: 124 LQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFS 183

Query: 72  ---------------------------------RGTKTEAPASLESNLPRYDLWSTTTMG 98
                                             GT   +P    + LP   +WS + MG
Sbjct: 184 TTSSSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPN-KIWSMSIMG 242

Query: 99  LERFPEWSNVPREVVRKLRPFDR 121
           +E +PEW  VP  +V+ L+PFD+
Sbjct: 243 MEYYPEWKGVPFNIVKNLKPFDK 265

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score = 85.1 bits (209), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 46/142 (32%)

Query: 24  KSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------------- 70
           KS    ++R LPRVPTTRFL  Q L++DILFSGYRP++ P+R+NPLF             
Sbjct: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64

Query: 71  --GRGTKTEAPASLESNLP--------------------RYD-----------LWSTTTM 97
             G   K++A  + E   P                    RY+           LWS++ M
Sbjct: 65  NGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAM 124

Query: 98  GLERFPEWSNVPREVVRKLRPF 119
           G+E +PEW++VP +V   L+P+
Sbjct: 125 GMEFYPEWNDVPNKVSASLKPY 146

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 80.5 bits (197), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 35/129 (27%)

Query: 27  TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF---------------- 70
            +++FR LP+VP TR+LE + LS D+L++GYRP++YP+RENPL                 
Sbjct: 4   VNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSN 63

Query: 71  ------------------GRGTKTEAPASLESNLPRYDL-WSTTTMGLERFPEWSNVPRE 111
                             GRG  +       ++  +  L  S + MG+E +PEW  VPR+
Sbjct: 64  ELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRD 123

Query: 112 VVRKLRPFD 120
           VV++++P++
Sbjct: 124 VVKRIKPYE 132

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 185

 Score = 80.1 bits (196), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%)

Query: 21 WRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF 70
          ++RK  + D+FR++PRVPTT+FLE++ L+ DILFSGYRPVMYPV+ENPLF
Sbjct: 15 FKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLF 64

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/44 (63%), Positives = 32/44 (72%)

Query: 80  ASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFDRHH 123
           A + S L  Y  WSTT+MG+E FPEW  VPR VVRKL+PFDR H
Sbjct: 126 AKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFDRGH 169

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 69.3 bits (168), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/47 (65%), Positives = 36/47 (76%)

Query: 27 TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRG 73
          +  + R LPRVPTT +LE  RL +DI FSGYRPVMYPV+ENPLF  G
Sbjct: 12 SKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNG 58

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 64.3 bits (155), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 1/60 (1%)

Query: 29 DLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESNLPR 88
          ++ R LPRVPTT++L  + L +DI FSGYRP++YPV++NPLF R +K    +S+   L R
Sbjct: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF-RSSKNILESSIGKGLGR 66

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 10/89 (11%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYP---VRENPLFGRGTKTEAPASLESNLPRYD 90
           LPRVPTT  +  +  +SD+L+SGYRP++      +EN L     K E    L   +P   
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLE---KLSEPVP--- 165

Query: 91  LWSTTTMGLERFPEWSNVPREVVRKLRPF 119
            W ++  G E F EW NVP E+++ L+PF
Sbjct: 166 -WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLES------NLP 87
           LPRVP+T +L  + +SS IL+SGYRP+     E      G      A L         L 
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFLNPDELKTSQDGGNANNGARLYEFAMKLEELG 147

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120
              LW+++  G E +PEW  VP EV RKL+PF+
Sbjct: 148 EQSLWTSSATGQEIYPEWDYVPMEVQRKLKPFN 180

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 61.6 bits (148), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%)

Query: 30 LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR 72
          L + LPRVPTT++L+  +L  DIL++GYRPV+YP++ENPL  R
Sbjct: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYR 49

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 12/91 (13%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPV-MYPVR----ENPLFGRGTKTEAPASLESNLPR 88
           LP+ P+T  L+ + +S+D+ +SGYRP+ + P      E+ L+    K EA   L   +P 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIFLNPASPKESESTLYEFAMKLEA---LGDPIP- 138

Query: 89  YDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
              W ++  G E + EW NVP EV++KL+PF
Sbjct: 139 ---WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query: 22  RRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPAS 81
           +RK V +  F  LP++     L  Q +S  +L+SGYRP+  P   N  F +G K      
Sbjct: 84  QRKKVLN--FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNGSTL 138

Query: 82  LESNLP--------RYDLWSTTTMGLERFPEWSNVPREVVRKLRPFDR 121
            E  +            +W T+  G+E F EW NVP  V+R L+PF +
Sbjct: 139 YEFAMKLDEFKKDKNSTIWDTSATGVETFTEWDNVPESVIRNLKPFQK 186

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 5/91 (5%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPV-MYPVR-ENPLFGRGTKTEAPASLESNLP---R 88
           LP+VP+ + L  Q +++DI +SG+RP+ + P   EN      T  E   +L+S +P    
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTELENKDEDSSTWYEVSLTLDSPVPPSGH 156

Query: 89  YDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
             +W+++  G+ER+ EW +VP EV+  L PF
Sbjct: 157 NSIWTSSATGMERYREWHSVPEEVINSLTPF 187

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 4/98 (4%)

Query: 23  RKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVR-ENPLFGRGTKTEAPAS 81
           +K V D  + TLPRV      + + +S+++L+SGYRP+ + V  +N   G+ T  E    
Sbjct: 107 KKKVYD--YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGK-TLYEFAMK 163

Query: 82  LESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
           LE        W ++  G E + EW NVP +V++ L+PF
Sbjct: 164 LEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPF 201

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 58.5 bits (140), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 8/95 (8%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFG--RGTKTEAPASL-ESNLPRYD 90
           LP+VP T  +  + ++++ L+SGYRP+    ++  L G    T  +A +S+ E  +   +
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVNSTAQDANSSIYEFAMKLNE 154

Query: 91  L-----WSTTTMGLERFPEWSNVPREVVRKLRPFD 120
           L     W  +  GLE + EW  VP +V++KL+P+D
Sbjct: 155 LSEPSPWMMSATGLESYSEWDYVPSKVIKKLKPYD 189

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%), Gaps = 10/95 (10%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESNLPRYD 90
           F  LPRVP+T  L+   +++++L+SGYRP+      NP   +  +       E  +   D
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI----NPNDPKLKEDTGSTLYEFAMKLDD 155

Query: 91  L------WSTTTMGLERFPEWSNVPREVVRKLRPF 119
           L      W ++  GLE F EW N+P E+++ L+PF
Sbjct: 156 LNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 13/102 (12%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPV----------MYPVRENPLFGRGTKTEAPA 80
           +  LP VP+T+ +E   + +++L+SGYRP+          +   +E   F +        
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRPLFLDSTALERGLLAAKEQASFTQSASPTGST 152

Query: 81  SLESNLPRYD---LWSTTTMGLERFPEWSNVPREVVRKLRPF 119
             E  +   D   +W+ +  GLE++ EW N+P  V   L+PF
Sbjct: 153 FYEIAMKLEDPACIWANSATGLEKYTEWDNIPYSVANSLKPF 194

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT---EAPASLESNLP 87
           F  LPRVP+T  L+   +++++L+SGYRP ++    +P     T +   E    LE    
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYRP-LFINPNDPKLKEDTGSTLYEFAMKLEDLNE 158

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
               W ++  GLE F EW N+P E+++ L+PF
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT---EAPASLESNLP 87
           F  LP+VP+T  L+   +++++L+SGYRP ++    +P     T +   E    LE    
Sbjct: 100 FSWLPKVPSTSHLKQSDMTTNVLYSGYRP-LFINPNDPKLKEDTGSTLYEFAMKLEDLNE 158

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
               W ++  GLE F EW N+P E++R L+PF
Sbjct: 159 PLSPWISSATGLEFFSEWDNIPSELLRNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT---EAPASLESNLP 87
           F  LPRVP+T  L+   +++++L+SGYRP ++    +P     T +   E    LE    
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRP-LFINPNDPKLKEDTGSTLYEFAMKLEDLNE 158

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
               W ++  GLE F EW N+P E+++ L+PF
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 12/94 (12%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENP-----LFGRGTKTEAPASLESN 85
           F  LP+ P+T  L+ + +S+ +L+SGYRP +    E       L+    K EA   L   
Sbjct: 82  FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSEQKQTDSTLYEFAMKLEA---LGDP 138

Query: 86  LPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
           LP    W ++  G E + EW N+P +V++KLRPF
Sbjct: 139 LP----WISSATGTEFYGEWDNIPADVIKKLRPF 168

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 55.8 bits (133), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT-----EAPASLESNLPR 88
           LPRVP+T  L+ + +S  +L+SGYRP+     E      G+ T     E    LE  L  
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPLFINPDEIKTSSEGSGTGGTLYEFAMKLEE-LGD 154

Query: 89  YDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
              W T+  GLE + EW ++P E+ +KL+PF
Sbjct: 155 QSPWVTSATGLEYYREWDSIPGELQKKLKPF 185

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPV------RENPLFGRGTKTEAPASLE- 83
           + +LP+ PTT  L +   ++D+ +SGYRP+   V      +ENP     T  E   S++ 
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENPC----TCYEISLSMDI 158

Query: 84  --SNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
              NL     W  +  G E + EW N+P+ V+  L+ F
Sbjct: 159 VKKNLKVSTPWLFSATGSELYKEWDNIPKSVLDNLKCF 196

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 12/94 (12%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRP-VMYPVRE----NPLFGRGTKTEAPASLESN 85
           F  LP+ P+T  L+ + +S+ +L+SGYRP V+ P  +    + L+    K E   SL   
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQKQTDSTLYEFAMKLE---SLGDP 138

Query: 86  LPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
           LP    W ++  G E + EW  VP +V+++LRPF
Sbjct: 139 LP----WISSATGTEFYGEWDGVPADVIKQLRPF 168

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 19/117 (16%)

Query: 20  VWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRE------NPLFGRG 73
           + R+K   D  + TLP+V     L    +S+DIL+SGYRP+    ++         FG  
Sbjct: 78  IQRKKKRFD--YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKDLENSSRKAEFGNS 135

Query: 74  TKT---EAPASLESNLPRY-------DLW-STTTMGLERFPEWSNVPREVVRKLRPF 119
             +   E    L+   P         + W ST+  G+E F EW NVP  +++ L+PF
Sbjct: 136 NNSTLYEIAMKLDDLSPEAISGSTSSNFWHSTSATGMEVFDEWDNVPNSILKNLKPF 192

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 14/98 (14%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPV------------MYPVRENPLFGRGTKTEAPAS 81
           LP+VPT + L+ + + +++L+SGYRP+            +Y    +P  G  T  E    
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSIDFKALNDPTNIYDPYSSP-NGSSTLYEFAMQ 225

Query: 82  LESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
           L+S L     W ++  GLE + EW ++P EV++KL+P 
Sbjct: 226 LQS-LSEIFPWMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 13/95 (13%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVR---ENPLFG------RGTKTEAPASLES 84
           LP+VP+T  L  + + +  L+SGYRP+    +   +N L G        T  E    LE+
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSKGSGKNKLSGTMKNGVNSTFYEIAMKLEN 171

Query: 85  NLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
             P    W ++  G+E + EW +VP +V++ L+PF
Sbjct: 172 PSP----WMSSATGMELYSEWDHVPLDVLKDLKPF 202

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 49.3 bits (116), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (69%)

Query: 30 LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR 72
           FR LPRVP+T+ L   ++  DILFS +RP+ YPV +NPL  R
Sbjct: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRR 48

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESN---LPRYD 90
            P  P T  L+   ++ D+L+SGYRP+    R +P   +    E    LE+    LP   
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPLSLR-RADPKEAQSKIYELAMRLEAVEDPLP--- 144

Query: 91  LWSTTTMGLERFPEWSNVPREVVRKLRPF 119
            W     G   + EW NVP+ V+R LRP+
Sbjct: 145 -WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 31  FRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTE---APASLESNLP 87
           +  LPRVP+T  ++ ++L++++LFS YRP+   ++ +      T  E   AP    ++ P
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSDS----STMYEFLMAPDQSTTSSP 143

Query: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119
               W      L     W NVP   VRKL+PF
Sbjct: 144 ----WGRPFSRLHDHRAWRNVPSHTVRKLKPF 171

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 33.9 bits (76), Expect = 0.074,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPV 60
           LPRVP+T  +  + + +D LF+GYRP+
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPL 100

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 33.5 bits (75), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 37/123 (30%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMY---PVREN-------PLFGRGTKTE-APASL 82
           +P+VP+T +L  + L ++ LF+GY+P+     P+  N        LF    K + A  + 
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNAQINS 149

Query: 83  ESNLPRYDL-------------------------WSTTTMGLERFPE-WSNVPREVVRKL 116
           E+N    D+                         W  +  GL    E +  VPR VV KL
Sbjct: 150 ENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIPWDASISGLVYNDEPFKGVPRSVVSKL 209

Query: 117 RPF 119
           +PF
Sbjct: 210 KPF 212

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVM 61
           LPRVP+T ++    + ++ LF+GYRP+ 
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF 102

>Skud_2.57 Chr2 complement(117906..119279) [1374 bp, 457 aa] {ON}
          YBL045C (REAL)
          Length = 457

 Score = 32.0 bits (71), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 24 KSVTDDLFRTLPRVPTTRFLETQRLSSDILFSG-YRPVMYPVRENPLFGRGTKTEAPASL 82
          K+V+ +  RTL   P TR  E  +LS+ I+ +  + P  +      +FG G   E P   
Sbjct: 8  KTVSKEFRRTLATAPATRKAEVTQLSNGIVVATEHNPSAHSASVGVVFGSGAANENP--- 64

Query: 83 ESNLPRYDLWSTT 95
            N    +LW  T
Sbjct: 65 -YNNGVSNLWKNT 76

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 31.6 bits (70), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 22  RRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV 60
           R K    +L   +PRV +T ++  + + ++ LF+GYRP+
Sbjct: 99  RSKISGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPL 137

>TPHA0G01560 Chr7 (316294..319584) [3291 bp, 1096 aa] {ON} Anc_8.683
           YPL160W
          Length = 1096

 Score = 31.2 bits (69), Expect = 0.58,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 58  RPVMYPVRENPLFGRGTKTEAPASLESNLPRYDLWSTTTMGLERFPEWSNVPREVVRKL 116
           R +   +RE    G   K   PA L+S+ P       T +  E FPEW N   EVVR+L
Sbjct: 922 RDLQRSIREAEGQGMKKKKGKPADLDSSKPA----RLTLLISENFPEWQNAVIEVVREL 976

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 21/27 (77%)

Query: 34 LPRVPTTRFLETQRLSSDILFSGYRPV 60
          +P+VPTT ++ +  + ++ LF+GY+P+
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPL 96

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 33 TLPRVPTTRFLETQRLSSDILFSGYRPV 60
           +PRVP T ++    + ++ LF+GYRP+
Sbjct: 57 VVPRVPPTDYISAPEIQTEGLFAGYRPL 84

>KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {ON}
           Anc_3.62 YNL295W
          Length = 491

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 4/90 (4%)

Query: 34  LPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFG---RGTKTEAPASLESNLPRYD 90
           +PRV  T  +    + ++ LF+GYRP+       P       G       S ES      
Sbjct: 120 VPRVQPTDHIGADTIHTEGLFAGYRPLFLGNSSLPSGSGDFNGYTEHRMDSFESEGKPVI 179

Query: 91  LWSTTTMG-LERFPEWSNVPREVVRKLRPF 119
            W  +  G L +   +  + +++V +LRPF
Sbjct: 180 PWDASISGLLYKDNAFGKLSKDIVHRLRPF 209

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 22  RRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV 60
           R K    +L   +P+V +T ++  + + ++ LF+GYRP+
Sbjct: 99  RPKMFGSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPL 137

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 28.1 bits (61), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 27/40 (67%), Gaps = 1/40 (2%)

Query: 22  RRKSVT-DDLFRTLPRVPTTRFLETQRLSSDILFSGYRPV 60
           R+K+ T  +L   +P+V +T  +  + ++++ LF+GYRP+
Sbjct: 99  RQKTTTGSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPL 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,842,421
Number of extensions: 446133
Number of successful extensions: 988
Number of sequences better than 10.0: 55
Number of HSP's gapped: 966
Number of HSP's successfully gapped: 68
Length of query: 124
Length of database: 53,481,399
Length adjustment: 93
Effective length of query: 31
Effective length of database: 42,817,461
Effective search space: 1327341291
Effective search space used: 1327341291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)