Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056303.495ON1501507381e-101
Kpol_480.133.495ON1571494259e-54
ZYRO0D09878g3.495ON1531534171e-52
NDAI0G009103.495ON1631594078e-51
NCAS0E007803.495ON1711634024e-50
TPHA0D042603.495ON1581503981e-49
Kwal_55.212463.495ON1601503868e-48
KLTH0F14894g3.495ON1661503852e-47
YGR133W (PEX4)3.495ON1831563741e-45
Smik_6.2293.495ON1651563643e-44
CAGL0I10450g3.495ON1621563582e-43
Skud_7.4443.495ON1621563539e-43
SAKL0F02706g3.495ON1611543521e-42
TBLA0C045003.495ON1651523512e-42
Suva_7.4213.495ON1651563477e-42
KNAG0B007803.495ON1531473242e-38
AFR314W3.495ON1551533233e-38
KAFR0C019903.495ON1511503006e-35
Ecym_12343.495ON1611502852e-32
KLLA0E04027g3.495ON1581542478e-27
Suva_2.2183.308ON1481382051e-20
Skud_4.3143.308ON1481382051e-20
YDR059C (UBC5)3.308ON1481382051e-20
Smik_4.2973.308ON1481382042e-20
CAGL0E04752g3.308ON1471382024e-20
Suva_4.3263.308ON1481142007e-20
KNAG0J023403.308ON1611142001e-19
KAFR0C002703.308ON1471141991e-19
TBLA0F024406.109ON1741482011e-19
KLTH0E14300g3.308ON1471401972e-19
SAKL0B06512g3.308ON1471401972e-19
AER173C3.308ON1471401972e-19
Ecym_74313.308ON1471401963e-19
Kpol_461.86.109ON1671311964e-19
Skud_2.2073.308ON1481141954e-19
Smik_2.2193.308ON1481141954e-19
YBR082C (UBC4)3.308ON1481141954e-19
KLLA0C05632g6.109ON1641391965e-19
TPHA0J017506.109ON1691181966e-19
YGL058W (RAD6)6.109ON1721481966e-19
SAKL0A07260g6.109ON1691481966e-19
AAR156C6.109ON1701481966e-19
Ecym_30776.109ON1701481966e-19
Smik_7.2226.109ON1711481966e-19
Suva_7.2136.109ON1731481966e-19
ZYRO0C04950g6.109ON1681481956e-19
TDEL0G036106.109ON1691481956e-19
NCAS0A108003.308ON1481381937e-19
NDAI0A054903.308ON1471381938e-19
KNAG0F025706.109ON1511071938e-19
NCAS0D032206.109ON1711481958e-19
TDEL0F021003.308ON1471401938e-19
KLTH0H06732g6.109ON1601071949e-19
ZYRO0G12870g3.308ON1471401921e-18
TBLA0I021303.308ON1481401921e-18
CAGL0I00352g6.109ON1671481931e-18
Kwal_27.124013.308ON2361141971e-18
KAFR0A047006.109ON1531181922e-18
Kpol_1052.23.308ON1481401912e-18
KLLA0E12563g3.308ON1481401912e-18
Kwal_14.18286.109ON1521071902e-18
TPHA0A038503.308ON1481401893e-18
TDEL0H039707.54ON156971878e-18
Skud_7.2226.109ON1701481889e-18
KAFR0B060608.375ON2131301882e-17
NDAI0I016506.109ON1761071853e-17
SAKL0A00396g8.375ON2151401863e-17
Smik_15.5177.54ON156971825e-17
Skud_4.4418.375ON2151291839e-17
CAGL0E00671g8.375ON2131301831e-16
KLLA0C18656g8.375ON2281291831e-16
YDR177W (UBC1)8.375ON2151291831e-16
Suva_2.3438.375ON2151291831e-16
Smik_4.4258.375ON2151291831e-16
TDEL0F049908.375ON2171371812e-16
NDAI0A011608.375ON2161401812e-16
TBLA0H031308.375ON2141291803e-16
Kpol_1065.127.54ON1591101763e-16
NCAS0B031508.375ON2141301785e-16
Skud_15.5047.54ON1561121746e-16
ADR169C8.375ON2111301777e-16
Ecym_60388.375ON2111401769e-16
KLTH0A07546g8.375ON2151511769e-16
ZYRO0C03784g8.375ON2181301761e-15
ZYRO0D04466g7.54ON159971722e-15
CAGL0M03399g1.436ON2141241742e-15
Suva_8.3897.54ON1561161702e-15
KAFR0H012303.308ON1101001664e-15
YOR339C (UBC11)7.54ON1561061694e-15
Kwal_23.64858.375ON2151291725e-15
TPHA0O009201.436ON2261221726e-15
TPHA0B034108.230ON1521031676e-15
KNAG0H029808.230ON1521031677e-15
ZYRO0B11682g8.230ON1511031669e-15
TPHA0L008508.375ON2161291709e-15
Kpol_1030.108.375ON2151291691e-14
NDAI0J015408.230ON1541031642e-14
NDAI0E038707.54ON164971643e-14
TDEL0B056701.436ON2031241663e-14
AGR121C8.230ON1541041633e-14
KNAG0H018701.436ON2101221663e-14
SAKL0B10582g7.54ON1611031633e-14
KLTH0D01760g7.54ON1611171633e-14
Skud_4.3528.230ON1431031614e-14
Kpol_1075.1b8.230ON1521031624e-14
KLLA0A11198g1.436ON2021241644e-14
KNAG0A048108.375ON2141291654e-14
NCAS0B040108.230ON1531031615e-14
Suva_2.2538.230ON1431031615e-14
KLTH0H13816g1.436ON2331241656e-14
KAFR0A024208.230ON1471031606e-14
AEL045W1.436ON2111221637e-14
SAKL0H17930g8.230ON1531031608e-14
YDR092W (UBC13)8.230ON1531031599e-14
KAFR0H029601.436ON1871241619e-14
Smik_4.3358.230ON1431031599e-14
TDEL0A013408.230ON1571031591e-13
ZYRO0E06358g2.569ON1651241601e-13
CAGL0M07568g2.569ON1651591591e-13
YEL012W (UBC8)1.436ON2181221611e-13
Kpol_1030.181.436ON2231221612e-13
Kwal_26.70097.54ON1611031582e-13
Skud_5.871.436ON2101221612e-13
KLLA0C17622g8.230ON1591031582e-13
Kwal_56.234828.230ON1491031572e-13
NCAS0G031301.436ON2311221612e-13
KLTH0G14366g8.230ON1491031572e-13
Ecym_55638.230ON1641131582e-13
Smik_5.981.436ON2151221602e-13
Kwal_34.161741.436ON2131051602e-13
Ecym_13481.436ON2111051602e-13
NDAI0D011401.436ON2451091603e-13
ABR059W2.569ON1651241563e-13
Suva_5.531.436ON2151221593e-13
Kpol_483.164.249ON122941533e-13
TBLA0F037908.230ON1511031554e-13
TDEL0B065702.569ON1651241564e-13
TBLA0A012901.436ON2191241585e-13
ZYRO0E03806g1.436ON2091241575e-13
CAGL0G08063g8.230ON1491031538e-13
SAKL0D10560g1.436ON2071221559e-13
TPHA0I024602.569ON1671241531e-12
KNAG0M021502.569ON1701171531e-12
KAFR0A021602.569ON1651541512e-12
Ecym_45782.569ON1651231512e-12
NCAS0A127402.569ON1651241503e-12
NDAI0B015202.569ON1651241494e-12
KLLA0E07745g2.569ON1651321486e-12
YDL064W (UBC9)4.249ON157941451e-11
Smik_4.1714.249ON157941451e-11
SAKL0D13552g2.569ON1651241451e-11
TBLA0H026102.569ON1651171442e-11
Suva_4.1864.249ON157941432e-11
Smik_12.3894.49ON1871061452e-11
NCAS0A059404.49ON1931111452e-11
Kwal_26.82242.569ON1651541433e-11
Kpol_1056.52.569ON1651241433e-11
KLTH0D07986g2.569ON1651591424e-11
Ecym_32704.249ON157941415e-11
Smik_13.1862.569ON1651291416e-11
CAGL0D00814g4.249ON157941407e-11
Suva_13.1892.569ON1651241407e-11
Skud_13.1762.569ON1651291407e-11
YMR022W (UBC7)2.569ON1651241408e-11
Suva_10.4014.49ON1871001418e-11
Skud_4.1914.249ON157941399e-11
SAKL0H03058g4.249ON157941391e-10
Kwal_23.42274.249ON122941361e-10
KNAG0D043904.249ON157941381e-10
KLLA0E05039g4.249ON157941381e-10
TBLA0E015704.49ON194981392e-10
TPHA0B007704.249ON157941372e-10
KLTH0D14344g4.249ON157941363e-10
AER056C4.249ON157941363e-10
ZYRO0B12386g4.249ON157941354e-10
KAFR0F030404.49ON169861354e-10
KAFR0G032404.249ON157941345e-10
Skud_12.3894.49ON1871061356e-10
YLR306W (UBC12)4.49ON188911348e-10
KNAG0I029404.49ON197841348e-10
TPHA0F003904.49ON1931041348e-10
TDEL0E012204.249ON157941321e-09
TBLA0I029604.249ON157991302e-09
NDAI0D029104.49ON189991312e-09
NDAI0D043804.249ON157941284e-09
CAGL0D06468g4.49ON187981294e-09
KLLA0C17248g4.49ON1841041277e-09
NCAS0A024904.249ON157941251e-08
KLTH0H09504g4.49ON184941251e-08
Kpol_414.2singletonOFF192961252e-08
Kpol_YGOB_414.24.49ON193961252e-08
TDEL0E055604.49ON187851216e-08
TPHA0M012803.301ON435941211e-07
Suva_7.1826.187ON137901162e-07
CAGL0E04598g3.301ON295991192e-07
Kpol_1065.453.301ON323941192e-07
KAFR0H012703.301ON287941183e-07
Skud_7.1956.187ON100871104e-07
ZYRO0G19910g4.49ON179831145e-07
Skud_4.3063.301ON297941156e-07
Smik_4.2903.301ON297941157e-07
YGL087C (MMS2)6.187ON1371161117e-07
NCAS0A107703.301ON273941157e-07
Suva_2.2113.301ON297941158e-07
KNAG0H010403.301ON296941158e-07
Smik_7.1966.187ON100871098e-07
YDR054C (CDC34)3.301ON295941149e-07
TDEL0D032603.301ON289941149e-07
NDAI0A055303.301ON273941149e-07
ZYRO0G12650g3.301ON285941131e-06
SAKL0H24112g4.49ON185791121e-06
ADL035C4.49ON200861121e-06
Ecym_46837.392ON2431201121e-06
KNAG0F021306.187ON1381171092e-06
KLLA0D09196g3.301ON292941122e-06
TBLA0G032703.301ON330941132e-06
Ecym_83714.49ON267861112e-06
KLLA0E20395g7.392ON2511191112e-06
NCAS0I014303.301ON258971103e-06
SAKL0D02530g3.301ON272941095e-06
KLTH0C06688g7.392ON246951076e-06
Kwal_27.104443.301ON278941087e-06
Ecym_26693.301ON268941078e-06
AGL203C3.301ON270941078e-06
KLTH0C04818g3.301ON275941079e-06
NDAI0A075703.301ON239941042e-05
CAGL0H03157g6.187ON1391171003e-05
KLLA0E19119g6.187ON139117994e-05
TBLA0D006007.392ON2561191015e-05
AGR372W7.392ON2421191006e-05
KNAG0B023607.392ON251951006e-05
CAGL0I05478g7.392ON246951007e-05
NDAI0A016507.392ON251951007e-05
Ecym_22306.187ON138110977e-05
Kwal_27.108377.392ON2461191007e-05
KAFR0C021406.187ON13860978e-05
ZYRO0B03344g7.392ON25095998e-05
Smik_5.2467.392ON25095981e-04
KNAG0J022803.301ON21794971e-04
Skud_5.2257.392ON25095981e-04
YER100W (UBC6)7.392ON25095972e-04
TDEL0G015806.187ON138117942e-04
ZYRO0G08228g6.187ON138117942e-04
Kwal_27.111826.187ON10157904e-04
NCAS0A143907.392ON24095935e-04
SAKL0F12474g7.392ON251119936e-04
KAFR0L017507.392ON251121928e-04
Suva_5.2197.392ON24995919e-04
TPHA0J022506.187ON137116870.002
NDAI0E041707.392ON257121890.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05630
         (150 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   288   e-101
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   168   9e-54
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   165   1e-52
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   161   8e-51
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   159   4e-50
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   157   1e-49
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   153   8e-48
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   152   2e-47
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   148   1e-45
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   144   3e-44
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   142   2e-43
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   140   9e-43
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   140   1e-42
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   139   2e-42
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   138   7e-42
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   129   2e-38
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   129   3e-38
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   120   6e-35
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   114   2e-32
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   100   8e-27
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    84   1e-20
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    84   1e-20
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    84   1e-20
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    83   2e-20
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    82   4e-20
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    82   7e-20
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    82   1e-19
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    81   1e-19
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    82   1e-19
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    80   2e-19
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    80   2e-19
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    80   2e-19
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    80   3e-19
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    80   4e-19
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    80   4e-19
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    80   4e-19
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    80   4e-19
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    80   5e-19
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    80   6e-19
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    80   6e-19
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    80   6e-19
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    80   6e-19
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    80   6e-19
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    80   6e-19
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    80   6e-19
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    80   6e-19
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    80   6e-19
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    79   7e-19
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    79   8e-19
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    79   8e-19
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      80   8e-19
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    79   8e-19
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    79   9e-19
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    79   1e-18
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    79   1e-18
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    79   1e-18
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    80   1e-18
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    79   2e-18
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    78   2e-18
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    78   2e-18
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    78   2e-18
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    77   3e-18
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    77   8e-18
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    77   9e-18
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    77   2e-17
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      76   3e-17
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    76   3e-17
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    75   5e-17
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    75   9e-17
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    75   1e-16
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    75   1e-16
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    75   1e-16
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    75   1e-16
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    75   1e-16
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    74   2e-16
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      74   2e-16
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    74   3e-16
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    72   3e-16
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      73   5e-16
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    72   6e-16
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    73   7e-16
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    72   9e-16
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    72   9e-16
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    72   1e-15
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    71   2e-15
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    72   2e-15
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    70   2e-15
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    69   4e-15
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    70   4e-15
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    71   5e-15
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    71   6e-15
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    69   6e-15
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    69   7e-15
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    69   9e-15
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    70   9e-15
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    70   1e-14
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    68   2e-14
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    68   3e-14
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    69   3e-14
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    67   3e-14
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    69   3e-14
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    67   3e-14
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    67   3e-14
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    67   4e-14
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    67   4e-14
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    68   4e-14
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    68   4e-14
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    67   5e-14
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    67   5e-14
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    68   6e-14
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    66   6e-14
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    67   7e-14
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    66   8e-14
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    66   9e-14
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    67   9e-14
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    66   9e-14
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    66   1e-13
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    66   1e-13
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    66   1e-13
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    67   1e-13
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    67   2e-13
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    65   2e-13
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    67   2e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    65   2e-13
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    65   2e-13
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                67   2e-13
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    65   2e-13
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    65   2e-13
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    66   2e-13
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    66   2e-13
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    66   2e-13
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    66   3e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    65   3e-13
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    66   3e-13
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    64   3e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    64   4e-13
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    65   4e-13
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    65   5e-13
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    65   5e-13
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    64   8e-13
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    64   9e-13
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    64   1e-12
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    64   1e-12
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    63   2e-12
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    63   2e-12
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    62   3e-12
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    62   4e-12
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    62   6e-12
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    60   1e-11
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    60   1e-11
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    60   1e-11
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    60   2e-11
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    60   2e-11
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    60   2e-11
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     60   2e-11
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    60   3e-11
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    60   3e-11
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    59   4e-11
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    59   5e-11
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    59   6e-11
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    59   7e-11
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    59   7e-11
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    59   7e-11
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    59   8e-11
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    59   8e-11
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    58   9e-11
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    58   1e-10
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    57   1e-10
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    58   1e-10
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    58   1e-10
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    58   2e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    57   2e-10
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    57   3e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    57   3e-10
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    57   4e-10
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    57   4e-10
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    56   5e-10
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    57   6e-10
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    56   8e-10
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    56   8e-10
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    56   8e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    55   1e-09
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    55   2e-09
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       55   2e-09
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    54   4e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    54   4e-09
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    54   7e-09
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    53   1e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    53   1e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    53   2e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    53   2e-08
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    51   6e-08
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    51   1e-07
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    49   2e-07
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    50   2e-07
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    50   2e-07
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                50   3e-07
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    47   4e-07
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    49   5e-07
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    49   6e-07
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    49   7e-07
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    47   7e-07
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    49   7e-07
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    49   8e-07
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                49   8e-07
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    47   8e-07
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    49   9e-07
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    49   9e-07
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    49   9e-07
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    48   1e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    48   1e-06
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    48   1e-06
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    48   1e-06
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    47   2e-06
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    48   2e-06
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    48   2e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    47   2e-06
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    47   2e-06
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                47   3e-06
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    47   5e-06
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    46   6e-06
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    46   7e-06
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    46   8e-06
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    46   8e-06
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    46   9e-06
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    45   2e-05
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    43   3e-05
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    43   4e-05
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    44   5e-05
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    43   6e-05
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    43   6e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    43   7e-05
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    43   7e-05
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    42   7e-05
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    43   7e-05
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    42   8e-05
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    43   8e-05
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    42   1e-04
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    42   1e-04
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    42   1e-04
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    42   2e-04
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    41   2e-04
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    41   2e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    39   4e-04
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    40   5e-04
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    40   6e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    40   8e-04
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    40   9e-04
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    38   0.002
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    39   0.002
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    38   0.002
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    39   0.002
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    38   0.003
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    39   0.003
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    38   0.003
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    37   0.003
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    37   0.003
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    38   0.004
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    36   0.006
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    37   0.007
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    36   0.011
NCAS0A04480 Chr1 complement(901897..902898) [1002 bp, 333 aa] {O...    30   3.1  
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    29   4.8  
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    28   8.4  
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    28   9.2  

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  288 bits (738), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 140/150 (93%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           MARIAREYKHIQATLG          PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD
Sbjct: 1   MARIAREYKHIQATLGSESSLVVSLEPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
           RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP
Sbjct: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120

Query: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           DSPLDIDLANILRAQDRSAYYGLVNYYLQS
Sbjct: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  168 bits (425), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 1/149 (0%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGD-LSRWAGEIRGPTGTPYEGHTFSLRLVLGDR 61
           R+ +EY+ ++  LG          PID D L+ W   I GP  TPY GH+F LR+ L   
Sbjct: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPE 64

Query: 62  YPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPD 121
           YP  PPQVTF+   MPHCN+ ++TG ICLNIL   +WSP W+LL V+ AI QLLSDP  D
Sbjct: 65  YPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTD 124

Query: 122 SPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           SPL+IDL+NIL+ +D SAYYGL+ YYL +
Sbjct: 125 SPLNIDLSNILKIKDTSAYYGLIEYYLNN 153

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  165 bits (417), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 81/153 (52%), Positives = 102/153 (66%), Gaps = 3/153 (1%)

Query: 1   MARIAREYKHIQATLGX---XXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLV 57
           M+R A+EYK I   L                  DL+RW   IRGP+GTPYEG  F L L 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 58  LGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSD 117
           L   YP +PP V F   +MPH NV++ TG ICL+ILT +HWSPAWDLLHV++AI QLL +
Sbjct: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120

Query: 118 PEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P   SPL++D+ANIL+A D +AYYGLV+YY++S
Sbjct: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  161 bits (407), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 98/159 (61%), Gaps = 10/159 (6%)

Query: 1   MARIAREYKHIQATLGXX--------XXXXXXXXPID--GDLSRWAGEIRGPTGTPYEGH 50
           M+RI +EYK IQ  L                   PID   DL++W   I+GP GTPY G 
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 51  TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEA 110
            F L + +   YPT PP   F  RSMPHCNVNY TG ICL+IL  +HW+P W+L+  L+A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 111 IIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149
           I  LL DP P+SPL++DLAN+LR  D SAY GL+NYYL 
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  159 bits (402), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (62%), Gaps = 13/163 (7%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXX------------XPID-GDLSRWAGEIRGPTGTPY 47
           M+R+ +EYK IQ TL                       PI   DL+ W  +I+GP GTPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 48  EGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHV 107
             H F L++     YP  PP + F   SMPHCNVN++TG+ICL+IL  +HW+PAW+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 108 LEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           ++AI  LL DP PDSPL++D+ANILR  D+SAY GL+NYYL +
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  157 bits (398), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 96/150 (64%), Gaps = 1/150 (0%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59
           + R+ +E + I+  L           P+   +  +W   ++GP  TPY  H+F L + L 
Sbjct: 3   LKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62

Query: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119
             YP  PP +TF   SMPHCNV + TG ICLNIL  EHWSP W+L++V+ A+ QLL +P 
Sbjct: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122

Query: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149
            DSPL+IDLANILRA D SAY+GL+NYYLQ
Sbjct: 123 VDSPLNIDLANILRAGDTSAYHGLINYYLQ 152

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  153 bits (386), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 100/150 (66%), Gaps = 3/150 (2%)

Query: 3   RIAREYKHIQATLGX--XXXXXXXXXPI-DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59
           R+A+EYK +  TL             P+ D +L  W  +I GP+ TPY+GH FSL + + 
Sbjct: 4   RLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIP 63

Query: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119
             YP  PP+V F  R +PHCNV++E+G IC+N+L   HWSPAWDLLH++ AI  LL++PE
Sbjct: 64  SAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANPE 123

Query: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149
           PDSPLD+DLA + RA D SA+ GLV YYL 
Sbjct: 124 PDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  152 bits (385), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 100/150 (66%), Gaps = 3/150 (2%)

Query: 3   RIAREYKHIQATLGX--XXXXXXXXXPI-DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59
           R+A+EY+ +  TLG            P+ + +L +W   I GP  TPY GH F+L++   
Sbjct: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63

Query: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119
           + YP  PP+V F  R MPHCNV++++G ICL++L   HW+PAWDLLHV+ AI  LL+ PE
Sbjct: 64  EAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPE 123

Query: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149
           PDSPLD+DLA ++RA DRSA+  L+ YYL 
Sbjct: 124 PDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  148 bits (374), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 95/156 (60%), Gaps = 8/156 (5%)

Query: 1   MARIAREYKHIQATLGXX-------XXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTF 52
           M+RI +EYK I  TL                  PID  DLS+W   I GP+ TPYE H F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
            + + +   YP  PP+++F + ++ HCNV   TG ICLNIL PE W+P WDLLH + A+ 
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
           +LL +P  DSPLD+D+ NI+R  D SAY G+V Y+L
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  144 bits (364), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 95/156 (60%), Gaps = 8/156 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXX-------XXXPID-GDLSRWAGEIRGPTGTPYEGHTF 52
           M+RI +EY+ I  TL                  PID  DLSRW  +I GP+ TPYE + F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
            + + +   YP TPP++ F +  + HCNV   TG ICL+IL PE W+P WDLLH + A+ 
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
           +LL +P  DSPLD+D+ NI+R  D SAY G+V Y+L
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  142 bits (358), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 1   MARIAREYKHIQATL--GXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           MARI++E   I+  L  G            D DLSRW   I+GP  TPY  + F L + +
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60

Query: 59  GDRYPTTPPQVTFAR------RSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
              YP  PP + F        R  PHCNV+  TG ICL+IL PE WSP WD+LHV++AI 
Sbjct: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120

Query: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
            LL +P PDSPLD+D+ANIL+  D SAY G++ Y+L
Sbjct: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  140 bits (353), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 1   MARIAREYKHIQATLGXX-------XXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTF 52
           M+RIA+EY  IQ TL                  PID  DLS+W   I GPT TPYE + F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
            + + +   YP  PP + F R ++ HCN+   TG ICL+IL PE W+P WDLLH + AI 
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
           +LL +P  DSPLD+D+ NI+R  D  AY G++ Y+L
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  140 bits (352), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 99/154 (64%), Gaps = 6/154 (3%)

Query: 1   MARIAREYKHIQATLGX--XXXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLV 57
           + RI +E+K ++ TL             P D G++  W  +I GP  TPY    F+L + 
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62

Query: 58  LGDRYPTTPPQVTF---ARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQL 114
           L  +YP  PP+V F   +R ++ HCNV+++TG ICL+ILT EHWSP WDL+HV+ AI  L
Sbjct: 63  LPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWIL 122

Query: 115 LSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
           L +P P+SPL++D+AN+L+A D  AY GL+ YY+
Sbjct: 123 LGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  139 bits (351), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 94/152 (61%), Gaps = 5/152 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDG---DLSRWAGEIRGPTGTPYEGHTFSLRLV 57
           M+RI +EY HI+  L           P+     DLS W   I GP  +PY   +F L + 
Sbjct: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59

Query: 58  LGDRYPTTPPQVTFARRSMP-HCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLS 116
           +   YP+ PP + F + S+P HCNVN+ TG ICLNIL  E+WSP W+LL+ ++AIIQLL+
Sbjct: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119

Query: 117 DPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
            P+P SPL+IDL+ +L  +D  AY  L+ YYL
Sbjct: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  138 bits (347), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 94/156 (60%), Gaps = 8/156 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPI--------DGDLSRWAGEIRGPTGTPYEGHTF 52
           M+RI +EY+ I+ TL            I        + DLS+W   I GP  TPYE + F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
            + + + D YP  PP++ F + ++ HCN+N  TG ICL+IL  + W+P WDLLH + A+ 
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
           +LL +P  DSPLD+D+ NI+R  D+ AY G+V Y+L
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  129 bits (324), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDR 61
           R+ REY+ + A  G          P D  DL+ W   + GP GTPYEGH+F LR+ + D+
Sbjct: 4   RVLREYRRLVAAGGAANESNLH--PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61

Query: 62  YPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPD 121
           YPT PP V F +R+MPH NV ++TG +CL+ L    W+P  DL + + A+ +LL++P P+
Sbjct: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNPE 120

Query: 122 SPLDIDLANILRAQDRSAYYGLVNYYL 148
           SPL+++LA + R  D  AY G++ Y L
Sbjct: 121 SPLNLELAALSRLGDHKAYDGIIKYRL 147

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  129 bits (323), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 94/153 (61%), Gaps = 5/153 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPI---DGDLSRWAGEIRGPTGTPYEGHTFSLRLV 57
           M RI REYK +Q  L           P+   +GDL RW    +GP  TPY G TF+LR+ 
Sbjct: 1   MRRILREYKQLQKQLALHPAVLSLA-PVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59

Query: 58  LGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSD 117
           + + YP  PP+ +F    + H N+ + TG +CL++L  E WSP ++LL V+EAI  LL++
Sbjct: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119

Query: 118 PEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P  DSPLD+DL+  L   DR+AY G+VNY L++
Sbjct: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRT 151

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  120 bits (300), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 93/150 (62%), Gaps = 5/150 (3%)

Query: 2   ARIAREYKHIQATLGXXXXXXXXXXPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           +RI +EYK  ++             PI   DL+ W   I+GP  +P+  HTF LR+ +  
Sbjct: 3   SRILKEYKDSRS---LQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQ 59

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP T P   F   +MPH NVN+ETG ICL+IL   +WSP +++ +++EAI+ LL++P  
Sbjct: 60  TYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNF 118

Query: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
            SPL++DLAN+LR  D  AY+ L++Y+L +
Sbjct: 119 KSPLNLDLANLLRFDDLKAYHDLISYHLNN 148

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  114 bits (285), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 85/150 (56%), Gaps = 2/150 (1%)

Query: 2   ARIAREYKHIQATLGXXXXXXXXXXPIDG-DLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           +R+  EYK I+  L             DG  LS+W  +  GP  TPY   TF+L + + +
Sbjct: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP   F    + H N+ + TG +CL++L  E WSP ++LL V+EAI  LL++P  
Sbjct: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129

Query: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           DSPLD+DLA  L + D+ AY GLV Y L S
Sbjct: 130 DSPLDVDLAK-LYSVDKQAYQGLVTYRLCS 158

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 99.8 bits (247), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 89/154 (57%), Gaps = 6/154 (3%)

Query: 1   MARIAREYKHIQATLGXXXXX-XXXXXPIDGD-LSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           M+RI +EY  +Q  L            P+D D LS W    +GP+ +P+EG    L + +
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60

Query: 59  G-DRYPTTP-PQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLS 116
             ++YP +  P+V F  R++ H NV ++TG ICL++L  + W+P + LL V+ AI  LL+
Sbjct: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119

Query: 117 DPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           DP  DSPLD+D+A I  A D  AY  +V Y L+ 
Sbjct: 120 DPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 83.6 bits (205), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RIA+E     + LG          P+  DL  W   I GP+ +PY G  F L +     Y
Sbjct: 6   RIAKEL----SDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+V F  + + H N+N  +G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 62  PFKPPKVNFTTK-IYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 118

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A I +  D++ Y
Sbjct: 119 PLVPEIAQIYKT-DKAKY 135

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 83.6 bits (205), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RIA+E     + LG          P+  DL  W   I GP+ +PY G  F L +     Y
Sbjct: 6   RIAKEL----SDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+V F  + + H N+N  +G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 62  PFKPPKVNFTTK-IYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 118

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A I +  D++ Y
Sbjct: 119 PLVPEIAQIYKT-DKAKY 135

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 83.6 bits (205), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RIA+E     + LG          P+  DL  W   I GP+ +PY G  F L +     Y
Sbjct: 6   RIAKEL----SDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+V F  + + H N+N  +G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 62  PFKPPKVNFTTK-IYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 118

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A I +  D++ Y
Sbjct: 119 PLVPEIAQIYKT-DKAKY 135

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RIA+E     + LG          P+  DL  W   I GP+ +PY G  F L +     Y
Sbjct: 6   RIAKEL----SDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+V F  + + H N+N  +G+ICL+IL  + WSPA  L  VL ++  LL+D  PD 
Sbjct: 62  PFKPPKVNFTTK-IYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSVCSLLTDANPDD 118

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A I +  D++ Y
Sbjct: 119 PLVPEIAQIYKT-DKAKY 135

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 82.4 bits (202), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RIA+E     + LG          P+  DL  W   I GP  +PY G  F L +     Y
Sbjct: 5   RIAKEL----SDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDY 60

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+++F  + + H N+N   G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 61  PFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 117

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A+I +  DR+ Y
Sbjct: 118 PLVPEIAHIYKT-DRAKY 134

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 81.6 bits (200), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 26  PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 83

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DRS Y
Sbjct: 84  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 135

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 39  PVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 96

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DRS Y
Sbjct: 97  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 148

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 81.3 bits (199), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 25  PVGDDLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 82

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DRS Y
Sbjct: 83  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 134

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 74/148 (50%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K I++             P+  ++  W   I GP+ TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRIKSD----SPPGISASPLPDNVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVSSILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   R+ Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-RAQYVKKVKETVEK 147

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 80.5 bits (197), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  DL  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 80.5 bits (197), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  DL  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 80.5 bits (197), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  DL  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 80.1 bits (196), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  DL  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 80.1 bits (196), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 7/131 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFVSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILR 133
           P +++ A + +
Sbjct: 121 PANVEAATLFK 131

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.7 bits (195), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 26  PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 83

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DR  Y
Sbjct: 84  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKY 135

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.7 bits (195), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 26  PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 83

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DR  Y
Sbjct: 84  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKY 135

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 79.7 bits (195), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 26  PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 83

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  L  VL +I  LL+D  PD PL  ++A+I +  DR  Y
Sbjct: 84  NICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKY 135

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 69/139 (49%), Gaps = 9/139 (6%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----SPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYY 141
           P +++ A +   QD  + Y
Sbjct: 121 PANVEAATLF--QDHKSQY 137

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 63/118 (53%), Gaps = 4/118 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP+ TPYE  TF L L   + YP  PP V F    M H NV Y  G
Sbjct: 28  PLPDNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISE-MFHPNV-YANG 85

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +   +S Y   V
Sbjct: 86  EICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH-KSQYIKKV 141

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 79.7 bits (195), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYIKRVKETVEK 147

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 79.7 bits (195), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 79.0 bits (193), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RI +E     + +G          P+  DL  W   I GP  +PY G  F L +     Y
Sbjct: 6   RITKEL----SDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDY 61

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+++F  + + H N+N   G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 62  PFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 118

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A+I +  DR  Y
Sbjct: 119 PLVPEIAHIYKT-DRPKY 135

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 79.0 bits (193), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           RI +E     + +G          P+  DL  W   I GP  +PY G  F L +     Y
Sbjct: 5   RITKEL----SDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDY 60

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP+++F  + + H N+N   G+ICL+IL  + WSPA  L  VL +I  LL+D  PD 
Sbjct: 61  PFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDD 117

Query: 123 PLDIDLANILRAQDRSAY 140
           PL  ++A+I +  DR  Y
Sbjct: 118 PLVPEIAHIYKT-DRPKY 134

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 79.0 bits (193), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 3/107 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP  TPYE  TF L L   + YP  PP V F    M H NV Y  G
Sbjct: 13  PLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANG 70

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +
Sbjct: 71  EICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYIKRVKETVEK 147

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 79.0 bits (193), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKIAFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 79.3 bits (194), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 3/107 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP  TPYE  TF L L   + YP  PP V F    M H NV Y  G
Sbjct: 24  PLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV-YANG 81

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +
Sbjct: 82  EICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 8/140 (5%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + RI +E       LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 3   LKRITKELND----LGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 59  DYPFKPPKIAFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 115

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR+ Y
Sbjct: 116 DDPLVPEIAHIYKT-DRAKY 134

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+ + R  K +   LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 1   MSSLKRITKELN-DLGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 60  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 116

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A+I +  DR  Y
Sbjct: 117 DDPLVPEIAHIYKT-DRPKY 135

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  TPYE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----SPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYIKRVKETVEK 147

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  DL  W   I GP  +PY G  F L +     YP  PP+++F  + + H N+N   G
Sbjct: 114 PVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANG 171

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +ICL+IL  + WSPA  +  VL +I  LL+D  PD PL  ++A+I +  DR+ Y
Sbjct: 172 NICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKY 223

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (52%), Gaps = 4/118 (3%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP  TPYE  TF L L   + YP  PP V F    M H NV Y  G
Sbjct: 13  PLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANG 70

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +   +S Y   V
Sbjct: 71  EICLDILQ-NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDH-KSQYVKRV 126

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 5/140 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+ + R  K +   LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 1   MSSLKRITKELN-DLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 60  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 116

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A++ +  DR+ Y
Sbjct: 117 DDPLVPEIAHLYKT-DRAKY 135

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 5/140 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+ + R  K +   LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 1   MSSLKRITKELN-DLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 60  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 116

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A++ +  DR+ Y
Sbjct: 117 DDPLVPEIAHLYKT-DRAKY 135

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 77.8 bits (190), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP  TPYE  TF L L   + YP  PP V F      H NV Y  G
Sbjct: 13  PLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPNV-YANG 70

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +
Sbjct: 71  EICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 77.4 bits (189), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+ + R  K +   LG          P+  D+  W   I GP  +PY G  F L +    
Sbjct: 1   MSSLKRITKELN-DLGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP+++F  + + H N+N   G+ICL+IL  + WSPA  +  VL +I  LL+D  P
Sbjct: 60  DYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANP 116

Query: 121 DSPLDIDLANILRAQDRSAY 140
           D PL  ++A++ +  DR  Y
Sbjct: 117 DDPLVPEIAHLYKT-DRPKY 135

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL++W G I GP GTPYE   F L L   D+YP  PP+VTF    M H NV+  +G+I
Sbjct: 36  EDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFV-SPMWHPNVDM-SGNI 93

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLD 125
           CL+IL  + WS  +++  +L ++  LL +P   SPL+
Sbjct: 94  CLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLN 129

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ R++K ++              P+  ++  W   I GP  T YE  TF L L   + Y
Sbjct: 8   RLMRDFKRMKED----APPGVSASPLPDNVMVWNAMIIGPADTSYEDGTFRLLLEFDEEY 63

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDS 122
           P  PP V F    M H NV Y  G ICL+IL    W+P +D+  +L +I  L +DP P S
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 123 PLDIDLANILRAQDRSAYYGLVNYYLQS 150
           P +++ A + +   +S Y   V   ++ 
Sbjct: 121 PANVEAATLFKDH-KSQYVKRVKETVEK 147

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 64/130 (49%), Gaps = 2/130 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA              I+ D+    G   GP GTPYE   F + + +  
Sbjct: 1   MSRAKRIMKELQAVKDDPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PPQ+ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPQMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLAN 130
           + P D ++A 
Sbjct: 119 NDPQDAEVAQ 128

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P+  ++  W   I GP  TPYE  TF L L   + YP   P V F    M H NV Y  G
Sbjct: 28  PLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSE-MFHPNV-YANG 85

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
            ICL+IL    W+P +D+  +L +I  L +DP P SP +++ A + +
Sbjct: 86  EICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 70/140 (50%), Gaps = 3/140 (2%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPL 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLANILRAQDRSAY 140
           + P D ++A     +D+S++
Sbjct: 119 NDPQDAEVAQHF-IRDKSSF 137

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (59%), Gaps = 3/97 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D DL+ W G I GP GTPY G  F + L   + YP  PP++ F    M H NV+ ++G+I
Sbjct: 35  DNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFV-SPMWHPNVD-KSGNI 92

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLD 125
           CL+IL  E WS  +++  +L ++  LL +P   SPL+
Sbjct: 93  CLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLN 128

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 75.1 bits (183), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 2/130 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDSK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLAN 130
           + P D ++A 
Sbjct: 119 NDPQDAEVAQ 128

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M R  R  K IQA               + D+    G   GP+GTPYEG  F + + +  
Sbjct: 1   MLRSKRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPV 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PPQ+ F  + + H NV+  TG+ICL+IL    W+P   L   L ++  LL  PEP
Sbjct: 61  EYPYKPPQMKFDTK-VYHPNVSSVTGAICLDILK-NAWTPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D  +A
Sbjct: 119 NDPQDAQVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 3/137 (2%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPY+G  F + + +  
Sbjct: 1   MSRAKRIMKEMQAVKDDPAAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H NV+  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA-NILRAQD 136
           + P D ++A + LR +D
Sbjct: 119 NDPQDAEVAQHYLRDKD 135

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 70/140 (50%), Gaps = 3/140 (2%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKELQAVKDDPTAKIGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLANILRAQDRSAY 140
           + P D ++A     +DR+++
Sbjct: 119 NDPQDAEVAQHY-LKDRASF 137

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEMQAVKDDPAANITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 4/110 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L++W+G I GP  +PY G  F + L   DRYP  PP+V F    M H NV+  +G+ICL
Sbjct: 41  NLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV-SPMWHPNVDL-SGNICL 98

Query: 91  NILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           ++L  E WS  +++  +L ++  LL +P   SPL+  +A  L   D+  Y
Sbjct: 99  DVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 63/130 (48%), Gaps = 2/130 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYEG  F + + +  
Sbjct: 1   MSRAKRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP + F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPMMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLAN 130
           + P D ++A 
Sbjct: 119 NDPQDAEVAQ 128

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 71.6 bits (174), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D DL+ W G I GP GTPY    F + L   + YP  PP+V F    M H NV+ ++G+I
Sbjct: 35  DNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFV-SPMWHPNVD-KSGNI 92

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           CL+IL  E WS  +++  +L ++  LL +P   SPL+  +A  L  +D   Y
Sbjct: 93  CLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGY 142

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 72.8 bits (177), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 2/130 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQ+               + D+    G   GP GTPY G TF + + +  
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPL 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQALLQSPEP 118

Query: 121 DSPLDIDLAN 130
           + P D ++A 
Sbjct: 119 NDPQDAEVAK 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 69/140 (49%), Gaps = 3/140 (2%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K IQ+               + D+    G   GP GTPY G  F + + +  
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPL 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQALLQSPEP 118

Query: 121 DSPLDIDLANILRAQDRSAY 140
           + P D ++A    + DRS++
Sbjct: 119 NDPQDAEVAKHYLS-DRSSF 137

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 5/151 (3%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYE   F + + +  
Sbjct: 1   MSRAKRVMKELQAIKDDPEAKVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H NV+  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLAN-ILRAQDRSAYYGLVNYYLQS 150
           + P D ++A   LR  D++++     ++ ++
Sbjct: 119 NDPQDAEVAQHFLR--DKASFDKTAAFWTKT 147

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 2/130 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+ R  G   GP  TPY+G  F + + +  
Sbjct: 1   MSRAKRLMKELQAVRDDPAANITLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLAN 130
           + P D ++A 
Sbjct: 119 NDPQDAEVAQ 128

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL  W+G I GP GTPYE   F + L   D YP  PP+V F    M H NV+  +G+I
Sbjct: 39  EDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFI-SPMWHPNVDM-SGNI 96

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLD 125
           CL+IL  + WS  +++  +L ++  L  +P   SPL+
Sbjct: 97  CLDILK-DQWSAVYNVQTILLSLQSLFEEPNNSSPLN 132

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYEG  + L + L D YP   P + F  +   H N++  +GS
Sbjct: 26  VEDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGS 84

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E ++  LL +P    PL+ + AN L+ +D+  Y   V  
Sbjct: 85  ICLDVIN-STWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVRE 142

Query: 147 YLQS 150
           Y+  
Sbjct: 143 YIDK 146

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 63/116 (54%), Gaps = 4/116 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D DL+ W G I GP GTPY    F + L   + YP  PP+V F    M H NV+  +G+I
Sbjct: 35  DNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFV-SPMWHPNVDM-SGNI 92

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           CL+IL  E WS  +++  +L ++  LL +P   SPL+  +A  L  +D   Y   V
Sbjct: 93  CLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEEYKKKV 146

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 68.6 bits (166), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 4/100 (4%)

Query: 41  GPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
           GP  +PY G  F L +     YP  PP+++F  + + H N+N   G+ICL+IL  + WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDILK-DQWSP 58

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           A  L  VL +I  LL+D  PD PL  ++A+I +  DR  Y
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKY 97

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D DL+ W G I GP  TPY G  F + L     YP  PP + F    M H NV+ ++G+I
Sbjct: 35  DNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFL-SPMWHPNVD-KSGNI 92

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRA 134
           CL+IL  E WS  +++  +L ++  LL +P   SPL+   A +  A
Sbjct: 93  CLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDA 137

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP GTPYE   + + + +  
Sbjct: 1   MSRAKRVMKELQAIKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H NV+  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFQTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 70.9 bits (172), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  +  GP  TPYEG  + L + L D YP   P + F  + + H N++  +GS
Sbjct: 27  VNDNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 85

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L+  D+  Y   +  
Sbjct: 86  ICLDVINST-WSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKE 143

Query: 147 YL 148
           Y+
Sbjct: 144 YI 145

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 68.9 bits (167), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  ++  I GP G+PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   + GP G+PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 68.6 bits (166), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +A  I GP  +PYE   F L L L D YP   P+V F  R + H N++   G
Sbjct: 27  PHEDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLTR-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 70.1 bits (170), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K ++A               + D+    G   GP  TPYEG  F + + +  
Sbjct: 1   MSRAKRIMKEMEAVRDDPEANIDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G   GP  TPY+G  F + + +  
Sbjct: 1   MSRAKRIMKEMQAVKDDPAANINLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H N++  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   + GPT +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 3/97 (3%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL+ W+  I GP  TPY+G  F L     D YP  PP V F    M H NV+  +G+I
Sbjct: 43  EEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI-SPMWHPNVDM-SGNI 100

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLD 125
           CL+IL  + WS  +++  +L ++  LL +P   SPL+
Sbjct: 101 CLDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLN 136

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 68/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  + RGP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 13  VNDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGS 71

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL +++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 72  ICLDVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKE 129

Query: 147 YLQS 150
           Y+  
Sbjct: 130 YIDK 133

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  +PYE   F L L L D YP  PP+V F  +   H N++   G
Sbjct: 27  PHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTKIY-HPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLAN 130
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A 
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           I+  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 26  INDSMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGFVNK-IYHPNIDIASGS 84

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 85  ICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKE 142

Query: 147 YL 148
           Y+
Sbjct: 143 YI 144

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL++W+G I GP GTPYEG  F + L     YP T P+VTF    M H NV+  +G+I
Sbjct: 41  EDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFV-SPMWHPNVDM-SGNI 98

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANI 131
           CL+IL  + WS  +++  +L ++  LL +P   SPL+   A +
Sbjct: 99  CLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 63/117 (53%), Gaps = 3/117 (2%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL++W G I GP GTPYEG  F + L     YP T P+V F    M H NV+  +G+ICL
Sbjct: 43  DLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDM-SGNICL 100

Query: 91  NILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYY 147
           +IL  + WS  +++  +L ++  LL +P   SPL+   A +     R     L+  Y
Sbjct: 101 DILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIARY 156

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  R + H N++   G
Sbjct: 17  PHDDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTR-IYHPNID-RLG 74

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 75  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 67.8 bits (164), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 68/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 26  VEDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGS 84

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L+ +D+  Y   ++ 
Sbjct: 85  ICLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHE 142

Query: 147 YLQS 150
           Y+  
Sbjct: 143 YINK 146

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           M+R  R  K +QA               + D+    G  +GP  TPY+   F + + +  
Sbjct: 1   MSRAKRIMKEMQAVKDDPEAHITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPM 60

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120
            YP  PP++ F  + + H NV+  TG+ICL+IL    WSP   L   L ++  LL  PEP
Sbjct: 61  EYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEP 118

Query: 121 DSPLDIDLA 129
           + P D ++A
Sbjct: 119 NDPQDAEVA 127

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 66.6 bits (161), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   + GP G+PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 17  PHDDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 74

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 75  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 69/124 (55%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           +D ++  +  +  GP GTPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 25  VDDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +++  Y   +  
Sbjct: 84  ICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKIRE 141

Query: 147 YLQS 150
           ++  
Sbjct: 142 FIDK 145

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 66.2 bits (160), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 23  PHDDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 80

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL+IL   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 81  RICLDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 67.4 bits (163), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           +D ++  +  +  GP GTPYE   + L + L D YP   P + F  +   H N++  +GS
Sbjct: 25  VDDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L+ ++   Y   +  
Sbjct: 84  ICLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNPQMYEEKIQE 141

Query: 147 YL 148
           Y+
Sbjct: 142 YI 143

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L + YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 65.9 bits (159), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 66.6 bits (161), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  +  GP  TPYE   + L + L D YP   P + F  +   H N++  +GS
Sbjct: 25  VNDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDVASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 84  ICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKE 141

Query: 147 YLQS 150
           Y+  
Sbjct: 142 YIDK 145

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 65.9 bits (159), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P D +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 17  PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTK-IYHPNID-RLG 74

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 75  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  +PYE   F+L L L D YP   P+V F  + + H N++ + G
Sbjct: 27  PHEDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLTK-IYHPNID-KLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL  W   I+GP  TPYEG  F+ +L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDYPLSPPKLTFT-PSILHPNI-YHNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  ++D A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVD-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RPEF 151

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 17/159 (10%)

Query: 1   MARIA--REYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           M++ A  R YK +Q  +             D +L  W   I+GP  TPY G  F+ +L  
Sbjct: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60

Query: 59  GDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL------------TPEHWSPAWDLLH 106
              YP +PP++TF   S+ H N+ Y  G +C++IL              E WSP   +  
Sbjct: 61  PKDYPLSPPKLTFT-PSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVN 145
           +L +++ +LS+P  +S  +ID A IL   +R+ +   V 
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNRAEFEKQVK 156

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 66.6 bits (161), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           I+  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 25  INDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 84  ICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKE 141

Query: 147 YL 148
           Y+
Sbjct: 142 YI 143

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 26  VNDNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 84

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L+  D++ Y   +  
Sbjct: 85  ICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKE 142

Query: 147 YL 148
           Y+
Sbjct: 143 YI 144

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL++W G I GP GTPYEG  F + L     YP T P+V F    M H NV+  +G+I
Sbjct: 41  EDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDM-SGNI 98

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANI 131
           CL+IL  + WS  +++  +L ++  LL +P   SPL+   A +
Sbjct: 99  CLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 24  VNDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 82

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL+++LE +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 83  ICLDVINS-TWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKE 140

Query: 147 YL 148
           Y+
Sbjct: 141 YI 142

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 48  VNNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 106

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DLL+++E +I  LL +P    PL+ + A  L  +D+  Y   +  
Sbjct: 107 ICLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIRE 164

Query: 147 YL 148
           Y+
Sbjct: 165 YI 166

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  +PYE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL ++  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP  + YE   F L L L D YP  PP+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSA 139
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A    A + +A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAEDWIADEDAA 136

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           I+  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 25  INDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 84  ICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKE 141

Query: 147 YL 148
           Y+
Sbjct: 142 YI 143

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           I+ ++  +  +  GP  TPYEG  + L + L D YP   P + F  + + H N++  +GS
Sbjct: 13  INDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGS 71

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANI 131
           ICL+++    WSP +DLL++LE +I  LL +P    PL+ + A +
Sbjct: 72  ICLDVINS-AWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           +D ++  +  +  GP GTPYE   + L + L D YP   P + F  +   H N++  +GS
Sbjct: 25  VDDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANI 131
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A +
Sbjct: 84  ICLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 4/109 (3%)

Query: 41  GPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
           GP  TPYE   + L + L D YP   P + F  + + H N++  +GSICL+++    WSP
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 113

Query: 101 AWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148
            +DLL+++E +I  LL +P    PL+ + A  L  +D+  Y   +  Y+
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYI 161

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 65/124 (52%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + +L  W   I GP  +PYEG  F+ RL     YP +PP++TF   S+ H NV Y  G +
Sbjct: 31  EDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFT-PSILHPNV-YPNGEV 88

Query: 89  CLNIL------------TPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++IL              E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R+ +
Sbjct: 148 RADF 151

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 65.9 bits (159), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 25  VNDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 84  ICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKE 141

Query: 147 YL 148
           Y+
Sbjct: 142 YI 143

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 63.5 bits (153), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL RW   I G TGT +    + + +   D YP+ PP+V F  +   H NV Y +G+ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFP-KGFYHPNV-YPSGTICL 59

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  E  W PA  L  ++  +  LL  P P+SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 64.3 bits (155), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  ++  I GP  + YE   F L L L D YP   P+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + +L  W   I+GP  TPYEG  F+ RL     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ESNLFLWDCLIQGPPDTPYEGGIFNARLDFPKDYPLSPPKLTFT-PSILHPNI-YHNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  ++D A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANVD-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RPEF 151

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 65.5 bits (158), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  +  GP  TPYE   + L + L D YP   P + F  +   H N++  +GS
Sbjct: 25  VNDNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGS 83

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 84  ICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKE 141

Query: 147 YLQS 150
           Y+  
Sbjct: 142 YIDK 145

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 65.1 bits (157), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 4/124 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++ ++  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 27  VNDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGS 85

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL +++E +I  LL +P    PL+ + A  L+ +D+  Y   +  
Sbjct: 86  ICLDVINS-TWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKE 143

Query: 147 YLQS 150
           Y+  
Sbjct: 144 YIDK 147

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 63.5 bits (153), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + +L  +   I GP+ +PYE   F L L L + YP   P+V F  + + H N++   G
Sbjct: 27  PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTK-IYHPNID-RLG 84

Query: 87  SICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
            ICL++L   +WSPA  +  VL +I  LL+ P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 64.3 bits (155), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 28  IDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGS 87
           ++  +  +  +  GP  TPYE   + L + L D YP   P + F  + + H N++  +GS
Sbjct: 13  VNDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGS 71

Query: 88  ICLNILTPEHWSPAWDLLHVLEAII-QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNY 146
           ICL+++    WSP +DL++++E +I  LL +P    PL+ + A  L+ +++  Y   +  
Sbjct: 72  ICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKIQE 129

Query: 147 YL 148
           Y+
Sbjct: 130 YI 131

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (51%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + ++  W   I GP  TPYE   F+  L+    YP +PP++TF   S+ H N+ Y  G +
Sbjct: 33  ENNMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSPPKLTFT-PSLLHPNI-YPNGEV 90

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A+IL   +
Sbjct: 91  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ASILYRDN 149

Query: 137 RSAY 140
           R  +
Sbjct: 150 RPEF 153

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 14/117 (11%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL  W   ++GP  +PYEG  F  +L     YP +PP++TF   S+ H NV Y  G +
Sbjct: 31  ESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFV-PSVLHPNV-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID   + R
Sbjct: 89  CISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWR 145

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 75/154 (48%), Gaps = 17/154 (11%)

Query: 1   MARIA--REYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           M++ A  R  K +Q  +             + ++ +W   ++GP  +PYEG  F+ +L  
Sbjct: 1   MSKTAQKRLLKELQQLMKDSPPGIVAGPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDF 60

Query: 59  GDRYPTTPPQVTFARRSMPHCNVNYETGSICLNI------------LTPEHWSPAWDLLH 106
              YP +PP++TF   S+ H N+ Y  G +C++I            L  E WSP   +  
Sbjct: 61  PKDYPLSPPKLTFT-PSILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +L +++ +LS+P  +S  +ID A IL   +R  +
Sbjct: 119 ILLSVMSMLSEPNIESGANID-ACILWRDNRKEF 151

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 15/123 (12%)

Query: 35  WAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL- 93
           W   I GP  +PYEG  F+ RL     YP +PP++TF   S+ H NV Y  G +C++IL 
Sbjct: 37  WDCLIAGPPDSPYEGGIFNARLQFPTDYPLSPPKLTFT-PSILHPNV-YPNGEVCISILH 94

Query: 94  -----------TPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYG 142
                        E WSP   +  +L +++ +LS+P  +S  +ID A IL   +R  +  
Sbjct: 95  APGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANID-ACILWRDNRPDFVK 153

Query: 143 LVN 145
            V 
Sbjct: 154 QVK 156

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (51%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + +L  W   ++GP  T YEG  F+ RL     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 REEF 151

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (51%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + +L  W   ++GP  T YEG  F+ RL     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RKEF 151

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 15/132 (11%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D +L +W   I GP  + YEG  F+ RL     YP  PP++TF + S+ H N+ Y  G +
Sbjct: 31  DSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPLNPPKLTF-QPSILHPNI-YPNGEV 88

Query: 89  CLNIL-TP-----------EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++IL +P           E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSILSEPNIESGANID-ACILWRDN 147

Query: 137 RSAYYGLVNYYL 148
           R  +   V   L
Sbjct: 148 RPEFERQVKLNL 159

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL +W   I G  GT + G  + + +   + YP+ PP+V F      H NV Y +G+ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL +W   I G  GT + G  + + +   + YP+ PP+V F      H NV Y +G+ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + +L  W   I GP  +PYEG  F+  L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  EDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPRLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L ++  +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  Y
Sbjct: 148 RPEY 151

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (49%), Gaps = 14/117 (11%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL  W   + GP  TPY G  F+ +L     YP +PP +TF   S+ H NV Y  G +
Sbjct: 31  ESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFT-PSILHPNV-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILR 133
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID   + R
Sbjct: 89  CISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACILWR 145

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL +W   I G  GT + G  + + +   + YP+ PP+V F      H NV Y +G+ICL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 43  TGTPYEGH----TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHW 98
           T  P EG+    + +  L   + YP  PP+V   +R   H N++++ G++CLNIL  E W
Sbjct: 66  TVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDFK-GNVCLNILR-EDW 122

Query: 99  SPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           SPA DL  ++  ++ L  +P P+ PL+ D A +L  QD   +   V
Sbjct: 123 SPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKEFAEAV 167

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 39  IRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHW 98
           I  P    Y+   F   L   D YP  PP+V   R  + H N++ + G +CLNIL  E W
Sbjct: 74  IISPDEGYYKNGHFRFSLEFNDNYPMEPPKVV-CRNRIYHPNIDVQ-GKVCLNILR-EDW 130

Query: 99  SPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149
           SPA DL  ++  ++ L  +P    PL+ D A +  ++D +A+   V   ++
Sbjct: 131 SPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVRKTME 180

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 17/154 (11%)

Query: 1   MARIA--REYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           M++ A  R +K +Q  L             + +L  W   I GP  +PY+G  F+  L  
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEF 60

Query: 59  GDRYPTTPPQVTFARRSMPHCNVNYETGSICLNI------------LTPEHWSPAWDLLH 106
              YP +PP++ F   S+ H N+ Y  G +C++I            L  E WSP   +  
Sbjct: 61  PKDYPLSPPKLLFT-PSILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           +L +++ +LS+P  +S  +ID A IL   +R  +
Sbjct: 119 ILLSVMSMLSEPNVESGANID-ACILWRDNRPEF 151

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + DL  W   I+GP  TPYE   F+ +L     YP +PP +TF    + H N+ Y  G +
Sbjct: 31  ENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDYPLSPPTLTFTPAIL-HPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RPEF 151

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 17/159 (10%)

Query: 1   MARIA--REYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58
           M++ A  R +K +Q  L             + +L  W   I GP  +PY+G  F+  L  
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPEGIVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNATLEF 60

Query: 59  GDRYPTTPPQVTFARRSMPHCNVNYETGSICLNI------------LTPEHWSPAWDLLH 106
              YP +PP++ F   S+ H N+ Y  G +C++I            L  E WSP   +  
Sbjct: 61  PKDYPLSPPKLLFT-PSILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVN 145
           +L +++ +LS+P  +S  +ID A IL    R  +   V 
Sbjct: 119 ILLSVMSMLSEPNVESGANID-ACILWRDSREEFEKQVK 156

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  +  +L  +  LL+ P PDSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 15/129 (11%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + ++  W   I+GP  TPY    F+ +L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAYYGLVN 145
           R  +   V 
Sbjct: 148 RPEFEKQVK 156

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   F + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + ++  W   I+GP  TPY    F+ +L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RPEF 151

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 15/129 (11%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + ++  W   I+GP  TPY    F+ +L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAYYGLVN 145
           R  +   V 
Sbjct: 148 RPEFEKQVK 156

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 58.5 bits (140), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 15/124 (12%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           + ++  W   I+GP  TPY    F+ +L     YP +PP++TF   S+ H N+ Y  G +
Sbjct: 31  ENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFT-PSILHPNI-YPNGEV 88

Query: 89  CLNI------------LTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           C++I            L  E WSP   +  +L +++ +LS+P  +S  +ID A IL   +
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-ACILWRDN 147

Query: 137 RSAY 140
           R  +
Sbjct: 148 RPEF 151

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 58.9 bits (141), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 8/100 (8%)

Query: 45  TPYEGH----TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
           +P EG+    + S  L   + YP  PP+VT  ++   H N++   G++CLNIL  E WSP
Sbjct: 68  SPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKKIF-HPNIDL-NGNVCLNILR-EDWSP 124

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAY 140
           A DL  ++  ++ L  +P P+ PL+ D A +   QD+  +
Sbjct: 125 ALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF-CQDQKKF 163

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.2 bits (139), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL +W   I G   T + G  + + +   + YP+ PP+V F      H NV Y +G+ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL+ P PDSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 57.0 bits (136), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   F + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 59

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   +  LL  P P+SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL RW   I G  GT +    + L +   D YP+ PP+V     +  H NV Y +G+ICL
Sbjct: 37  DLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLP-ANFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   I  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + L +   D YP+ PP+V F      H NV Y +G+ICL
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +L  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 4/98 (4%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+   F   +V  D YP  PP V F ++ + H N++   G ICLNIL  E WSP  DL  
Sbjct: 80  YKDGYFPFSMVFKDSYPIEPPVVKFLKK-IYHPNIDL-NGKICLNILR-EDWSPVLDLQS 136

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           ++  ++ L  +P P  PL++    +L+ +++  +  +V
Sbjct: 137 IIIGLMFLFLEPNPRDPLNLKAGELLK-ENKQEFIDIV 173

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           DL  W   I G  GT +    + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   F + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  +  +L  +  LL+ P P+SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y G  F   L   + YP  PP V   ++ + H N++   G ICLNIL  E WSPA D+  
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCLQK-IYHPNIDLN-GKICLNILR-EDWSPALDIQS 114

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANIL 132
           V+  ++ L  +P P  PL+ D A+ L
Sbjct: 115 VIVGLLFLFLEPNPRDPLNKDAASTL 140

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L RW   I G  GT +    + L +   D YP+ PP+V        H NV Y +G+ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   I  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 43  TGTPYEGH----TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHW 98
           T +P EG+    + +  L   + YP  PP+V   ++   H N++ + G++CLNIL  E W
Sbjct: 66  TVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKKIF-HPNIDLK-GNVCLNILR-EDW 122

Query: 99  SPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           SPA DL  ++  ++ L  +P P+ PL+ D A +   Q+   +  +V
Sbjct: 123 SPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEKKFAEIV 167

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 7/91 (7%)

Query: 46  PYEGH----TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPA 101
           P EG+    + +  L   + YP  PP+V   ++   H N++ + G++CLNIL  E WSPA
Sbjct: 70  PDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIF-HPNIDLK-GNVCLNILR-EDWSPA 126

Query: 102 WDLLHVLEAIIQLLSDPEPDSPLDIDLANIL 132
            DL  ++  ++ L  +P P+ PL+ D A +L
Sbjct: 127 LDLQSIITGLLFLFLEPNPNDPLNKDAAKLL 157

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 49  GHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVL 108
           GH F  +  + + YP  PP+V    + + H N+N  TG ICLNIL  E WSPA DL  V+
Sbjct: 89  GH-FRFQFTINENYPIEPPKVVCLTK-IYHPNIN-RTGEICLNILR-EDWSPALDLQSVI 144

Query: 109 EAIIQLLSDPEPDSPLDIDLANIL 132
             ++ L  +P P  PL+   A+ L
Sbjct: 145 IGLLFLFIEPNPKDPLNKQAADTL 168

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 41  GPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
            P   PY G  F   L   + YP  PP      +   H N++   G ICLNIL  E WSP
Sbjct: 76  SPREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIF-HPNIDL-NGKICLNILR-EDWSP 132

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           A DL  ++  ++ L  D     PL+   A +L A DR+ +  LV
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELV 175

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT ++   + + +   D YP+ PP+V F      H N+ Y +G++CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFP-AGFYHPNI-YPSGTVCL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 5/99 (5%)

Query: 28  IDG--DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYET 85
           +DG  +L  W   I G   T + G  + + +   D YP+ PP+V F      H N+ Y +
Sbjct: 32  VDGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFP-AGFYHPNI-YPS 89

Query: 86  GSICLNILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           G++CL+IL  +  W PA  L  ++  +  LL  P P+SP
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+G  F+ +L   D YP  PP V    + + H N++ + G +CLNIL  E WSPA D+  
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICTSK-LYHPNIDID-GKVCLNILR-EDWSPALDVQS 134

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVN 145
           ++  ++ LL +P    PL+ D A +L + D + +  LVN
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKDAAMML-STDTARFASLVN 172

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT +    + + +   + YP+ PP+V        H NV Y +G+ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLP-AGFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  E  W PA  L  +   I  LL  P P+SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 4/98 (4%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+G  F       + YP  PP+V      + H N++   G ICLNIL  E WSPA DL  
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNIDPH-GKICLNILR-EDWSPALDLQC 132

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLV 144
           ++  ++ L  +P  + PL+ + A +L  +D+  +  LV
Sbjct: 133 IVLGLLSLFQEPNGNDPLNKEAAEVLN-KDKLEFGNLV 169

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y G T+   + + D YP  PP V    R + H N++ + G++CLN+L  E W+PA D+  
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHR-IYHPNIDID-GNVCLNLLR-EDWTPALDIQS 128

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150
           ++  I+ L  +P    PL+ D A  L  +D   +   VN+ L+ 
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAAKTL-IEDPLRFENKVNHSLRG 171

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 31  DLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICL 90
           +L +W   I G  GT +    + + +   + YP+ PP+V     +  H NV Y +G+ICL
Sbjct: 37  NLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLP-ANFYHPNV-YPSGTICL 94

Query: 91  NILTPEH-WSPAWDLLHVLEAIIQLLSDPEPDSP 123
           +IL  +  W PA  L  +   I  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 7/94 (7%)

Query: 45  TPYEGH----TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
           TP EG+     F       D YP  PP+VT   +   H N++ + G++CLNIL  E WSP
Sbjct: 67  TPDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSKIF-HPNIDLQ-GNVCLNILR-EDWSP 123

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRA 134
             D+  +L  ++ L  +P    PL+   A++L A
Sbjct: 124 VLDVQSILIGLLMLFLEPNATDPLNKVAADVLAA 157

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 41  GPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
            P    Y+   F   L   + YP  PP +      + H N++ + G ICLNIL  E WSP
Sbjct: 75  SPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDWSP 131

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           A DL  ++  ++ L  +     PL+ + ANIL + +
Sbjct: 132 ALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 41  GPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSP 100
            P    Y+   F   L   + YP  PP +      + H N++ + G ICLNIL  E WSP
Sbjct: 76  SPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDWSP 132

Query: 101 AWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQD 136
           A DL  ++  ++ L  +     PL+ + ANIL + +
Sbjct: 133 ALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 48  EGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHV 107
           +GH F+  +   ++YP  PPQV    +   H N++ + G ICLNIL  E WSPA DL  V
Sbjct: 77  KGH-FTFEMTFTEKYPIEPPQVRCMNQIF-HPNIDLQ-GKICLNILR-EDWSPALDLQSV 132

Query: 108 LEAIIQLLSDPEPDSPLDIDLANIL 132
           +  I+ L  +     PL+   A++L
Sbjct: 133 IIGILFLFLEVSGRDPLNKQAASLL 157

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   D +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 29  DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
           D  +++W G I GP  + +E   +SL +  G  YP +PP+VTF  +    C VN  TG I
Sbjct: 35  DITMTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEI 93

Query: 89  CLNILTPEHWSPAWDLLHVLEAIIQLLSDP 118
             +  T   W  A+ +  +L  + + ++ P
Sbjct: 94  QTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 13/99 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   D +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRA 134
           E WSP   +  VL +I+ LL DP   SP ++D A   R 
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRK 151

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   D +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   D +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 32  LSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLN 91
           +++W G I GP  + +E   +SL +  G  YP +PP VTF  +    C V+  TG +  N
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTN 59

Query: 92  ILTPEHWSPAWDLLHVLEAIIQLLSDP 118
             T   W  A+ +  +L  + + ++ P
Sbjct: 60  FHTLRDWKRAYTMETLLLDLRKEMATP 86

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+G  F+  L+  ++YP  PP+V    R + H N++ + G +CLNIL  + W+PA DL  
Sbjct: 66  YKGGNFTFELLFNEQYPMEPPKVKCLNR-IYHPNIDTD-GRVCLNILR-QDWTPALDLQS 122

Query: 107 VLEAIIQLLSDPEPDSPLDIDLA 129
           V+  ++ L  +     PL+   A
Sbjct: 123 VIIGLLFLFLEISGVDPLNKQAA 145

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP  +SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP  +SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 47.4 bits (111), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 1/116 (0%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +   G            D  +++W G I GP  + +E   +SL +  G  Y
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDP 118
           P +PP+VTF  +    C VN  TG +  +  T   W  A+ +  +L  + + ++ P
Sbjct: 69  PDSPPKVTFISKINLPC-VNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP  +SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 46.6 bits (109), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 32  LSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLN 91
           +++W G I GP  + +E   +SL +  G  YP +PP+VTF  +    C VN  TG +  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 92  ILTPEHWSPAWDLLHVLEAIIQLLSDP 118
             T   W  A+ +  +L  + + ++ P
Sbjct: 60  FHTLRGWKRAYTMETLLLDLRKEMATP 86

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP  +SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+   F   L   D YP  PP V    + + H N++ + G++CLNIL  E WSP  DL  
Sbjct: 73  YKPGYFRFSLFFKDTYPIEPPAVKCVNK-IYHPNIDTQ-GNVCLNILR-EDWSPVLDLQS 129

Query: 107 VLEAIIQLLSDPEPDSPLD 125
           V+  ++ L  +P    PL+
Sbjct: 130 VVIGLLFLFLEPNDKDPLN 148

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y G  F   +V  D YP  PP V     ++ H N++Y +G+ICLN+L  E WSP  DL  
Sbjct: 88  YRGGHFRFSVVFRDTYPIEPPTVK-CLNTIYHPNIDY-SGNICLNVLR-EDWSPVMDLQT 144

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANIL 132
           V+  ++ L  +P    PL+   A+ +
Sbjct: 145 VVLGLLFLFLEPNGSDPLNRQAADTM 170

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 2   ARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDR 61
            R+++EYK I               P D ++  W   I GP  TPYEG  +   L     
Sbjct: 8   KRLSKEYKMIMEN----TPPYIIAVPNDENILEWHYVITGPPDTPYEGGQYHGTLHFPPE 63

Query: 62  YPTTPPQVTFARRSMPHCNVNYETGSICLNI--LTPEHWSPAWDLLHVLEAIIQLLSDPE 119
           YP  PP +   R S P+      T  +CL++    P+ W+P+W +  +L  ++  ++  E
Sbjct: 64  YPFKPPAI---RISTPNGRFKQHT-RLCLSMSDYHPDTWNPSWSVATILNGLLSFMTGDE 119

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (42%), Gaps = 2/117 (1%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +   G            D  +++W G I GP  + +E   +SL +V GDRY
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLEIVCGDRY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNIL-TPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP V F  +    C V+  TG +      T   W  ++ +  VL  + + +  P
Sbjct: 69  PDEPPLVKFISKVNLPC-VDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDLRKEMGTP 124

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   D +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PPQ  F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLH 106
           Y+   F   +   D YP  PP V     ++ H N++Y  G+ICLN+L  E W+P  DL  
Sbjct: 155 YKHGHFGFSVSFKDSYPIDPPIVK-CLTTIYHPNIDYN-GNICLNVLR-EDWTPVLDLQT 211

Query: 107 VLEAIIQLLSDPEPDSPLDIDLANIL 132
           ++  ++ L  +P P  PL+   A+ +
Sbjct: 212 IVIGLLFLFLEPNPKDPLNKHAAHTM 237

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 10/119 (8%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ +EYK+I               P + ++  W   I GP  TPYE   +   L     Y
Sbjct: 9   RLTKEYKNIVNN----PPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDY 64

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
           P  PP +   R   P+     E   +CL++    PE W+PAW ++ +L  ++  ++  E
Sbjct: 65  PFNPPAI---RMITPNGRFK-ENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMTGDE 119

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 19/97 (19%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMP---HCNVNYETGSICLNIL---------- 93
           Y G  F  ++     +P +PPQ  F    +P   H NV Y  G +C++IL          
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKF----IPPIYHPNV-YRDGKLCISILHQSGDAMTSE 116

Query: 94  -TPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
              E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 117 PDNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPYEG  +   LV    YP  PP +   R   P      +T 
Sbjct: 29  PNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAI---RMVTPSGRFKEDT- 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P+W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTSDE 119

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F  ++   + +P +PP   F   ++ H NV Y  G +C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +I+ LL DP   SP ++D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G  F   +     +P +PP   F    + H NV Y+ G +C++IL             
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDN 113

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +II LL DP   SP ++D +
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 2/117 (1%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  LG            D  ++RW G I GP  + +E   +S+ +  G +Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIECGPKY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNIL-TPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP +TF  +    C V+  TG +      T + W   +++  +L  + + ++ P
Sbjct: 69  PDEPPTITFISKINLPC-VDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKEMASP 124

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 2/117 (1%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  LG            D  +++W G I GP  + +E   +S+ +  G  Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECGPSY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNIL-TPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP+V F  +    C VN  TG +      T + W  ++ +  VL  + + ++ P
Sbjct: 69  PDEPPKVKFVSKINLPC-VNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRKEMATP 124

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 10/119 (8%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ +EYK +  T            P + ++  W   I GP  TPY+G  +   L     Y
Sbjct: 9   RLTKEYKMMVET----PPPYITARPNESNILEWHYIIIGPQDTPYDGGQYHGTLTFPSDY 64

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
           P  PP +   R   P+     E   +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 65  PYKPPAI---RMITPNGRFK-ENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTGNE 119

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+++EYK     +           P + ++  W   I GP  TPYE   +   LV  + Y
Sbjct: 9   RLSKEYK----MMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDY 64

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNI--LTPEHWSPAWDLLHVLEAIIQLLSDPE 119
           P  PP +   R   P+     E   +CL++    P+ W+P+W +  +L  ++  ++  E
Sbjct: 65  PFNPPAI---RMLTPNGRFR-ENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTTDE 119

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPYEG  +   L     YP  PP +   R   P+     E  
Sbjct: 29  PNEDNILEWHYVITGPPETPYEGGQYHGTLTFPSDYPYKPPAI---RMVTPNGRFK-ENT 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDLWNPGWSVSTILTGLLSFMTGDE 119

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+G  +   L     YP  PP +   R   P+     E  
Sbjct: 29  PNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAI---RMITPNGRFK-ENT 84

Query: 87  SICLNI--LTPEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVATILNGLLSFMTGDE 119

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+G  +   L   + YP  PP +   R   P+     E  
Sbjct: 29  PNEDNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYPYKPPAI---RMITPNGRFK-ENT 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTGNE 119

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (41%), Gaps = 4/110 (3%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  LG            D  ++ W G I GP  + +E   +S+ +  GD Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLANGEDITMTTWNGTILGPPHSNHENRIYSVVIKCGDEY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112
           P  PP V F  +    C V+  TG +  N+    H    W   + +E ++
Sbjct: 69  PDKPPTVKFISKINLPC-VDQATGEVETNMF---HTLRDWKRSYTMETLL 114

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+++EYK    ++           P + ++  W   I GP  TPY G  +   LV    Y
Sbjct: 9   RLSKEYK----SMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDY 64

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
           P  PP +   R   P      +T  +CL++    P+ W+P+W +  +L  ++  ++  E
Sbjct: 65  PFKPPAI---RMVTPSGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTSEE 119

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 29 DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
          D  ++ W G I GP  + +E   +SL +V G  YP  PP+V F  +    C ++ +TG I
Sbjct: 35 DITMTNWNGTILGPPHSNHENRIYSLEIVCGPNYPDEPPKVKFVSKVNLPC-IDDKTGEI 93

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 42.7 bits (99), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP GTPYE   +   L     YP  PP +   R   P      E  
Sbjct: 29  PNESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAI---RMVTPSGRFQ-ENT 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P  W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPTTWNPGWSVSTILNGLLSFMTSEE 119

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+G  +   L     YP  PP +   R   P+      T 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAI---RMVTPNGRFKPNT- 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSDE 119

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 47  YEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNIL-----------TP 95
           Y G   +  L     +P +PP   F    + H NV +  GS+C++IL             
Sbjct: 56  YHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDS 113

Query: 96  EHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLA 129
           E WSP   +  VL +II LL DP   SP ++D A
Sbjct: 114 ETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+G  +   L     YP  PP +   R   P+      T 
Sbjct: 29  PNEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAI---RMVTPNGRFKPNT- 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSDE 119

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+G  +   L     YP  PP +   R   P+      T 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAI---RMITPNGRFKPNT- 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSDE 119

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 51/117 (43%), Gaps = 2/117 (1%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  LG            D  ++ W G I GP  + +E   +S+ +  G  Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECGPNY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNIL-TPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP++ F  +    C V+  TG +  ++  T   W  A+ +  +L  + + ++ P
Sbjct: 69  PDEPPKIKFVSKVNVPC-VDSTTGEVKSSVFHTLRDWKRAYTMETLLLDLRKEMATP 124

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 2/117 (1%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  LG            D  ++ W G I GP  + +E   +SL +  G  Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECGPNY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNIL-TPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP + F  +    C V+ +TG +  +   T   W  A+++  +L  + + ++ P
Sbjct: 69  PDHPPTIKFISKINLPC-VDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMATP 124

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa]
          {ON} YGL087C (MMS2) - Similar to ubiquitin conjugating
          protein family [contig 30] FULL
          Length = 101

 Score = 39.3 bits (90), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 32 LSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSI 88
          ++ W G I GP  + +E   +S+ L  G+ YP  PP++ F  +    C VN  TG +
Sbjct: 1  MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEV 56

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY G  +   L     YP  PP +   R   P+     E  
Sbjct: 29  PNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAI---RMITPNGRFK-ENT 84

Query: 87  SICLNI--LTPEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDLWNPGWSVATILNGLLSFMTGDE 119

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 10/119 (8%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+ +EYK I               P + ++  W   I GP  TPY    +   LV    Y
Sbjct: 9   RLTKEYKAIIEN----PPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADY 64

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
           P  PP +   R   P+     E   +C+ +    P+ W+PAW +  +L  ++  ++  E
Sbjct: 65  PFKPPAI---RMITPNGRFK-ENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTGDE 119

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 10/121 (8%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
           + R+ +EYK I               P + ++  W   I GP+ TPY    +   L    
Sbjct: 7   LKRLTKEYKLIVEN----PPPYIVARPNEDNILEWHYVITGPSDTPYSSGQYHGTLTFPS 62

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILT--PEHWSPAWDLLHVLEAIIQLLSDP 118
            YP  PP +   R   P+     E   +CL++    P+ W+P W +  +L  ++  ++  
Sbjct: 63  DYPYKPPAI---RMITPNGRFK-ENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFMTGD 118

Query: 119 E 119
           E
Sbjct: 119 E 119

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 39.7 bits (91), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 27  PIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETG 86
           P + ++  W   I GP  TPY+   +   L     YP  PP +   R   P+      T 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAI---RMITPNGRFKPNT- 84

Query: 87  SICLNILT--PEHWSPAWDLLHVLEAIIQLLSDPE 119
            +CL++    P+ W+P W +  +L  ++  ++  E
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSDE 119

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/116 (20%), Positives = 50/116 (43%), Gaps = 1/116 (0%)

Query: 3   RIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDRY 62
           R+  E +  +  +G            D  ++ W G I GP  + +    +SL +  G  Y
Sbjct: 9   RLLEELEKGEKGMGPESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIECGPSY 68

Query: 63  PTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDP 118
           P  PP + F  +   +C V+  TG +  +    ++W  ++ +  +L  + + ++ P
Sbjct: 69  PDEPPTLKFISKINLNC-VDSATGVVKPDFNPIKNWKRSYTMETILLELRKEMAHP 123

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 10/121 (8%)

Query: 1   MARIAREYKHIQATLGXXXXXXXXXXPIDGDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60
             R+ +EYK    TL           P + ++  W   I GP  +PY    +   L    
Sbjct: 7   FKRLTKEYK----TLTETPPPYILARPNEDNILEWHYIITGPPDSPYSEGQYHGTLTFPT 62

Query: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNI--LTPEHWSPAWDLLHVLEAIIQLLSDP 118
            YP  PP +   R   P+     E   +CL++    P+ W+P+W +  +L  ++  ++  
Sbjct: 63  DYPYKPPAI---RMITPNGRFK-ENTRLCLSMSDYHPDLWNPSWSVSTILTGLLSFMTGD 118

Query: 119 E 119
           E
Sbjct: 119 E 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,512,291
Number of extensions: 601748
Number of successful extensions: 1609
Number of sequences better than 10.0: 268
Number of HSP's gapped: 1334
Number of HSP's successfully gapped: 268
Length of query: 150
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 50
Effective length of database: 42,014,799
Effective search space: 2100739950
Effective search space used: 2100739950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)