Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056203.494ON27927914560.0
SAKL0F02728g3.494ON28228012361e-173
KLTH0F14872g3.494ON28027812341e-173
Smik_6.2283.494ON28728112291e-172
NCAS0E007903.494ON32727912291e-171
Suva_7.4203.494ON28728112181e-170
CAGL0I10472g3.494ON28828512131e-169
Kpol_1017.53.494ON28328112111e-169
TPHA0D032903.494ON28528112101e-169
ZYRO0D09900g3.494ON28327812041e-168
YGR132C (PHB1)3.494ON28728111991e-167
TBLA0D029503.494ON28227611941e-166
NDAI0G009203.494ON29627711901e-166
Skud_7.4433.494ON28726111861e-165
Kwal_55.212403.494ON28326511851e-165
KAFR0C019803.494ON28327911771e-164
KNAG0B007903.494ON28428211421e-158
Ecym_12353.494ON28328111281e-156
AFR313C3.494ON28328110761e-149
KLLA0D16302g3.494ON2262149741e-134
ADL141W5.98ON3072397542e-99
TBLA0H022205.98ON3072397421e-97
Kwal_27.127475.98ON3072397393e-97
YGR231C (PHB2)5.98ON3102427378e-97
SAKL0G15510g5.98ON3082427361e-96
Smik_16.755.98ON3102427352e-96
KAFR0B042505.98ON3102567342e-96
KNAG0A015805.98ON2882537272e-95
Suva_7.5235.98ON3102427292e-95
KLTH0C01672g5.98ON3072397282e-95
Kpol_1050.615.98ON3102537282e-95
CAGL0L06490g5.98ON3132397264e-95
TPHA0A050905.98ON3102397231e-94
NCAS0F006005.98ON3132537222e-94
Skud_7.5655.98ON3102427212e-94
NDAI0D025305.98ON3162537204e-94
TDEL0G012105.98ON3092397185e-94
ZYRO0B15136g5.98ON3102397161e-93
KLLA0E15731g5.98ON3082397125e-93
NCAS0J007904.164ON77248693.1
KLTH0F18546g7.518ON277779684.9
TPHA0I013002.117ON37950675.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05620
         (279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   565   0.0  
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   480   e-173
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   479   e-173
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   478   e-172
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     478   e-171
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   473   e-170
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   471   e-169
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   471   e-169
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   470   e-169
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   468   e-168
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   466   e-167
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   464   e-166
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     462   e-166
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   461   e-165
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   461   e-165
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   457   e-164
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   444   e-158
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   439   e-156
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   419   e-149
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   379   e-134
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   295   2e-99
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   290   1e-97
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   289   3e-97
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   288   8e-97
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   288   1e-96
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   287   2e-96
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   287   2e-96
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   284   2e-95
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   285   2e-95
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   285   2e-95
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   285   2e-95
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   284   4e-95
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   283   1e-94
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   282   2e-94
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   282   2e-94
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   281   4e-94
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   281   5e-94
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   280   1e-93
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   278   5e-93
NCAS0J00790 Chr10 (129988..132306) [2319 bp, 772 aa] {ON} Anc_4....    31   3.1  
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    31   4.9  
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    30   5.5  

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/279 (100%), Positives = 279/279 (100%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNIR 279
           EASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNIR
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNIR 279

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  480 bits (1236), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/280 (83%), Positives = 259/280 (92%), Gaps = 2/280 (0%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MS+L ++LAR+A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQ+QV+GEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           Q+AIVYD+RTKPK IATNTGTKD+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQRIR ELS RA+EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVE+AEQ R+A+VIRAEGEAESA+YISKAL++AGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIAQTLAASSNITYLPGKAHGNTE--GSQNSLLLNI 278
           EASKEIAQTLA SSN+TYLP    G  E  GS NSLLLN+
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNL 280

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  479 bits (1234), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/278 (83%), Positives = 257/278 (92%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MSRL ++LA++A+PLG+  S +QYSMYDV+GGSRAVIFDRLSGVQ+QVVGEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKA++YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR ELS RASEF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVEQKQIAQQDAERA+++VE AEQ R+ASVIRAEGEAESAEYISKALA+AGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNI 278
           EASKEIA+TLA SSN+TYLP     + +GS NSLLLN+
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNL 278

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  478 bits (1229), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/281 (81%), Positives = 260/281 (92%), Gaps = 4/281 (1%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           SRL++ + +VA+P+GIV SG+QYSMYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAI+YD+RTKPK IATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLAASSNITYLPGKAHGN----TEGSQNSLLLNI 278
           ASK+IAQTLA SSN+ YLP +  GN    + GS NSLLLNI
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNI 285

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/279 (82%), Positives = 258/279 (92%), Gaps = 2/279 (0%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           ++L+  + RVA+PLGI+ +G++YSMYDV+GGSR VIFDRLSGVQK+V+GEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KA++YD+RTKPK IATNTGTKD+QMVSLTLRVLHRP++ +LP+IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE+VSQRI+ ELS RA EFGIRLEDVSITHMTFGPEFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAEYISKALA+ GDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIAQTLAASSNITYLPGK--AHGNTEGSQNSLLLNI 278
           ASK+IAQTLA S NITYLPG+    GN  GS NSLLLNI
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNI 325

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  473 bits (1218), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 260/281 (92%), Gaps = 4/281 (1%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           SR ++ + +VA+P+G+V SG+QYSMYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAI+YD+RTKPK IATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKF+VEKAEQ R+ASVIRAEGEAESAEYISKALA+ GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLAASSNITYLPGK--AHGNTE--GSQNSLLLNI 278
           ASK+IAQTLA SSN+ YLP +    GN+E  GS NSLLLNI
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNI 285

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  471 bits (1213), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/285 (81%), Positives = 256/285 (89%), Gaps = 7/285 (2%)

Query: 1   MSRLVENLAR----VAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFL 56
           MS+   N  R    VAIP+GI VSG+QYSMYDV+GGSR VIFDRL GV+  VVGEGTHFL
Sbjct: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60

Query: 57  VPWLQKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDER 116
           VPWLQKAI+YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP IYQNLGLDYDER
Sbjct: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120

Query: 117 VLPSIGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGP 176
           VLPSIGNEVLK+IVAQFDAAELITQRE+VSQ+IR ELS+RA+EFGIRLEDVSITHMTFGP
Sbjct: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180

Query: 177 EFTKAVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLL 236
           EFTKAVEQKQIAQQDAERA+FLVEKAEQ R+ASVIRAEGEAESAEYISKAL++ GDGLLL
Sbjct: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240

Query: 237 IRRLEASKEIAQTLAASSNITYLPGKAHG---NTEGSQNSLLLNI 278
           IRRLEASKEIAQTLA S+NITYLP    G   + +GS N+LLLN+
Sbjct: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNL 285

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  471 bits (1211), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/281 (80%), Positives = 259/281 (92%), Gaps = 3/281 (1%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MS++++ +A+VA+P+GIVVSG+Q+SMYDV+GGSRAVIFDR+SGV++ ++GEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKAI+YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIR EL  R++EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVEKAEQ R+A+VIRAEGEAESAEYISKAL +AGDGLLLIRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIAQTLAASSNITYLP---GKAHGNTEGSQNSLLLNI 278
           EASKEIA TL+ SSN+TYLP   G A G ++G+ N+LLLN+
Sbjct: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNL 281

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  470 bits (1210), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/281 (80%), Positives = 261/281 (92%), Gaps = 4/281 (1%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           +++++ L ++A+PLGI VSG+QY+MYDV+GGSRAVIFDRLSGV++QV+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAIV+D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV QLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLKAIVAQFDAAELITQRE+VS +IR+ELS R++EFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQ R+A+VIRAEGEAESAEYISKALA+AGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAQTLAASSNITYLP--GKAHGNTE--GSQNSLLLNI 278
           ASKEIA+TL+ SSN+TYLP    ++GN E  G+ NSLLLN+
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNL 283

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  468 bits (1204), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/278 (85%), Positives = 258/278 (92%), Gaps = 1/278 (0%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           SRL E +A+VAIPLGIV SG+QYSMYDVRGGSRAVIFDRLSGVQ++VVGEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KA++YD+RTKPK IATNTGTKDMQMVSLTLRVLHRP VLQLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLKAIVA++DAAELITQRELVS  IRDELS+RASEF IRLEDVSITHMTFGPEFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQ+RK SVIRAEGEAE+AE ISKALA+AGDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAQTLAASSNITYLPG-KAHGNTEGSQNSLLLNI 278
           ASK+IAQTLA SSN+TYLP  ++ G  EG+  SLLLN+
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGGQEGTSQSLLLNL 280

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  466 bits (1199), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/281 (80%), Positives = 259/281 (92%), Gaps = 4/281 (1%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           ++L++ + +VA+P+GI+ SG+QYSMYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAI+YD+RTKPK IATNTGTKD+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLAASSNITYLPGK----AHGNTEGSQNSLLLNI 278
           ASK+IAQTLA SSN+ YLP +     +  + GS NSLLLNI
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNI 285

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  464 bits (1194), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/276 (79%), Positives = 253/276 (91%)

Query: 3   RLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQK 62
           ++ E LA++AIPLG+ VS + YSMYDV+GGSRAVIFDR+ GV++ VVGEGTHFLVPWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  AIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIG 122
           ++++DIRTKPK I TNTGT+D+QMVSLTLR+LHRPD++QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAV 182
           NEVLK+IVAQFDAAELITQRE+VSQRIR EL+HRA+EFGIRLEDVSITHMTFGPEFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 EQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEA 242
           EQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE IS+AL +AGDGLLLIRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 243 SKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNI 278
           SKEIA+TLA S ++TYLPG  +   + S+NSLLLN+
Sbjct: 245 SKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNL 280

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/277 (80%), Positives = 252/277 (90%), Gaps = 6/277 (2%)

Query: 8   LARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYD 67
           L +VA+P+G++V+GV YSMYDV+GGSR VIFDRLSGV+  VVGEGTHFLVPWLQKA++YD
Sbjct: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77

Query: 68  IRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLK 127
           +RTKPK IATNTGTKD+QMVSLTLRVLHRP+V +LP+IYQNLGLDYDE+VLPSIGNEVLK
Sbjct: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137

Query: 128 AIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQI 187
           +IVAQFDAAELITQRE+VSQRI+ ELS RA+EFG+RLEDVSITHMTFGPEFTKAVEQKQI
Sbjct: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197

Query: 188 AQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIA 247
           AQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLEASK+IA
Sbjct: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257

Query: 248 QTLAASSNITYLPGKAHGNTEG------SQNSLLLNI 278
           QTLA S N+TYLPG+   +  G      S NSLLLNI
Sbjct: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNI 294

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  461 bits (1186), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 216/261 (82%), Positives = 248/261 (95%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           SRL++ + +VA+P+GI+ +G+QY+MYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAI+YD+RTKPK IATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLAASSNITYLPGK 262
           ASK+IAQTLA SSN+ YLP +
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQ 265

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/265 (83%), Positives = 246/265 (92%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MSR  ++LA++A+PLG+  S +QYSMYDV+GGSRAVIFDRLSGVQ+QVVGEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKA+++D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR ELS RASEF IRLEDVSITHMTFG +FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVEQKQIAQQDAERA+F+VE AEQ R+ASVIRAEGEAESAEYISKALA+AGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAQTLAASSNITYLPGKAHG 265
           EASKEIA+TLA SSN+TYLP    G
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQG 265

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  457 bits (1177), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/279 (78%), Positives = 254/279 (91%), Gaps = 2/279 (0%)

Query: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61
           +R +  + ++AIP G++++ V YSMYDV+GGSR VIFDR+SGV+K V+GEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121
           KAI+YD+RTKPK I+TNTGTKD+QMVSLTLR+LHRP+V++LPRIYQNLGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181
           GNEVLK+IVAQFDAAELITQRE+VSQRIR E+SHRA+EFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241
           VEQKQIAQQDAERA+FLVEKAEQ R+ASVIRAEGEAESAE ISKAL+R GDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKEIAQTLAASSNITYLPGKA--HGNTEGSQNSLLLNI 278
           ASK+IA+TL+ SSNITYLPG     G+ +   NSLLLNI
Sbjct: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNI 281

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  444 bits (1142), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 225/282 (79%), Positives = 256/282 (90%), Gaps = 4/282 (1%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MS+ +  L+++AIP G+++    Y+MYDV+GGSR VIFDR+SGVQ++VVGEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKAI+YD+R+KPK IATNTGTKD+QMVSLTLRVLHRP+V++LPRIYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR ELS RA EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVEKAEQ+R+ASVIRAEGEAESAE ISKALA+ GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIAQTLAASSNITYLP----GKAHGNTEGSQNSLLLNI 278
           EASKEIA+TL+ SSN+TYLP    G  HG  +GS N+LLLNI
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNI 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  439 bits (1128), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 249/281 (88%), Gaps = 3/281 (1%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MSR +EN+A +A+P+G+ +   Q  +YDVRGG+RAVIFDRLSGVQ++VVGEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QKA++YD+RTKPK IATNTGTKD+Q+V+LTLRVLHRPDV+ LP+IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLKAIVAQFDAAELITQRELVSQ+IR EL+ RA  F I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQ R A+VIRAEG+AE+AEYISKAL +AGDGLL+IRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIAQTLAASSNITYLPGKAHGNTE---GSQNSLLLNI 278
           EASK+IAQTLA SSNITYLP  + G +    G+ +SLLLN+
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNL 281

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  419 bits (1076), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 210/281 (74%), Positives = 248/281 (88%), Gaps = 3/281 (1%)

Query: 1   MSRLVENLARVAIPL---GIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLV 57
           MSRL ++L R+ +PL    +  S VQ+SMYDVRGG+RA+IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERV 117
           PWLQKAI++D+RTKP+ IATNTGTKD+QMVSLTLRVLHRPDV+ L RIY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPE 177
           LPSIGNEVLKAIVAQF+A+ELITQRELVSQ+IR+EL+ RASEF IRLEDVSITHMTFG E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLI 237
           FTKAVEQKQIAQQ+++RAKF+VE+AEQ R+A+VIRAEGEAE+AE+ISKAL +AGDGLL+I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRLEASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNI 278
           RRLEASK IA+TLA S N+TYLP K      G+ NSLLLN+
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNL 281

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  379 bits (974), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/214 (83%), Positives = 200/214 (93%)

Query: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60
           MSR+ + +AR+AIP+G+ VS +QYSMYDVRGG RAVIFDRL GVQ+ V+GEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120
           QK+I++D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP+IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQRIR ELS RA EF I+LEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAE 214
           AVEQKQIAQQDAERA+FLVEKAEQ RKA+VIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  295 bits (754), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 140/239 (58%), Positives = 190/239 (79%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           S+++V GG RA+++ RLSGVQ+ V GEGTHF++PWL+  ++YD+R+KP+ +++ TGT D+
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IRD L  RAS F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            +++ +++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  LAAS N   L  +A
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPNRVILDNEA 294

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  290 bits (742), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 187/239 (78%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           S+++V GG RA+++ RLSGV  ++  EGTHF++PWLQ  I+YD+R KP+ +A+ TGTKD+
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ SK+IA+ LA SSN   L  +A
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSNRLVLDNEA 292

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  289 bits (739), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 189/239 (79%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           S+++V GG RA+++ RL+GVQ ++  EGTHF +PWL+  IVYD+R KP+ +A+ TGTKD+
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPDV QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RAS+F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  L++S N   L  +A
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVILDNEA 294

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  288 bits (737), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 189/242 (78%), Gaps = 1/242 (0%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           +  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YD+R KP+ +A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RAS+F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V+RA+GEA+SAE I +A+ ++ D + L +RL+ +++IA+ LA+S N   L  
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

Query: 262 KA 263
           +A
Sbjct: 293 EA 294

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  288 bits (736), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 190/242 (78%), Gaps = 1/242 (0%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           V  ++++V GG RA+++ R+ G+Q+++  EGTHF VPWL+  IVYD+R KP+ +A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RAS+F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA+ L+ S N   L  
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPNRVILDN 293

Query: 262 KA 263
           +A
Sbjct: 294 EA 295

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 189/242 (78%), Gaps = 1/242 (0%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           +  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   IVYD+R KP+ +A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RAS+F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ +++IA+ LA+S N   L  
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

Query: 262 KA 263
           +A
Sbjct: 293 EA 294

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (734), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 143/256 (55%), Positives = 194/256 (75%), Gaps = 11/256 (4%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           +Q S+++V GG RA+++ R++GV  ++  EGTHF++PWL+  IVYD+R KP+ +A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RAS+F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA+ LA S N   L  
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDN 291

Query: 262 KAHGNTEGSQNSLLLN 277
           +          SLLLN
Sbjct: 292 E----------SLLLN 297

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  284 bits (727), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 189/253 (74%), Gaps = 11/253 (4%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  IVYD+R KP+ +A+ TGTKD+
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPDV QLP +Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RAS F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKAH 264
            ++  V++A GEA+SAE I +A+ ++ D + L +RL+ +KEIA  LAAS N   L     
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVL----- 268

Query: 265 GNTEGSQNSLLLN 277
                   SLLLN
Sbjct: 269 -----DNESLLLN 276

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  285 bits (729), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 187/242 (77%), Gaps = 1/242 (0%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           V  ++++V GG RA+++ RL+GV  ++  EGTHF+ PW+   I+YD+R KP+ +A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RAS F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ +++IA+ LA S N   L  
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVLDN 292

Query: 262 KA 263
           +A
Sbjct: 293 EA 294

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  285 bits (728), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 187/239 (78%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           S+++V GG RA+I+ RL+GVQ ++  EGTHF +PW +  IVYD+R KP+ +A+ TGTKD+
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RAS+F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  L+ S N   L  +A
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPNRVILDNEA 294

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  285 bits (728), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 191/253 (75%), Gaps = 11/253 (4%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  +VYD+R KP+ +A+ TGTKD+
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L +RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKAH 264
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  LA S N   L  +  
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDNE-- 296

Query: 265 GNTEGSQNSLLLN 277
                   SLLLN
Sbjct: 297 --------SLLLN 301

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  284 bits (726), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 187/239 (78%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV +++  EGTH ++PW++  IVYD+R KP+ +A+ TGTKD+
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IRD L  RAS F I L+DVSIT+MTF PEFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I  A+ ++ D + L +RL+ +K+IA+ LA S N   L  +A
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSPNRVVLDNEA 296

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  283 bits (723), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 133/239 (55%), Positives = 186/239 (77%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PW++  ++YD+R KP+ +A+ TGTKD+
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IRD L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ +K+IA  LA S N   L  +A
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPNRVVLDNEA 295

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  282 bits (722), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 189/253 (74%), Gaps = 11/253 (4%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           S+++V GG RA+++ R+SGV  ++  EGTHF++PW++  I+YD+R KP+ +A+ TGTKD+
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  R+S F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKAH 264
            ++  V+RA+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  LA S N   L  +  
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDNE-- 295

Query: 265 GNTEGSQNSLLLN 277
                   SLLLN
Sbjct: 296 --------SLLLN 300

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  282 bits (721), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 186/242 (76%), Gaps = 1/242 (0%)

Query: 22  VQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGT 81
           V  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YD+R KP+ +A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KD+QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 142 RELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPG 261
           A Q ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ +++IA+ LA S N   L  
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPNRVILDN 292

Query: 262 KA 263
           +A
Sbjct: 293 EA 294

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  281 bits (720), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 188/253 (74%), Gaps = 11/253 (4%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+SGV  ++  EGTHF +PW++  I+YD+R KP+ +A+ TGTKD+
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RA+ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKAH 264
            ++  V+RA+GEA+SAE I  A+ ++ D + L +RL+ ++EIA+ LA S N   L     
Sbjct: 242 EKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVL----- 295

Query: 265 GNTEGSQNSLLLN 277
                   SLLLN
Sbjct: 296 -----DNESLLLN 303

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  281 bits (718), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 185/239 (77%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV  ++  EGTH ++PWL+  +VYD+R KP+ +A+ TGTKD+
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V QLP IY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RAS F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIAQ LA S N   L  +A
Sbjct: 239 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPNRVILDNEA 296

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  280 bits (716), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 186/239 (77%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R+ GV  ++  EGTH L+PW +  +VYD+R KP+ +A+ TGTKD+
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RPDV QLP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RAS F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  V++A+G+A+SAE I +A+ ++ D + L +RL+ ++EIAQ L+ S N   L  +A
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPNRVVLDNEA 297

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  278 bits (712), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 129/239 (53%), Positives = 187/239 (78%), Gaps = 1/239 (0%)

Query: 25  SMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPKGIATNTGTKDM 84
           ++++V GG RA+++ R++GVQ ++  EGTHF++PW++  +VYD+R KP+ +++ TGTKD+
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREL 144
           QMV++T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR+ L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 VRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAASSNITYLPGKA 263
            ++  +++A+GEA+SAE I +A+ ++ D + L +RL+ ++EIA  L+ S N   L  +A
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVILDNEA 295

>NCAS0J00790 Chr10 (129988..132306) [2319 bp, 772 aa] {ON} Anc_4.164
          Length = 772

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 198 LVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKE 245
           L EKAE + KA V+ A+G+     Y+ K  ++A DG LL++ +E +K+
Sbjct: 726 LSEKAENLVKAPVVEADGKL--VTYVVKFKSQA-DGRLLVKSIEDAKK 770

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 162 IRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAE 221
           I+L DVSI++     + TK++E     Q+ AER++    ++ +    + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 222 YISKALARAGDGLLLIRRL 240
           YI   L +A D + +  R 
Sbjct: 252 YIKSLLLKASDFVTMFDRF 270

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 80  GTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAI 129
           G +   +  +  + L R D+   P +Y++L L+    VLP  GN +LK +
Sbjct: 274 GCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,946,829
Number of extensions: 876231
Number of successful extensions: 2667
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2732
Number of HSP's successfully gapped: 49
Length of query: 279
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 171
Effective length of database: 41,097,471
Effective search space: 7027667541
Effective search space used: 7027667541
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)