Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056103.493ON1751756043e-80
ZYRO0D09966g3.493ON1781784056e-50
CAGL0L08448g3.493ON1731754039e-50
Smik_16.4023.493ON1731753976e-49
Skud_16.4443.493ON1731753933e-48
YPR149W (NCE102)3.493ON1731753872e-47
Kpol_1017.63.493ON1871873832e-46
SAKL0F02750g3.493ON1701753769e-46
Suva_16.4783.493ON1661753742e-45
TPHA0D032803.493ON1841843743e-45
CAGL0I10494g3.493ON1721763663e-44
KNAG0B008003.493ON1821823604e-43
KAFR0C019703.493ON1791793596e-43
KNAG0A079503.493ON1821513561e-42
NDAI0G009303.493ON1761763534e-42
NDAI0B058803.493ON1821823465e-41
Skud_7.4423.493ON1741753422e-40
YGR131W (FHN1)3.493ON1741753333e-39
Suva_7.4193.493ON1741753325e-39
KAFR0G037003.493ON1861863283e-38
KLTH0F14850g3.493ON1711763256e-38
Smik_6.2273.493ON1741753212e-37
NCAS0E008003.493ON1741753188e-37
KLLA0D16280g3.493ON1691753152e-36
TBLA0C044903.493ON1861533162e-36
Kwal_55.212383.493ON1701753109e-36
NCAS0F035603.493ON1831523083e-35
TBLA0D029603.493ON1891513066e-35
AFR312W3.493ON1681752517e-27
Ecym_12363.493ON1691752386e-25
CAGL0J09042g7.308ON36347681.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05610
         (175 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   237   3e-80
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   160   6e-50
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   159   9e-50
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   157   6e-49
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   155   3e-48
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   153   2e-47
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   152   2e-46
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   149   9e-46
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   148   2e-45
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   148   3e-45
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   145   3e-44
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   143   4e-43
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   142   6e-43
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   141   1e-42
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   140   4e-42
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   137   5e-41
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   136   2e-40
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   132   3e-39
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   132   5e-39
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   130   3e-38
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   129   6e-38
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   128   2e-37
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   127   8e-37
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   125   2e-36
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   126   2e-36
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   124   9e-36
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   123   3e-35
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   122   6e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   101   7e-27
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    96   6e-25
CAGL0J09042g Chr10 (892829..893920) [1092 bp, 363 aa] {ON} simil...    31   1.6  

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  237 bits (604), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 123/175 (70%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLAIVDNALRLVNFAF               DGHSSRVNFCMFAAAFGIVTDSFYGILAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
           IWEVFAWPVILFALD               VGIRTHSCKNQDYLDSNNITQGSTQRCRLA
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QASVA         LAKMIMSLIGIITNGPF             AQVGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  160 bits (405), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 103/178 (57%), Gaps = 3/178 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXX-XXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILA 59
           MLA+ DN LR VNF F                 GH+SRVNFCMFAAAFGIV DSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NIWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           NI+  FA+PVILF LD               VGIRTHSC N+ YLDSN ITQGST RCR 
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQ--VGVPTISQV 175
           AQA VA         L KM+MS + +++NG F              Q  VGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  159 bits (403), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 101/175 (57%), Gaps = 2/175 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA+ DN LR+VNF F               D HSSRVN+CMFAAA+GI TDS YG+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            +E+ AWP+ILF LD               VGIR HSC N  Y ++N I QGS +RCR +
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         LAKMIMSL+ I +NG F             A+VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAF--GTKFIRRRRNNAEVGVPSVSQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  157 bits (397), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 97/175 (55%), Gaps = 2/175 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA+ DN LR++NF F               D HSSRVN+CMFA A+GI TDS YG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
             E  AWP++LF LD               VGIR HSC N  Y+DSN ITQGS  RCR A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         LAK +MS+  +I+NG F              QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAF--GSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  155 bits (393), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 99/175 (56%), Gaps = 2/175 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA  DN LR++NF F               D +SSRVNFCMFAAA+GI TDS YG+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            +E  AWP++LF LD               VGIR HSC N+ Y+DSN ITQGS  RCR A
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         LAK +MS+  +I+NG F              QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAF--GSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  153 bits (387), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 96/175 (54%), Gaps = 2/175 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA+ DN LR++NF F                 HSSRVN+CMFA A+GI TDS YG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
             E  AWP++LF LD               VGIR HSC N  Y+DSN ITQGS  RCR A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         LAK +MS+  +I+NG F              QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAF--GSGSFSKRRRTGQVGVPTISQV 173

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  152 bits (383), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 99/187 (52%), Gaps = 12/187 (6%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML++ DN +R +NF F                GHSSRVN+CMF   F +VTDSFYGILAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  IWEV-FAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           IW   FAWP+ILFA D               VGIRTHSCKN++Y+D+N I QGST RCR 
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXX-----------XXXXXXAQVG 168
           AQAS+A           K++MS I +++NG                           QVG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 169 VPTISQV 175
           VP ISQV
Sbjct: 181 VPNISQV 187

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  149 bits (376), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 98/175 (56%), Gaps = 5/175 (2%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+I+DN+LRLVNFAF               D HS RVNF +F AAF +VTDSFY + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
           ++  FAWP++L   D               VGIRTHSC N+ YL SNNITQGST RCR A
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         L K+++S+I + +                 A VGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFS-----SGAFGSGSGSRRANVGVPTISQV 170

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  148 bits (374), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 99/175 (56%), Gaps = 9/175 (5%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA VDN LR++NF F                G+SSR+N+CMFA A+ IVTDS YG+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            +E  AWP+ILF+LD                 IR HSC+NQ YL SN+ITQGS  RCR A
Sbjct: 61  FFEPLAWPLILFSLD-------FLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         LAK +MS+  +I+NG F              QVGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAF--GSGSFSKRRRTGQVGVPTISQV 166

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  148 bits (374), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML + DN LR VNF F               + HSSRVN+C+F   F +VTD+FYG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  IWEV-FAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           IW    AWP+ILF  D               VG RTHSC NQ YLDSNNITQGST RCR 
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXX--------XXXXXXXXXAQVGVPT 171
           AQA+ A         LAK+IMS I + TNG                        Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 172 ISQV 175
           ISQV
Sbjct: 181 ISQV 184

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  145 bits (366), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 96/176 (54%), Gaps = 5/176 (2%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML++ DN LR+VN  F                 HSSRVNFC+FAAA+GI TDS YGI AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLD-SNNITQGSTQRCRL 119
            +E  AWP++LF LD               VGIR HSC N+ YL+    I QGS  RCR 
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           AQA VA         LAKMIMS++ +++NG F              +VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAF----GAKLRRKHHTEVGVPSISQV 172

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  143 bits (360), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 93/182 (51%), Gaps = 7/182 (3%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML + DN LRL+NF F                 H SRVN+CMFAAA+GI TD  YG+LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            WE  AWP+ILF LD               VGIR HSCKN  Y + N+I QGS  RCR++
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQV-------GVPTIS 173
           QA+ A         +AKM+MS I + +NG F                       GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 174 QV 175
           QV
Sbjct: 181 QV 182

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  142 bits (359), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 93/179 (51%), Gaps = 4/179 (2%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59
           ML + DN LRL+N  F               +GH +SRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NIWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           N ++V AWP++LF LD               VGIR HSC NQ YLDSN I +GS QRCR 
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQV---GVPTISQV 175
           AQA VA         +AKMIMS I +  NG F                   GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  141 bits (356), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 88/151 (58%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           MLA+ D  LRLVNF F                GHSSR+N+CMF AA+GI TDSFYG++AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            WE  +WP++L ALD               VGIR HSCKN  Y + N I QGS  RCR A
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPF 151
           QA+VA         LAK IMSL+ I TNGPF
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPF 151

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  140 bits (353), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 94/176 (53%), Gaps = 1/176 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML++ DN LRL+N  F                GH+SR+N+CMF   + ++TDSF+GILAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            +E  ++P ILF LD                GIR+HSC NQ YLD N ITQGS  RCR +
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXX-XAQVGVPTISQV 175
           QA VA         L K+ MS I +I NG F              A+VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  137 bits (346), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 101/182 (55%), Gaps = 7/182 (3%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+ VDN LR++N  F                 +SSR+NFCMFAAAFG++TDSF+G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  IWEVFA-WPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           +++  A WP++LF  D               V IR HSCKN+ Y++SN+ITQGS  RCR+
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPF------XXXXXXXXXXXXXAQVGVPTIS 173
           +QA+VA         LAKMIMS I + +NG F                    +VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 174 QV 175
           QV
Sbjct: 181 QV 182

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  136 bits (342), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 94/175 (53%), Gaps = 1/175 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+  DN +R+V+  F                  SSRVNFCMFAAA+G++TDSFYG LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            W    +P IL  LD               VGIR HSCKN+ YL+ NNITQGS+ RC  +
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         L K+ +S+ G++ NG F              Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR-QMGVPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  132 bits (333), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 91/175 (52%), Gaps = 1/175 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+  DN +R++N  F                 HSSRVNFCMFAA +G+VTDS YG LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            W    +P IL  LD               VGIR HSCKN+ YL+ N I QGS+ RC  +
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         L K+ ++ +G++ NG F              Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR-QMGIPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  132 bits (332), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 92/175 (52%), Gaps = 1/175 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML++ DN +R++N  F                 HSSRVNFCMFAAA+G++TDSFYG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
           +W    +PVI+F LD               VGIR HSC N+ YLD+N ITQGS  RC  A
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           +A+V          L K+++S I  +                   Q+G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVS-IAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  130 bits (328), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 94/186 (50%), Gaps = 11/186 (5%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59
           MLAI DN+LRLVNF F                GH S+RVN+CMFA AFGI+TDS YG+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NIWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           N +E  AWP+ILF  D               VGIR H+C N+ Y +SN I +GS  RCR+
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGP----------FXXXXXXXXXXXXXAQVGV 169
           AQA+VA         L K + S++  I+ GP                           GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 170 PTISQV 175
           PT+S+V
Sbjct: 181 PTVSEV 186

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  129 bits (325), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 95/176 (53%), Gaps = 6/176 (3%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSS-RVNFCMFAAAFGIVTDSFYGILA 59
           ML+I+DN+LR +NFAF                 H++ +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NIWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           N     AWP+++   D               V IRTHSC NQDYLDSN +TQGST RCR 
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           AQASVA         LAK+ +SL+ +I+ G F               VGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF-----GAGSSRRTGNVGVPTISQV 171

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  128 bits (321), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 87/175 (49%), Gaps = 1/175 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+  DN +R++N  F                 HSSRVNFCMF AA+G+VTDS YG LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            W    +P IL ALD               VGIR HSCKN+ YL+ N ITQ S+ RC  +
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA+VA         L K+ ++  G I                   Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTI-QNGGFGFNSGFGRRRARRQLGVPTISQV 174

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  127 bits (318), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 91/175 (52%), Gaps = 1/175 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML + DN LR++N  F                 ++SR+N+CMF  A+ + TDS YGI AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
            +++ A P + F LD                GIR HSCK++ Y++SN ITQG   RCR +
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QA VA         LAK+IMS I +I NG F             A++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAF-TQHIGRRRRRNAAEIGVPSISQV 174

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  125 bits (315), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 87/175 (49%), Gaps = 6/175 (3%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+I+DN+LR VNF F               D  SSRVNF +FAA FGIV DS Y ++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
                AWP+IL +LD               VGIR  SC N  +   N I +GS  RCR A
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QAS           L K I+S++  IT+G F              QVGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAF------GTSSNRKTQVGVPTISQV 169

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  126 bits (316), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 85/153 (55%), Gaps = 2/153 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXX-XXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILA 59
           ML+   N LR++NF F                  HS RVN+CMFAA F +VTDSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NIW-EVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCR 118
           N W   FAWP++L++ D               VGIRTHSC N+ YL SN ITQGST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 LAQASVAXXXXXXXXXLAKMIMSLIGIITNGPF 151
           LAQAS+A         L +++ S + +  NG F
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLF 153

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  124 bits (310), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 91/175 (52%), Gaps = 5/175 (2%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+I+DN+LR  NF F               D ++ +VNF +FAAAFG++ D+ Y I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
                AWP+++   D               V IR HSC N DY+D+N +TQGS+ RCR A
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QASVA         L K+ +SL+ + + G F             A VGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAF-----STSSGRKSANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  123 bits (308), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 1/152 (0%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+ VDN LR  N  F               +  SSRVN+CMFAAAFG++TDSF+G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  IWEVFA-WPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119
           + +  + WP+ILF  D               VGIR HSC N+ YL+SN I QGS  RCR+
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AQASVAXXXXXXXXXLAKMIMSLIGIITNGPF 151
           +QA+VA         LAKMIMS I + +NG F
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAF 152

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  122 bits (306), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 83/151 (54%), Gaps = 2/151 (1%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59
           ML + DN  R+ NF F                GH SSRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  N-IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCR 118
           N + E FA+P ILFA D               VGIRTHSC N++Y   N I QGS +RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 LAQASVAXXXXXXXXXLAKMIMSLIGIITNG 149
            AQA +A         L K++++L+   T G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGG 151

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  101 bits (251), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 80/175 (45%), Gaps = 7/175 (4%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+I+DN+LR VNF F                   SRVNF +F A F +VTDSFY I+AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
               FAWP+I  ALD                 I  HSC N+ +LD N I++ ST RCR  
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QAS           LAK + S + I +                    GVPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFS-------SGAFSSGGSKRGGGVPTISQV 168

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 96.3 bits (238), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 78/175 (44%), Gaps = 6/175 (3%)

Query: 1   MLAIVDNALRLVNFAFXXXXXXXXXXXXXXXDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60
           ML+I+DN+LR  NF F               +   SRVNF +F A F ++ DS Y +LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  IWEVFAWPVILFALDXXXXXXXXXXXXXXXVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120
                AWP++L   D                 I  HSC N  +L  N+I++G   RCR  
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QASVAXXXXXXXXXLAKMIMSLIGIITNGPFXXXXXXXXXXXXXAQVGVPTISQV 175
           QAS           LAK ++S + I++ G F                GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG------GVPTISQV 169

>CAGL0J09042g Chr10 (892829..893920) [1092 bp, 363 aa] {ON} similar
           to uniprot|Q12063 Saccharomyces cerevisiae YDL193w
          Length = 363

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 36  SRVNFCMFAAAFGIVTDSFYGILANIWEVFAW-------PVILFALD 75
           +RV F + A   G V    YG+L+N  EV +W        VIL+ +D
Sbjct: 155 TRVAFILEAKPIGQVGGGLYGLLSNAAEVVSWSVYAGVKEVILYDMD 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,535,170
Number of extensions: 241590
Number of successful extensions: 601
Number of sequences better than 10.0: 31
Number of HSP's gapped: 516
Number of HSP's successfully gapped: 31
Length of query: 175
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 73
Effective length of database: 41,785,467
Effective search space: 3050339091
Effective search space used: 3050339091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)