Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D056003.492ON70070024870.0
Skud_7.4413.492ON8074075871e-64
Suva_7.4183.492ON8313095836e-64
YGR130C3.492ON8164075712e-62
CAGL0I10516g3.492ON8133865554e-60
Smik_6.2263.492ON8394605555e-60
NCAS0E008103.492ON6923285487e-60
SAKL0F02772g3.492ON7733095262e-56
ZYRO0D09988g3.492ON9943095111e-53
NDAI0G009403.492ON6563784922e-52
KLTH0F14828g3.492ON8363224336e-44
Kwal_55.212293.492ON7874134132e-41
Kpol_480.143.492ON6993534005e-40
KLLA0D16236g3.492ON8713204026e-40
TPHA0D042503.492ON6293112876e-26
Ecym_12373.492ON7272502531e-21
KAFR0C019603.492ON5632542243e-18
KNAG0B008103.492ON7573672022e-15
AFR310C3.492ON6232491654e-11
TBLA0C044803.492ON802631637e-11
KNAG0A079403.492ON2751061186e-06
Smik_4.6225.414ON944109733.5
Suva_7.2804.124ON21684704.9
KAFR0G036903.492ON363121715.0
NDAI0B058603.492ON68181716.4
NOTE: 1 genes in the same pillar as TDEL0D05600 were not hit in these BLAST results
LIST: NCAS0F03550

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05600
         (700 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   962   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   230   1e-64
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   229   6e-64
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   224   2e-62
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   218   4e-60
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   218   5e-60
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   215   7e-60
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   207   2e-56
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   201   1e-53
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   194   2e-52
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   171   6e-44
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   163   2e-41
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   158   5e-40
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   159   6e-40
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   115   6e-26
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   102   1e-21
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    91   3e-18
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    82   2e-15
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    68   4e-11
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    67   7e-11
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    50   6e-06
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    33   3.5  
Suva_7.280 Chr7 (486107..486757) [651 bp, 216 aa] {ON} YGL002W (...    32   4.9  
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    32   5.0  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    32   6.4  

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/700 (74%), Positives = 518/700 (74%)

Query: 1   MFKQKRSDPFAQYWAGDQAXXXXXXXXXXXXXXXXGERDYVSPFRDEQEVLSAQRRRTQR 60
           MFKQKRSDPFAQYWAGDQA                GERDYVSPFRDEQEVLSAQRRRTQR
Sbjct: 1   MFKQKRSDPFAQYWAGDQAKDVEEQQKKKKEEEDVGERDYVSPFRDEQEVLSAQRRRTQR 60

Query: 61  FPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYXXXXXXXXXXXXXXXXXXXAHL 120
           FPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVY                   AHL
Sbjct: 61  FPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYLEEIEKKQLELLRELEVKEAHL 120

Query: 121 RYLKDCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVGESKAAASETEPA 180
           RYLKDCQ                                      NVGESKAAASETEPA
Sbjct: 121 RYLKDCQVVTEVKEKEKEKEKEQPKVEDEADEYEAEEEADEEADANVGESKAAASETEPA 180

Query: 181 ADFKPIXXXXXXXXXXXXXXXXXXXXXXXXXXLAADXXXXXXXXXXXXXXXXXXXXGREP 240
           ADFKPI                          LAAD                    GREP
Sbjct: 181 ADFKPIVPDVSEPVVPAVSEPAEHEPEVSEPVLAADSEPVVAAVSEPVVPAVSEPAGREP 240

Query: 241 EASEPVVSKTSLEVTTEVEPAEVSKPTAKPADEPETEEVEGEKLIEDGVXXXXXXXXXXX 300
           EASEPVVSKTSLEVTTEVEPAEVSKPTAKPADEPETEEVEGEKLIEDGV           
Sbjct: 241 EASEPVVSKTSLEVTTEVEPAEVSKPTAKPADEPETEEVEGEKLIEDGVETPESPEKTEK 300

Query: 301 XXXXXXXXXDPRSVPMVALPAAPRAFLDKIFKSXXXXXXXXXXXXXXXXHVVKTKDGYLT 360
                    DPRSVPMVALPAAPRAFLDKIFKS                HVVKTKDGYLT
Sbjct: 301 TEKTEKPLPDPRSVPMVALPAAPRAFLDKIFKSPPAPVPNPPATPENPEHVVKTKDGYLT 360

Query: 361 KVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSD 420
           KVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSD
Sbjct: 361 KVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSD 420

Query: 421 TDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEID 480
           TDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEID
Sbjct: 421 TDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEID 480

Query: 481 ELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILD 540
           ELNI        CQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILD
Sbjct: 481 ELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILD 540

Query: 541 QIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAIT 600
           QIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAIT
Sbjct: 541 QIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAIT 600

Query: 601 XXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDYTQ 660
                              NRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDYTQ
Sbjct: 601 KKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDYTQ 660

Query: 661 LEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEILTV 700
           LEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEILTV
Sbjct: 661 LEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEILTV 700

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  230 bits (587), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/407 (36%), Positives = 220/407 (54%), Gaps = 59/407 (14%)

Query: 351 VVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           +VKTK+ GYL+K +YDKI   ++ H  W+A  K  E+ K+D      + ++  L+ QI E
Sbjct: 399 IVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDE 458

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           I+N M  +R +T  KIEVS+N L ++  ++   H  KK  +FKDTE +K+QKL EKD VL
Sbjct: 459 IENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVL 518

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
            KQ  V+ EIDELN            WT ++  LS ++DA++  + ++N+KQ   Q EI+
Sbjct: 519 GKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEID 578

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
            LQ++K D++ Q E+N   H  N + +E  +NK YLP++N++DNQ+S LL ++T IRQ  
Sbjct: 579 ALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQEN 638

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANE+TELSAIT                    R+RKEE+LL KQR+ELE +A +A+  HEQ
Sbjct: 639 ANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQ 698

Query: 650 EMQKLKTDY-------------------------TQLEGKFKREQQQK------------ 672
           ++ ++K  Y                         T+L+G+   E+Q +            
Sbjct: 699 QITQVKQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEI 758

Query: 673 ---------------KDALAFAHEP------TKDDSLYEYGTEEEIL 698
                          K  +  +H P       KDDSLYEY TEE+++
Sbjct: 759 LGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEEDVM 805

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87
           G+ ++VSPFR  Q+ LS  +         + ++FPT SA SAY   +P++LGYK I    
Sbjct: 49  GKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNA 106

Query: 88  KRAKDISFPVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           KRAKDI FP Y                    HL+YLK+CQ
Sbjct: 107 KRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQ 146

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  229 bits (583), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 192/309 (62%), Gaps = 1/309 (0%)

Query: 351 VVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           +VKTK+ GYL+K +YDKI   ++ H  W+   +  E+ K+D K  E   K+  L+ QI E
Sbjct: 422 IVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDE 481

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           I+N M QLR +T  KIEV++N L ++  ++   H  KK  +FKDTE +K QKL EK+ VL
Sbjct: 482 IENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVL 541

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
           +KQ  V+ EIDELN            WT ++  LS ++DA++  + ++N+KQ   Q EI+
Sbjct: 542 NKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEID 601

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
            L++QK D++ Q E+N   H +N +V+E  +NK YLP++N++D QIS LL Q+T IRQ  
Sbjct: 602 NLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQEN 661

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANERT LSAIT                    R+RKEE+LL KQR+ELE +A +A  +HE+
Sbjct: 662 ANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEE 721

Query: 650 EMQKLKTDY 658
           ++ ++K  Y
Sbjct: 722 QITQVKKTY 730

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87
           G+ D+VSPFR  Q+ LS  +         + ++FPT SA S Y   +P++LGYK I    
Sbjct: 47  GKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDV 104

Query: 88  KRAKDISFPVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           KRAKDI FP Y                    HL+YLK CQ
Sbjct: 105 KRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQ 144

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  224 bits (571), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 147/407 (36%), Positives = 224/407 (55%), Gaps = 59/407 (14%)

Query: 351 VVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           +VKTK+ GYL+K +YDKI   ++ H  W+A  +  E+ K+D K  E   K+  L+ QI E
Sbjct: 408 IVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDE 467

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           I+N M  +R +T  KIEVS+N L +K  ++   H  KK  + KDTE +K+QKL EK+ VL
Sbjct: 468 IENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVL 527

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
           DKQ  V+ EID+LN            WT ++  LS ++DA++  + ++N+KQ   Q EI+
Sbjct: 528 DKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEID 587

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
            L+++K D++ Q E+N   H +N +V+E  +NK YLP++N++DNQIS LL ++T I+Q  
Sbjct: 588 NLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQEN 647

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANE+T+LSAIT                    R+RKEE+LL KQR+ELE +A +A+  HEQ
Sbjct: 648 ANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQ 707

Query: 650 EMQKLKTDY----TQLEGKFKREQQQ------------------------------KKDA 675
           ++ ++K  Y    T+L+ K   E+++                              K++ 
Sbjct: 708 QITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEI 767

Query: 676 LAFAHEPT------------------------KDDSLYEYGTEEEIL 698
           L+  H+                          KDDSLYEY TEE+++
Sbjct: 768 LSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVM 814

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87
           G+ ++VSPFR  Q+ L+ ++         + ++FPT SA SAY   +P++LGYK I    
Sbjct: 49  GKEEWVSPFR--QDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNA 106

Query: 88  KRAKDISFPVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           KRAKDI FP Y                    HL+YLK CQ
Sbjct: 107 KRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQ 146

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  218 bits (555), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 214/386 (55%), Gaps = 36/386 (9%)

Query: 351 VVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           + KT++ GY++K IYDK+   +  H  W+  +KK E+ K+DDK  E N ++  L+ +I  
Sbjct: 428 IAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDM 487

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           I   M  L+ +T  KIEVSEN L +K FE   +H ++KN++FK+TE IK+QK+ +K  +L
Sbjct: 488 INESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEIL 547

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
           DK   VQ EI +LN           KWT ++  L  ++DAK+  + ++ +KQ  TQ+EI 
Sbjct: 548 DKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIE 607

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
           KL+ QK +   QI+     H E +KV+E  +NK YLPK++ +DNQIS LL +L  I+Q  
Sbjct: 608 KLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQEN 667

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANE+TELS IT                    R R+E++LL KQR ELE KA++ + +HE+
Sbjct: 668 ANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEE 727

Query: 650 EMQKLKTDYTQLEGKFKREQQ------------------------QKKDALAFAHEPTK- 684
           +++K+K  Y       K++++                        Q+K A A     TK 
Sbjct: 728 QVRKMKEQYENELNNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQAEAQHAAQTKS 787

Query: 685 ----------DDSLYEYGTEEEILTV 700
                     D+SLYE+ TEEEI+ V
Sbjct: 788 IATNAANDMQDNSLYEFKTEEEIMYV 813

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 34/68 (50%)

Query: 60  RFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYXXXXXXXXXXXXXXXXXXXAH 119
           +FPT SA SA  N  P+ELG+K +    KRAKDI FPVY                     
Sbjct: 122 KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELKEGK 181

Query: 120 LRYLKDCQ 127
           L+YLKD Q
Sbjct: 182 LQYLKDSQ 189

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  218 bits (555), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 150/460 (32%), Positives = 235/460 (51%), Gaps = 71/460 (15%)

Query: 310 DPRSVPMVALPAAPRAFLDKIF------------KSXXXXXXXXXXXXXXXXHVVKTKD- 356
           DP   P V     PR     IF            KS                 +VKTK+ 
Sbjct: 378 DPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEH 437

Query: 357 GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQ 416
           GYL+K +YDKI   ++ H  W+   +  E+ K+D K  E   K+  L+ QI E+++ M  
Sbjct: 438 GYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKA 497

Query: 417 LRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQ 476
           +R +T  KIEVS+N L ++  ++   H  KK  +FKDTE +K+QKL EK+ VL+KQ  V+
Sbjct: 498 MRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVK 557

Query: 477 KEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKV 536
            +IDELN            WT ++  LS ++DA++  + ++N+KQ   Q+EI+ L+Q+K 
Sbjct: 558 SQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKN 617

Query: 537 DILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTEL 596
            ++ Q ++N   H +N +V+E  +N+ YLP++N++DNQIS LL ++T I+Q  ANE+T+L
Sbjct: 618 ALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQL 677

Query: 597 SAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKT 656
           SAIT                    R+RKEE+LL KQR+ELE +A++A+  HE+++ ++K 
Sbjct: 678 SAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQVKK 737

Query: 657 DY----TQLEGKFKREQQQ------------------------------KKDALAFAHEP 682
            Y    T+L+ K   E+++                              K++ L+  H+ 
Sbjct: 738 TYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQ 797

Query: 683 T------------------------KDDSLYEYGTEEEIL 698
                                    KDDSLYEY TEE+++
Sbjct: 798 AEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVM 837

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 11/101 (10%)

Query: 36  GERDYVSPFRDEQEVLSAQRR---------RTQRFPTTSAASAYVNARPEELGYKKIGAG 86
           G+ +++SPFR  Q+ L++++          + ++FPT SA SAY   +P++LGYK I   
Sbjct: 49  GKEEWISPFR--QDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKN 106

Query: 87  EKRAKDISFPVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
            KRAKDI FP Y                    HL+YLK CQ
Sbjct: 107 AKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQ 147

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  215 bits (548), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/328 (37%), Positives = 196/328 (59%), Gaps = 3/328 (0%)

Query: 351 VVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           +VKT   GYL+K +YDKI   ++QH +W+A Y+  + +K++ K  E  + +  +  Q+ E
Sbjct: 278 IVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSE 337

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           + + + +   DT  KI+V   +L +K F+   V I  K ++F +T+ IK +KLSEK++VL
Sbjct: 338 LNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVL 397

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
           +   EV++ IDEL             WT ++  + + +DAK+  + ++NV Q N Q +I+
Sbjct: 398 NDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKID 457

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
            L  QK ++ D+I KN   H  N K++E   NK YLPKLN++DN+I+ LL Q+T ++Q  
Sbjct: 458 ALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQEN 517

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANE+ +L+ IT                    R+R+EE+LLGKQR ELEAKA   +  H+Q
Sbjct: 518 ANEKVQLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQ 577

Query: 650 EMQKLKTDY-TQLEGKFKREQQQKKDAL 676
           E+  LK DY T+LE +FK + +Q++D L
Sbjct: 578 EIDALKNDYETKLE-EFKNQLKQEQDQL 604

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 43/89 (48%)

Query: 39  DYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVY 98
           DY SPFR E   ++ Q  +T+RFPT SA S Y    P++ G+  I  G+  AKDI FP Y
Sbjct: 72  DYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNY 131

Query: 99  XXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
                                L+YL+D Q
Sbjct: 132 LTENEQRQQAELLILEKKEKDLKYLQDSQ 160

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  207 bits (526), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 194/309 (62%)

Query: 350 HVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           ++V+T  GY++K IYDK+   ++ H   +A + K++  K+D    E N K+  L++QI E
Sbjct: 359 YIVRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDE 418

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           ++  M QLR DT  KI+VSE+EL++K  ++   HI  KN +FK+TE IK+QK++E+D + 
Sbjct: 419 LQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEIT 478

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
            K  EV+ EI+ELN+          ++   +++L+A++D+KV  ++E+N KQ      I 
Sbjct: 479 AKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIA 538

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
           +L Q+K++I  +       H E+  ++E  KNK YLPK+N +D+Q++ LLG LT I+Q  
Sbjct: 539 ELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQEN 598

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           AN++TE +AIT                    R+R EE+ L KQR+ELEAKA++AR KHE+
Sbjct: 599 ANQKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEE 658

Query: 650 EMQKLKTDY 658
           E++++K ++
Sbjct: 659 ELRQIKEEH 667

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 64/130 (49%), Gaps = 5/130 (3%)

Query: 1   MFKQKRS-DPFAQYWAGDQAXXXXX--XXXXXXXXXXXGERDYVSPFRDEQEVLSAQRRR 57
           +FK+K+  DPFA     +Q                    E+DY SPFR +QE+++A+  +
Sbjct: 3   IFKKKQQVDPFAHLLQPEQPQEQPNFLRKVVTNKKKEEEEKDYSSPFRSQQELIAAKNVK 62

Query: 58  TQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYXXXXXXXXXXXXXXXXXXX 117
            ++FPT SA S   +A   +LGYK I + ++RAKDIS P Y                   
Sbjct: 63  AKKFPTVSATSGTASAA--DLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE 120

Query: 118 AHLRYLKDCQ 127
            HL+YLKD Q
Sbjct: 121 NHLQYLKDSQ 130

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  201 bits (511), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 191/309 (61%), Gaps = 1/309 (0%)

Query: 351 VVKT-KDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           +VKT ++G+L+K +YDK+  ++ +H+EW+ ++   E++++++K+ + + ++  L+ ++++
Sbjct: 498 LVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEK 557

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
           ++  M +++ D +  IE+    L++KF E TQ +I+KKN +F +T+ I+ QK  E D + 
Sbjct: 558 LEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIK 617

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
            +Q EVQKEI  LN            WT  + + SA +DAK+  L  +  K   TQ +I+
Sbjct: 618 HRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQID 677

Query: 530 KLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHC 589
           +L  +K  +  ++  +  THA+N K +E   NK YLPK++E+D++IS LLG+L+ I+Q  
Sbjct: 678 ELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQES 737

Query: 590 ANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQ 649
           ANE+ +L +IT                    R RKE+DLLGKQR+E EA A   +++HE+
Sbjct: 738 ANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEE 797

Query: 650 EMQKLKTDY 658
           E++K+K DY
Sbjct: 798 ELRKMKQDY 806

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (66%)

Query: 39  DYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVY 98
           ++ SPFR E     A++RR QRFPT S  S +    P+ELGY+ +G G +RAKDI FP+Y
Sbjct: 68  EFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIY 127

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  194 bits (492), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 202/378 (53%), Gaps = 9/378 (2%)

Query: 310 DPRSVPMVAL-----PAAPRAFLDKIFKSXXXXXXXXXXXXXXXXHVVKTKD-GYLTKVI 363
           DP+  PMV+      P   +    ++                    +VKTK  G L+K I
Sbjct: 192 DPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGILSKSI 251

Query: 364 YDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDTDA 423
           YD++    +QH +++A YK + Q+K+D K  E   ++ SL  +I      + Q + DTDA
Sbjct: 252 YDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTDA 311

Query: 424 KIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEIDELN 483
           K+++   EL ++ F+   V    K ++F +T++IK +K+ EK +V +   +V  EID+LN
Sbjct: 312 KLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGEIDQLN 371

Query: 484 IXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILDQIE 543
                      +WT ++  ++ ++DAK+  ++++N+ Q N Q +I+ L  +K+ +  +IE
Sbjct: 372 KEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIE 431

Query: 544 KNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAITXXX 603
            N  THA N + IE   NK YLPKLN +D+QI+ LL QLT I+Q  ANE+ +LS +T   
Sbjct: 432 ANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKL 491

Query: 604 XXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDYTQLEG 663
                            R+R+EE+LLGKQR+ELE KA + +  HE EM  LKT Y Q   
Sbjct: 492 EKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLA 551

Query: 664 KFKR---EQQQKKDALAF 678
            FK    EQQ K D L  
Sbjct: 552 DFKSKLMEQQDKVDDLKL 569

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 42/92 (45%), Gaps = 3/92 (3%)

Query: 39  DYVSPFRDE---QEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95
           +Y+SPFR           Q  +T+RFPT SA S Y N   +E+G+KKI   +  AKDI F
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126

Query: 96  PVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           P Y                     L+Y KD Q
Sbjct: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQ 158

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  171 bits (433), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 102/322 (31%), Positives = 179/322 (55%)

Query: 351 VVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEI 410
           +VK   GY++K +YD +  ++  H   +  Y K+   K++ K  E   ++ SL++QI E+
Sbjct: 386 IVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAEL 445

Query: 411 KNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLD 470
           +  M  L+ DT  KIE+SE +L+ +  ++   H   KN +FK+TE +K+ K+ EK+ V  
Sbjct: 446 EATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEA 505

Query: 471 KQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINK 530
           KQ +V+ E++EL           ++    ++EL+A +DAK+A ++E+N +Q   Q  I+ 
Sbjct: 506 KQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDD 565

Query: 531 LQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCA 590
           LQQQK  ++ +    +  H  N  V+E  +NK YLPKLN +D +IS LL  LT ++Q  A
Sbjct: 566 LQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETA 625

Query: 591 NERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQE 650
           N +TE +A++                   NR+R E + L KQR+E + +    +++HE++
Sbjct: 626 NHKTEFAAVSKRLEEEDEERKEKLRQEEENRKRLEAERLQKQREEHDQQILLLQQEHERQ 685

Query: 651 MQKLKTDYTQLEGKFKREQQQK 672
           + +      + E    +E++Q+
Sbjct: 686 LAEASQKAAEHEQALLKEREQR 707

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 40  YVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYX 99
           Y SPFR  Q + +AQ+R+ Q+FPT SA+ +  ++   ++GYK I A  +RAKDI+ P Y 
Sbjct: 41  YNSPFRTSQSLAAAQKRKMQKFPTVSASVSAHSSS--DMGYKVIDAARRRAKDIAVPRYL 98

Query: 100 XXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
                               L+Y KD Q
Sbjct: 99  QGNDERQRRRLDKLERKEDALKYKKDSQ 126

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/413 (29%), Positives = 198/413 (47%), Gaps = 13/413 (3%)

Query: 241 EASEPVVSKTSLEVTTEVEPAEVSKPTAKPADEPETEEVEGEKLIEDGVXXXXXXXXXXX 300
           EAS+P+    + E +  +E  E S+PT      P+ E + GE L+ D             
Sbjct: 257 EASKPI---ETTEASQPIESTEASQPTPTTKASPDDEGIVGESLVADASAAAETPAAAET 313

Query: 301 XXXXXXXXXDPRSVPMVALPAAPRAFLDKIFK--SXXXXXXXXXXXXXXXXHVVKTKDGY 358
                     P+++     P  P  F   IF   +                 +VK   GY
Sbjct: 314 SATLQK----PKNIKDT--PRVP--FATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGY 365

Query: 359 LTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLR 418
           ++K +YD +  ++  H + + +Y K+   K+D K  E    + SL++QI E++  M QL+
Sbjct: 366 MSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQ 425

Query: 419 SDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKE 478
            DT  KI +S  EL+ +  E    H   KN +FK+TE  K+ K+ EK +V+ KQ EV+ E
Sbjct: 426 LDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAE 485

Query: 479 IDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDI 538
            +EL           Q+    I+EL+ ++D+K + ++E+N +Q   Q  I+ L+QQK  +
Sbjct: 486 NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTL 545

Query: 539 LDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSA 598
           +      +  H  N  ++EG  NK YLPK+N +D+QIS LL  L  ++Q  AN+ TE +A
Sbjct: 546 VADATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAA 605

Query: 599 ITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQEM 651
           ++                   NR+R E +   KQR E +      +++HE+++
Sbjct: 606 VSKRLEEENEERKEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQL 658

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 57/128 (44%), Gaps = 4/128 (3%)

Query: 1   MFKQKRSDPFAQYWAGDQAXXXXXXXXXXXXXXXXGE-RDYVSPFRDEQEVLSAQRRRTQ 59
           MFK K+ DPF   +  DQ                  E   Y SPFR  Q  + AQ+R+ Q
Sbjct: 1   MFK-KKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQ 59

Query: 60  RFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYXXXXXXXXXXXXXXXXXXXAH 119
           RFPT SA+S   ++   E+G+K I A  KRAKDI+ P Y                     
Sbjct: 60  RFPTVSASSGGNSSA--EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDS 117

Query: 120 LRYLKDCQ 127
           L+Y KD Q
Sbjct: 118 LQYKKDSQ 125

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  158 bits (400), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 196/353 (55%), Gaps = 20/353 (5%)

Query: 350 HVVKTK-DGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIK 408
           +V+KTK  GYL+K +YDK+      H  W+   +  E++K+ +K+ E    +  ++++I 
Sbjct: 365 YVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKID 424

Query: 409 EIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSV 468
            I + M +L+  T  KIEV E +L +   +MTQ H   KN++FK+TE++K +KL+ K   
Sbjct: 425 NIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDF 484

Query: 469 LDKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEI 528
           + KQ E++KEI+ L+           +W   + E++A++DAK+ D+   N ++ + ++E+
Sbjct: 485 ISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEM 544

Query: 529 NKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQISVLLGQLTTIRQ 587
            KL   K+++ ++I+KN   H  N +++      K YLP++NE+DN+I+  L +L+TI++
Sbjct: 545 AKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKK 604

Query: 588 HCANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKH 647
               E   L+ +T                     +R++E  L KQ  EL+A       KH
Sbjct: 605 ETIEENNRLTILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLAELKA-------KH 657

Query: 648 EQEMQKLKTDYTQLEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEILTV 700
            +E+        +++ K++++  Q+  A+     PT D+SLYEY TEEE+ ++
Sbjct: 658 NEEL-------LEIQKKYEKKMAQQPKAVEL---PT-DNSLYEYVTEEEVFSL 699

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query: 39  DYVSPFRDEQEVLSA---QRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95
           +YVSPFRD   V +A   + ++ +RFPT SA+S +    P ELGYK I    KRAKDISF
Sbjct: 37  EYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISF 96

Query: 96  PVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           P +                   A+L+YL++ Q
Sbjct: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQ 128

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  159 bits (402), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 107/320 (33%), Positives = 177/320 (55%), Gaps = 2/320 (0%)

Query: 351 VVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEI 410
           +V+T++GY++K +YDK+   + QH   +A Y K++ ++++ K  E   KI S++A+I E+
Sbjct: 454 IVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAEL 513

Query: 411 KNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLD 470
             +M Q+R + + K+++ + E ++   E    HI  K  ++K TE IK+Q +S+K+    
Sbjct: 514 DAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEV 573

Query: 471 KQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINK 530
               VQ EIDEL +         Q+    +EEL+A +D K + L E   K+  T  EI  
Sbjct: 574 AHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQA 633

Query: 531 LQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCA 590
           L+++K  +  +I++    H +N   IE   NK YLPK+NE++ +IS LL  L  I+Q  A
Sbjct: 634 LEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLIQQEIA 693

Query: 591 NERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKHEQE 650
           N++ E S++T                    R R E++ L KQR E E +A+EAR KHE+E
Sbjct: 694 NQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRTEYEKQAEEARLKHEEE 753

Query: 651 MQKLKTDYTQL--EGKFKRE 668
           +  LK  + +   E + +RE
Sbjct: 754 LANLKQTHDEALKEAQLQRE 773

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 39  DYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKI-GAGEKRAKDISFP 96
           +Y SPFR  +E   A++ R ++FPT S  +  ++  PE++GY  +     K+AKDI  P
Sbjct: 60  EYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLD--PEQMGYSVVTDKSVKKAKDIIIP 116

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  115 bits (287), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 163/311 (52%), Gaps = 9/311 (2%)

Query: 350 HVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIK 408
           ++V+T +   ++K +YD++  + + H+EW+  +   E +K++ K+ E   K+  L+ Q+ 
Sbjct: 323 YLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLD 382

Query: 409 EIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSV 468
           +I+ +          KIE+ E +L +   ++   +   K +V K+TE++K QK++ K+ +
Sbjct: 383 DIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDL 442

Query: 469 LDKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEI 528
           L KQ +V+ EI++LN            W  ++E L+  +D K+A +E +N      Q++I
Sbjct: 443 LAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDI 502

Query: 529 NKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQISVLLGQLTTIRQ 587
             LQ +K+++ ++I+ +      N+ V++     K YLP+LNE+D QI+    +L  I+ 
Sbjct: 503 EVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKN 562

Query: 588 HCANERTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKELEAKAQEAREKH 647
              +E  +LS +T                     +R++++LL K+  EL+       EKH
Sbjct: 563 ETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTELQ-------EKH 615

Query: 648 EQEMQKLKTDY 658
            +EM +++  Y
Sbjct: 616 NEEMAEIQKKY 626

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 3/63 (4%)

Query: 39 DYVSPFRDEQEVLS---AQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95
          +Y+SPFR+ Q+ +    A+  + ++FPTTSA S +    P E+GY  +   +KRAKDI F
Sbjct: 36 EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95

Query: 96 PVY 98
          P Y
Sbjct: 96 PKY 98

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 140/250 (56%), Gaps = 3/250 (1%)

Query: 351 VVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEI 410
           +V T+ GY++K IYD++  ++  H E +A   ++   K++D       K+ SL  +I E+
Sbjct: 331 IVLTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEV 390

Query: 411 KNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLD 470
              M QL+S T+ +++  E  L++   ++   H ++K  + K+ E  K+ K++EK+++ +
Sbjct: 391 HAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINE 450

Query: 471 KQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINK 530
           K  +V+ E++ L           Q++  +++ L+A +DA++ +L+ V+ +Q      +  
Sbjct: 451 KLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAA 510

Query: 531 LQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCA 590
           L++++V I   I ++N   A N+++++  +N    P +  +DNQ+S +   ++ + Q  A
Sbjct: 511 LEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHA 567

Query: 591 NERTELSAIT 600
            ++ EL+ ++
Sbjct: 568 AQKDELTELS 577

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 36 GERDYVSPFRDEQEVLSAQRRRTQRFPTTSAAS 68
          G  +YVSPFRD++ V  A+R R  +FPTT   S
Sbjct: 53 GGGEYVSPFRDDKAVAEAERIRDLKFPTTGHHS 85

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 131/254 (51%), Gaps = 14/254 (5%)

Query: 351 VVKTKDGY-LTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           VVK   G  ++K +YDKI    + ++++I KY+ D+  K +  ++E N KI S++ +  +
Sbjct: 257 VVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQLEKFK 316

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVL 469
             NE+  L  ++    EV +N+L +   + T      K ++ + T  +K QKL+E   + 
Sbjct: 317 TLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNELKFLN 376

Query: 470 DKQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEIN 529
            K+  +++E + +N+               + E+   +DAK+  L + N++ +N + EIN
Sbjct: 377 QKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRNENLEHEIN 436

Query: 530 KLQQQK---VDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIR 586
           KLQ +K   +D +D IE   L   ++ K +E          LNE+D QI+  L  L  I+
Sbjct: 437 KLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQINSKLSNLNLIK 486

Query: 587 QHCANERTELSAIT 600
           Q   NE+ ++S +T
Sbjct: 487 QEIINEKLKISKLT 500

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 163/367 (44%), Gaps = 34/367 (9%)

Query: 355 KDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEM 414
           K G+++  +++K+   D+ H   +A Y+++++ KF  K  E  +K+  +  +   +  +M
Sbjct: 313 KYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKM 372

Query: 415 AQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGE 474
              + D  AK EV EN+  ++ F+        K +V  + +++K QKL +   +  K+  
Sbjct: 373 NDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKLQDLKFISQKKTL 432

Query: 475 VQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQ 534
           +Q E+++L +           WT ++  ++ R+DA++  L + N KQ     +I  L Q+
Sbjct: 433 MQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQR 492

Query: 535 KVDILDQIEKNNLTHAENEKVIEGAKNKTYLP--KLNEVDNQISVLLGQLTTIRQHCANE 592
           K ++  +I+ N  +    ++ +   +   +L   +L +V + I   L  L  ++Q  + E
Sbjct: 493 KTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGE 552

Query: 593 RTELSAITXXXXXXXXXXXXXXXXXXXNRRRKEEDLLGKQRKEL---------------- 636
           R +L  IT                   +  +  ED LG++  +L                
Sbjct: 553 RLKLIGITNEMERARAERERIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLV 612

Query: 637 ------EAKAQEAREKHEQEMQKLKT---DYTQLEGKFKREQQQKKDALA-------FAH 680
                 EAK Q++ EK E+  Q+LK    +  Q+E     ++QQ K  L        FA 
Sbjct: 613 QVREIYEAKLQDSAEKAEEAEQQLKLAAEEKAQIEKSLLDQEQQAKKELEDMQKERDFAE 672

Query: 681 EPTKDDS 687
              KD+S
Sbjct: 673 RRAKDES 679

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 39  DYVSPFRDEQEVLSA----QRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDIS 94
           +YVSPFR  Q   ++    Q +RT++FPT SA S Y +    ELG+ K+   ++RA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 95  FPVYXXXXXXXXXXXXXXXXXXXAHLRYLKDCQ 127
           FP Y                     L +L+ CQ
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQ 139

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 125/249 (50%)

Query: 351 VVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEI 410
           V+ T  GY++K +YD++  +++ H   +    +D  Q +        ++I  L A+I ++
Sbjct: 289 VLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKL 348

Query: 411 KNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLD 470
           + ++  L+++T+ +I+  E  L++   +M   +  K++ + +  E  ++++L++K+ ++ 
Sbjct: 349 RADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRAEQLADKEEIVH 408

Query: 471 KQGEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINK 530
           +  E+Q EID L            +    I++L  ++DA+  +L  V  +Q      +  
Sbjct: 409 QNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLAT 468

Query: 531 LQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCA 590
           LQ+QK  +  ++  +N     N + +E      Y   + E+D + S +L ++  IRQ   
Sbjct: 469 LQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIE 528

Query: 591 NERTELSAI 599
            +R EL A+
Sbjct: 529 FQRKELVAL 537

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 38  RDYVSPFRDEQ---EVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDIS 94
           + Y SPFRD Q    +  A +++  R+PT SA S Y N  P++LGYK I    KRAKDI 
Sbjct: 54  KQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113

Query: 95  FPV 97
           FPV
Sbjct: 114 FPV 116

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 87/178 (48%), Gaps = 22/178 (12%)

Query: 359 LTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLR 418
           L+K +YD +    + HN+ +  Y  D   K+ +K  E N  IN L  +IK I+ ++   +
Sbjct: 399 LSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDLKIKSIEKDIIDYK 458

Query: 419 SDTDAKI--EVSENELTRKFFEMTQVHIQKKNQVFKD----TEVIKSQKLSEKDSVLDKQ 472
           +  D+ +   V +N++  + +   +  + KKNQ+ K     T +++S   +   S LD +
Sbjct: 459 AKIDSLMNDNVEKNDIDIENYH--EKMLIKKNQIIKKNDEITYILQSSPPTAAIS-LDTK 515

Query: 473 GEVQKEIDELNIXXXXXXXXCQKWTKDIEELSARIDAKVADLEEVN-----VKQKNTQ 525
             V K+ D             + W  +  +L+ +ID+KV  ++++N     VKQK T+
Sbjct: 516 DAVTKQSD--------CTPLIKDWKSEQSKLNEQIDSKVNVIKQLNKNLADVKQKITE 565

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 350 HVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409
           H+  T   Y +K I+D I      HN W+   +     +   K  E N+++  L  QIK 
Sbjct: 136 HLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKS 194

Query: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTE 455
            K  M  LR      I+++EN LT+ F   TQ    +KN+++K+TE
Sbjct: 195 EKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETE 240

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 19/109 (17%)

Query: 378 IAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFF 437
           I KYKKD    F++ ++E +     L  QI  ++N++ +           SE+EL R   
Sbjct: 624 IDKYKKD----FNESKSEESNIQRDLNLQILNLENKLIE-----------SEDEL-RSLK 667

Query: 438 EMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEV---QKEIDELN 483
           +  ++ I+   + + +  +   + L+EKDS LDK+ EV    +++DELN
Sbjct: 668 DSQRIEIENWKRKYNNLSLENDRLLAEKDSTLDKEHEVSILNRKVDELN 716

>Suva_7.280 Chr7 (486107..486757) [651 bp, 216 aa] {ON} YGL002W
           (REAL)
          Length = 216

 Score = 31.6 bits (70), Expect = 4.9,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 13/84 (15%)

Query: 366 KITLQDRQHNEWIAKYKKDEQQKF--------DDKRAES----NRKINSLRAQIKEIKNE 413
           KI LQ  Q N W+ K K   + +F        D KR ++    + K+N L ++I EI+ E
Sbjct: 104 KICLQS-QVNNWVGKTKTKLEVEFEVGFEAMLDSKRKDTLETLHGKVNILNSKIMEIRRE 162

Query: 414 MAQLRSDTDAKIEVSENELTRKFF 437
              +R   ++  ++SE+  TR  +
Sbjct: 163 QQLVREREESFRDISESVNTRAMW 186

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 68/121 (56%), Gaps = 17/121 (14%)

Query: 351 VVKTKDG---YLTKVIYDKITLQDRQHNEWIAKY--KKDEQQ-----KFDDKRAESNRKI 400
           V++ KDG   Y +K ++D I  +++ H++ + K   K DE+      ++D + +  N KI
Sbjct: 196 VLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKI 255

Query: 401 NSLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQ 460
           +    +I+++ ++++  +  +D K   ++N L    F+MT+ +   K +++ + E IK+Q
Sbjct: 256 DIENEKIRKLNSKISHFKDFSDFK--STKNYL----FKMTEYN-NTKTRLYGEIEAIKNQ 308

Query: 461 K 461
           +
Sbjct: 309 R 309

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%)

Query: 359 LTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLR 418
           +TK  YDK+   ++ H  W+     +    ++ K      K+N L  QI      ++ ++
Sbjct: 404 ITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIK 463

Query: 419 SDTDAKIEVSENELTRKFFEM 439
            DT    E+++  LT K F++
Sbjct: 464 KDTLKNKELNDAILTNKRFQL 484

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,137,909
Number of extensions: 2014972
Number of successful extensions: 19759
Number of sequences better than 10.0: 951
Number of HSP's gapped: 19350
Number of HSP's successfully gapped: 1541
Length of query: 700
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 583
Effective length of database: 40,065,477
Effective search space: 23358173091
Effective search space used: 23358173091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)