Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055903.491ON34434416150.0
KLTH0F14806g3.491ON3583579491e-127
Kwal_55.212273.491ON3763759251e-123
Skud_16.4433.491ON4202848861e-117
Suva_16.4773.491ON4232788761e-115
Smik_16.4013.491ON4272948731e-114
YPR148C3.491ON4352978501e-111
SAKL0F02794g3.491ON3972717991e-104
ZYRO0D10010g3.491ON3822527663e-99
KLLA0E04621g3.491ON3893877552e-97
Kpol_1017.73.491ON3783817455e-96
Ecym_12383.491ON3933857318e-94
NCAS0F035403.491ON4442556942e-87
NDAI0B058503.491ON4732906918e-87
TPHA0D032703.491ON3884016841e-86
AFR309C3.491ON3643636732e-85
TBLA0D029803.491ON4432706192e-76
KAFR0G036803.491ON4152575451e-65
CAGL0L08492g3.491ON3852514933e-58
KNAG0A079303.491ON4522744922e-57
TDEL0H022407.221ON3381992245e-20
Kwal_47.181487.221ON3232872183e-19
KLTH0A03894g7.221ON3231992033e-17
ZYRO0D16522g7.221ON3582942044e-17
Kpol_478.227.221ON3502172025e-17
KLLA0E04511g7.221ON3022441981e-16
SAKL0F08162g7.221ON3301991964e-16
TPHA0C012307.221ON3052281935e-16
Kpol_1070.197.221ON3112961936e-16
Ecym_43777.221ON3332371938e-16
KNAG0D017607.221ON3421991921e-15
ADL115W7.221ON3332361911e-15
CAGL0L00891g7.221ON3412851875e-15
NDAI0A026607.221ON3642001868e-15
TBLA0D042007.221ON3312081788e-14
Suva_9.1597.221ON3252031752e-13
KAFR0I019507.221ON3301991733e-13
Smik_9.1507.221ON3262021672e-12
YIL041W (GVP36)7.221ON3262031611e-11
Skud_9.1287.221ON3292031592e-11
TBLA0B015807.221ON3862091593e-11
NCAS0A133807.221ON3292001556e-11
TPHA0B027507.221ON3631931504e-10
KAFR0E041804.327ON101360686.6
KNAG0I002303.567ON57167669.4
KAFR0C040502.624ON39067669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05590
         (344 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   626   0.0  
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   370   e-127
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   360   e-123
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   345   e-117
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   342   e-115
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   340   e-114
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   332   e-111
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   312   e-104
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   299   3e-99
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   295   2e-97
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   291   5e-96
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   286   8e-94
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   271   2e-87
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   270   8e-87
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   268   1e-86
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   263   2e-85
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   243   2e-76
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   214   1e-65
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   194   3e-58
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   194   2e-57
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    91   5e-20
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    89   3e-19
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    83   3e-17
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    83   4e-17
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    82   5e-17
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    81   1e-16
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    80   4e-16
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    79   5e-16
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    79   6e-16
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    79   8e-16
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    79   1e-15
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    78   1e-15
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    77   5e-15
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     76   8e-15
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    73   8e-14
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    72   2e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    71   3e-13
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    69   2e-12
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    67   1e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    66   2e-11
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    66   3e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    64   6e-11
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    62   4e-10
KAFR0E04180 Chr5 complement(835423..838464) [3042 bp, 1013 aa] {...    31   6.6  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...    30   9.4  
KAFR0C04050 Chr3 (809102..810274) [1173 bp, 390 aa] {ON} Anc_2.6...    30   9.8  

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/344 (89%), Positives = 309/344 (89%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDD 60
           MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDD
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDD 60

Query: 61  KSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFG 120
           KSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFG
Sbjct: 61  KSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFG 120

Query: 121 TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVSNVAKM 180
           TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHG        VSNVAKM
Sbjct: 121 TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGDEDEEDEDVSNVAKM 180

Query: 181 FDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY 240
           FDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY
Sbjct: 181 FDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY 240

Query: 241 EIKLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXXXXXXXXXXXFVSNTTAAVEIMGE 300
           EIKLKETENAKKSTETDEA                           FVSNTTAAVEIMGE
Sbjct: 241 EIKLKETENAKKSTETDEASKDETKTEEEPPKTSEEDKLLEELEDEFVSNTTAAVEIMGE 300

Query: 301 VTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESDDN 344
           VTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESDDN
Sbjct: 301 VTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESDDN 344

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  370 bits (949), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 238/357 (66%), Gaps = 14/357 (3%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58
           MS Y   FSLNK+T+++ N AHKTQDTL++AIAN+   DPQAKLSLKAR  YLQETLGTI
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118
           +D SKLPPQYQ LEKK D+LEK C+R+L+VT+T+EVEGYDYPPNL+ES+SDWWS NK+G 
Sbjct: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 119 FG---TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH-----GXXXXX 170
           FG   + K EK    + D  +A +PRSF+QAISKAA D   V T L+             
Sbjct: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDEE 180

Query: 171 XXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEE 230
              ++++ KMF++WS C  N+D+ K EMD+++ KEFN KL   + E FK     RKKVE+
Sbjct: 181 DEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240

Query: 231 SRLKFDTVRYEIKLKE----TENAKKSTETDEAXXXXXXXXXXXXXXXXXXXXXXXXXXX 286
           SRLKFDT+RYE+K+ E    TE A + TE+ +                            
Sbjct: 241 SRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQEDEAEASKDSDSSDEAQKLLEKLEDE 300

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESDD 343
           FVSNTT AVE MGE+T+SAEI+ L KLF NFQL+Y++QCVQ +E S+  L  LE D+
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGDE 357

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  360 bits (925), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/375 (50%), Positives = 234/375 (62%), Gaps = 32/375 (8%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58
           MS Y   FS NK+TDTL NAAHKTQDTL++AIAN+   DPQA LSLKAR  YLQETLGTI
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118
           +D SKLPPQYQ LEKK D+LEK C+R+L+VT+TFEVEGYDYPPNL+ES+SDWWS NK+G 
Sbjct: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 119 FG---TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL-----QEHGXXXXX 170
           FG   + K +K    ++    A +PRSF+QAI+KAA D   V   L     Q        
Sbjct: 121 FGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDE 180

Query: 171 XXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEE 230
              ++ + KMF +WS+C   ID+GK EMD+++ KEFN KL  +I E FK     R+KVE+
Sbjct: 181 DEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240

Query: 231 SRLKFDTVRYEIKLKET----------------------ENAKKSTETDEAXXXXXXXXX 268
           SRLKFDT+RYE+KL E                       E A  +  ++E          
Sbjct: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300

Query: 269 XXXXXXXXXXXXXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQE 328
                             FVSNTT AVE MGE+T+SAE+L L KLF NFQLVY RQCVQ+
Sbjct: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360

Query: 329 VEASLKILGALESDD 343
           +EASL  L  LE +D
Sbjct: 361 LEASLSTLNELEGED 375

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  345 bits (886), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/284 (60%), Positives = 210/284 (73%), Gaps = 28/284 (9%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIA----NVSDPQAKLSLKARTRYLQETLG 56
           MSGY S FSLNKITD++A AAHKTQDTLN+A+A    N++DP+ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116
           T+ D SKLPPQYQ LEKKSD+LEK C+RILLV++TFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 117 GWFGTKKPEKT-KNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXX-- 173
           GWFG++K E   K   S+  DAFLPRSF+QAISKAA DC   F +L++            
Sbjct: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180

Query: 174 ---------------------VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEK 212
                                +SN+ K+FDSWS CYKNIDEGK EMDS + KEFN KLEK
Sbjct: 181 NETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEK 240

Query: 213 IINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETENAKKSTET 256
           +IN+DFKKVH  RKKVE+SRLKFDT+RYE+K KE +   +  ET
Sbjct: 241 LINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAET 284

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 50/54 (92%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           FVSNTT AVEIM E+T+S++ILGL KLFQNFQLVYFRQCVQEVEA+LK+L +LE
Sbjct: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLE 419

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  342 bits (876), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 175/278 (62%), Positives = 204/278 (73%), Gaps = 37/278 (13%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIAN----VSDPQAKLSLKARTRYLQETLG 56
           MSGY      NKITD++A AAHKTQDTLNSA+AN    ++DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116
           T+ D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 117 GWFGTKKPEK-TKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXX-- 173
           GWFG+KK E  +K   S+  D FLPRSF+QAISKAA DC S F NL+++           
Sbjct: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEA 175

Query: 174 -------------------------VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNT 208
                                    +SN+ K+FDSWS CYKNIDEGK EMDSM+ KEFN 
Sbjct: 176 KKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235

Query: 209 KLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKE 246
           KLEK+INEDFKKVH  R+KVEESRLKFDT+RYE K KE
Sbjct: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKE 273

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 48/55 (87%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALES 341
           FVSNTTAAVE M E+T+S+EIL L KLFQNFQLVYFRQC QEVEA+LK+L  +E+
Sbjct: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 184/294 (62%), Positives = 215/294 (73%), Gaps = 35/294 (11%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56
           MSGY S+FSLNKITD++A AAHKT DTLN+A+AN +    DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116
           TI D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 117 GWFGTKKPEKT-KNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL-------------- 161
           GWFG+KK E T K   S+  DAFLPRSF+QAISKAA DC   F NL              
Sbjct: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180

Query: 162 ----QEHGXX-----------XXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEF 206
               Q  G                   +SN+ K+FDSWS CYKNIDEGK EMDSM+ KEF
Sbjct: 181 TKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240

Query: 207 NTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETE-NAKKSTETDEA 259
           N KLEK+IN+DFK+VH  RKKVE SRLKFDT+RYE+K KE + +A+K   T+EA
Sbjct: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEA 294

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALES 341
           FVSNTTAAVE M E+ +S+EILGL KLFQNFQLVYFRQCVQEVEA+LK+L  LE+
Sbjct: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/297 (61%), Positives = 211/297 (71%), Gaps = 38/297 (12%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56
           MSGY S FSLNKITD++A AAHKTQDTLN+A+AN +    DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116
           T+ D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 117 GWFG-TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH----------- 164
           GWFG  K    TK   S+  DAFLPRSF+QAISKAA DC   F NL+ +           
Sbjct: 121 GWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKES 180

Query: 165 ---------------------GXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIR 203
                                         +SN+ K+FDSWS CYKNIDEGK EMDSM+ 
Sbjct: 181 IKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240

Query: 204 KEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETE-NAKKSTETDEA 259
           KEFN KLE +IN+DFKKVH  RKKVEESRLKFDT+RYE+K KE E  AKK+  T EA
Sbjct: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEA 297

 Score = 95.5 bits (236), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (90%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           FVSNTTAAVE M E+T+S+EILGL KLFQNFQLVYFRQCVQEVEA+LK+L  LE
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  312 bits (799), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/271 (57%), Positives = 200/271 (73%), Gaps = 13/271 (4%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58
           MSGY S+FSL+K+T+++++AAHKTQD L++AIAN+   DPQAKLSLK R  YLQETLG I
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDG- 117
           DD SKLPPQYQ LEKK D+LEK C+R+L+VT+TFEVEGYDYPPNL+ESISDWW  N+ G 
Sbjct: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 118 --WFGTKKPE--KTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQE------HGXX 167
             +   KK E  + K +  D ++ FLPRSF+QA+SKAA D   V   L++          
Sbjct: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDED 180

Query: 168 XXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKK 227
                 ++++  MF++WSKC + ID+ K EMDS++ KEFN KL+K+INEDFKKVH+ RKK
Sbjct: 181 EDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240

Query: 228 VEESRLKFDTVRYEIKLKETENAKKSTETDE 258
           VEESRLKFDT+RYE+ LKE E  K   + +E
Sbjct: 241 VEESRLKFDTLRYELNLKEKEQQKAKAKEEE 271

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 47/56 (83%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESD 342
           FVS+TT AVEIMGE+T+S+EIL L KLF  FQL+Y RQCVQE+EAS KIL  L+++
Sbjct: 342 FVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  299 bits (766), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 146/252 (57%), Positives = 189/252 (75%), Gaps = 9/252 (3%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58
           MS Y S+FS   + D++ANAAH+TQD L++A+ANV+  DPQ +LS+K RTRYL+ETLG +
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118
           D+ SKLPPQY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ES SDWWS +K+GW
Sbjct: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 119 FGTKKPEKTKND--SSDGS--DAFLPRSFSQAISKAANDCNSVFTNLQ--EHGXXXXXXX 172
           FG+ K ++       +DGS  D  +PRSF+QAI+KA+++C   + N Q  E         
Sbjct: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 180

Query: 173 XVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESR 232
            V N+ +MF++ S CY+NIDEGK EMD  I +EFN KLE+++N DFKK+H  R KVE SR
Sbjct: 181 DV-NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSR 239

Query: 233 LKFDTVRYEIKL 244
           LKFDT+RYE++L
Sbjct: 240 LKFDTMRYEMRL 251

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALES 341
           FVSNT+ AVE M  + E +EIL L KLFQN QLVY+RQCVQE+EASLK L  LE+
Sbjct: 328 FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  295 bits (755), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 221/387 (57%), Gaps = 48/387 (12%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTIDDKS 62
            S  SLN ITD+++NAA +TQ+  +SAI  +   DP+ +LS+  R   LQETLGT+ D S
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW--FG 120
           +LP QY+ LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNLTES +DWWS NKD    F 
Sbjct: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFS 121

Query: 121 TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL--------QEHGXXXXXXX 172
            KK E +        +  LPRSF+QA+SKAA D   +   L        QE         
Sbjct: 122 KKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQK 181

Query: 173 XV-----------------------SNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTK 209
                                     N+ K F+SW+KC  +ID+ K EMDS++ KEFN K
Sbjct: 182 PAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNAK 241

Query: 210 LEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLK-------------ETENAKKSTET 256
           L K+I  DFKK H  R KV+++RL FDT+R+EIKLK             E + A ++ ET
Sbjct: 242 LSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKKVATETPET 301

Query: 257 DEAXXXXXXXXXXXXXXXXXXXXXXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQN 316
            E                            FVS T+  VE +GE+T+S+EI+ L KLF N
Sbjct: 302 PEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHN 361

Query: 317 FQLVYFRQCVQEVEASLKILGALESDD 343
           FQL++++QCV+ +E  L++L +L+S+D
Sbjct: 362 FQLIHYKQCVKSLEEDLEVLNSLDSED 388

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  291 bits (745), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 167/381 (43%), Positives = 226/381 (59%), Gaps = 50/381 (13%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVS--------DPQAKLSLKARTRYLQETLG 56
            S FS++K+TD+++N A KTQ+ L +A++NV+        DP  KLS+K++ R++QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 57  TIDDK-SKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNK 115
           TI+D+ SKLPP Y  LE K+DA+EK  KR+L VT+T+E EGYDYPPNLTES+SDWW+ N 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT-ND 120

Query: 116 DGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDC--------NSVFTNLQEHGXX 167
           D    T   E  +N  S+ S  FLPRSF+QAIS A+ D         N++  N ++    
Sbjct: 121 DNVTNT--DENDENIQSNKS--FLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDDEEE 176

Query: 168 XXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKK 227
                  S++ K+F+S   CY+NID GK EMD +I  EFN KL+ +IN +FK VH  RK 
Sbjct: 177 EEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKS 236

Query: 228 VEESRLKFDTVRYEIKLKE----------------------------TENAKKSTETDEA 259
           VE SRLKFDT+RYE+K+KE                             E +KK T   E 
Sbjct: 237 VENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEASKKETPKKEI 296

Query: 260 XXXXXXXXXXXXXXXXXXXXXXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQL 319
                                      FVSNT  AVE M E+T++++I+ L KL+QNFQL
Sbjct: 297 NKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQL 356

Query: 320 VYFRQCVQEVEASLKILGALE 340
           VY++QC+QE+E++LKIL  LE
Sbjct: 357 VYYKQCIQEIESNLKILNGLE 377

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  286 bits (731), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 217/385 (56%), Gaps = 46/385 (11%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNS-------AI--ANVSDPQAKLSLKARTRYL 51
           MS Y SNFSL+KI  T+  AAHKTQ  LN        AI   N+ DPQ  LSL+ R   L
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 52  QETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWW 111
           QETLGTI D SKLPP+YQ LE+K DA EK C RIL+V++TFEV+GYDYPPNL ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 112 --SLNKDG--WFGTKKPEKTKNDSSDGSDA-------FLPRSFSQAISKAANDCNSVFTN 160
             S  KDG  W   KK +  KN +   S A       ++P SF+QAISKAA+D  ++   
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 161 LQEH------GXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKII 214
           L E                V ++  + ++W++   NIDE K +MD  +  EFN KL+ ++
Sbjct: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240

Query: 215 NEDFKKVHASRKKVEESRLKFDTVRYEIKL--------KETENAKKSTETDEAXXXXXXX 266
           N DF KV A RKKVEESRLKFDT+RYE+++        KET    +S + ++        
Sbjct: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300

Query: 267 XXXXXXXXXXXXXXX------------XXXXXFVSNTTAAVEIMGEVTESAEILGLAKLF 314
                                           FVSNTT AV  M ++T+S  +  L KLF
Sbjct: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360

Query: 315 QNFQLVYFRQCVQEVEASLKILGAL 339
            NFQL+Y ++CVQE++ASL ++  L
Sbjct: 361 HNFQLIYHKKCVQELQASLNVINTL 385

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  271 bits (694), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 178/255 (69%), Gaps = 24/255 (9%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKL 64
            SNFSL+KIT++LA AA KT DTL++AI   +DP  KLSL+++ R  QE++GT+ D S L
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTL 61

Query: 65  PPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKP 124
           P QY +LE ++DALEKC +RIL+V++TFE+EGYDYPPNL+ES SDWWSL+          
Sbjct: 62  PEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSS--------- 112

Query: 125 EKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQE---------------HGXXXX 169
           +K K    +    FLPRSF+QAIS +A DC  ++ ++ +               +     
Sbjct: 113 KKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDE 172

Query: 170 XXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVE 229
               V N+ K FDSW+KCYKNID+GK EMDSM+ KEFN KLEK++NE+FKKVH  RK+V+
Sbjct: 173 EDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVK 232

Query: 230 ESRLKFDTVRYEIKL 244
           +SRLKFDTVRYE+K+
Sbjct: 233 DSRLKFDTVRYELKV 247

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (88%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           FVS+T +AVE+M E+T+S+EI+GL KLFQNFQLVY+RQCVQE+EA+LK L  LE
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  270 bits (691), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 182/290 (62%), Gaps = 46/290 (15%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKL 64
            S+FSL+KIT+++ NAA K  +TLN+AI   +DPQ KLS+K++TR  QE LGTI D SKL
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHDISKL 61

Query: 65  PPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKP 124
           P QY+SLE K+D+LEK  KRILLV++TFE+EGYDYPPNLTES SDWW++ K      KK 
Sbjct: 62  PDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKKQ 121

Query: 125 --------EKTKNDSSDG-----------SDAFLPRSFSQAISKAANDCNSVFTNL--QE 163
                     T ND  +            S +FLPRSF+QAISK+A DC  ++  L  QE
Sbjct: 122 ISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQE 181

Query: 164 HGXXXXX-------------------------XXXVSNVAKMFDSWSKCYKNIDEGKHEM 198
                                              + N+ K F+SWS CYKNID+GK EM
Sbjct: 182 TATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKSEM 241

Query: 199 DSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETE 248
           DSM+ KEFN KLE +IN +FKKV+  RKKV +SRLKFDTVR+EIK+KE E
Sbjct: 242 DSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEE 291

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           FVS+T +AVE+M E+TES+ I+GL KLFQNFQLVY+RQCVQE+EA+LK L  L+
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  268 bits (684), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/401 (40%), Positives = 216/401 (53%), Gaps = 82/401 (20%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVS--------DPQAKLSLKARTRYLQETLG 56
            SNFSL+K+TD+++N A KTQ+   +AI +++        DP  KLS++AR+RY+QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 57  TIDDK-SKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNK 115
           T+DD+ SKLP QY  LE K+D++EK  KR+LLVT TF  EGYDYPPNLTESISDWW+   
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118

Query: 116 DGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXX---- 171
                         D +  +  FLPRSF+QA++KA +D   + T+  E            
Sbjct: 119 -------------EDETTENKNFLPRSFAQALAKAYSDS-KLITDKAERNIKLQTSPKNT 164

Query: 172 -----------------------XXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNT 208
                                    +  + K F + S  + NID GK+EMD+MI  EFN 
Sbjct: 165 GTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNK 224

Query: 209 KLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKET--------------ENAKKST 254
           KLE ++  +FK+V   R+ VE SRLKFDT+RY++KLKE               E  KK +
Sbjct: 225 KLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEKKES 284

Query: 255 ETDEAXXXXXXXXXXXXXXXXXX---------------XXXXXXXXXFVSNTTAAVEIMG 299
           ET E                                           FVSNT++AVE M 
Sbjct: 285 ETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKME 344

Query: 300 EVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           E+T+SA+IL L KLFQNFQLVY+RQCVQE+E +LK +  LE
Sbjct: 345 ELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  263 bits (673), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/363 (42%), Positives = 206/363 (56%), Gaps = 25/363 (6%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQ-------DTLNSAIANVS--DPQAKLSLKARTRYL 51
           MS Y    SL+K+ +TL NAA KTQ       + L  AI N+   DP+  LSLK R R L
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 52  QETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWW 111
           QETLG+  D S+LPPQY  LE+K DA+E+ CK+IL+V++TFEVEGYDYPPN TESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 112 SLN-------KDGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH 164
           + +       K G  GT K ++ K   + GS    P SF+ A+ +AA     +   L+E 
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD--PPSFAHALHRAAKGSQGIIQELKEQ 178

Query: 165 GXXXXXXXX-----VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFK 219
                         V ++ KMF +W+    N+D  K EMD  + KEFN KL+ ++  +FK
Sbjct: 179 AEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238

Query: 220 KVHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXX-- 277
           K H  R+KVEESRL FDT++YE   ++   AKK  E  +A                    
Sbjct: 239 KGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFY 298

Query: 278 XXXXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILG 337
                    FVSNT  AVE M  + ++ +++ L KLFQNFQLVY R+CVQE+E SL  L 
Sbjct: 299 AQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLT 358

Query: 338 ALE 340
           +LE
Sbjct: 359 SLE 361

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  243 bits (619), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 176/270 (65%), Gaps = 29/270 (10%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56
           MSGY SNFSL+K+ D+L +AA KTQDTL++AI NV+    DPQ +L+L ++  YLQE++G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116
            I++ SKLP QY +LE+K+DALEK  KRIL+VT TFE+EGYDYPPNL+ESIS+WW LN  
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW-LNDP 144

Query: 117 GWF-------------GTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQE 163
             F              +  P+      SD   +FLPRSF  AISKA++D +++ TNL  
Sbjct: 145 LAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNN 204

Query: 164 H-----------GXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEK 212
           +                    +  + K+FDSWS C KNID+ K + D +I K+FN KL  
Sbjct: 205 NEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTS 264

Query: 213 IINEDFKKVHASRKKVEESRLKFDTVRYEI 242
           +++ +FK V A R KV+++RLKFDT+RYEI
Sbjct: 265 LLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 46/53 (86%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGAL 339
           FVS+T+AAVE M E+TES++IL L KLFQNFQL++++QC++EVE ++K+L  L
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  214 bits (545), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 158/257 (61%), Gaps = 27/257 (10%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDK--S 62
            SNF+ +KIT++++ AA   Q  +N  I    D Q KL  K   R+ QE +G I DK  S
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTIL-TPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60

Query: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTK 122
           KLP  Y +LE K DALEK  KR+L+VT+T+E+EGYDYPPNL+ES++DWW      W   K
Sbjct: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------WSDLK 114

Query: 123 KPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVS------- 175
           K +K +  SS     F+  SF  AISKAA D  S+  +L+E                   
Sbjct: 115 KSKKHQEKSS-----FMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEE 169

Query: 176 ------NVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVE 229
                 N+ ++F+S S CYKNID+ K EMD+MI KEFN KLE +IN DFKKV   R KV+
Sbjct: 170 DDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQ 229

Query: 230 ESRLKFDTVRYEIKLKE 246
           +SRL+FDT+R+EIKLKE
Sbjct: 230 DSRLEFDTLRHEIKLKE 246

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (55%), Gaps = 7/143 (4%)

Query: 204 KEFNTKLEKIINEDFKKVHASRKKVEESRLKFD-----TVRYEIKLKETEN-AKKSTETD 257
           KE +TK E++ NE+  K    +KK+ E +   D     TV  + + KETE  AK+ +  +
Sbjct: 274 KEESTKEEQV-NEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKE 332

Query: 258 EAXXXXXXXXXXXXXXXXXXXXXXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNF 317
           EA                           FVSNT AAVE+M E+TE++E++ L KLFQNF
Sbjct: 333 EAPKEDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNF 392

Query: 318 QLVYFRQCVQEVEASLKILGALE 340
           QL++++QCVQE+E ++K L  LE
Sbjct: 393 QLIHYKQCVQEIENNMKFLDQLE 415

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  194 bits (493), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 147/251 (58%), Gaps = 27/251 (10%)

Query: 8   FSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQ 67
           F+L  IT +++           S +   +DP+ KLS+KA+TR+LQE +G   D SKLPPQ
Sbjct: 4   FNLESITQSISEGTQ-------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQ 56

Query: 68  YQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKT 127
           Y  LEKK D++EK  KRIL+VT+T+E+EGYDYPPN++ES+S WW   +  WF   +  K 
Sbjct: 57  YVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKE--WFNISELTKN 114

Query: 128 -----KNDSSDGSDAFL-----------PRSFSQAISKAANDCNSVFTNLQEHGXXXXXX 171
                 N    G++A             P SF+ AI++A  D   +F +++         
Sbjct: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIE--TKDEDEK 172

Query: 172 XXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEES 231
             +  + K+F  WS C+  I + K EMD M+ KEFN KLE  + ++F+K+H  R KVEES
Sbjct: 173 EDIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEES 232

Query: 232 RLKFDTVRYEI 242
           RL FDT+RYE+
Sbjct: 233 RLNFDTMRYEV 243

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (77%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340
           FVSNTT AVE+M EV+E++E+L L KLFQ FQL Y + CV+ +E SLK L A++
Sbjct: 331 FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  194 bits (492), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 154/274 (56%), Gaps = 49/274 (17%)

Query: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTI--DDKS 62
            SNFSL+K+T T+ NAA   QDT+++ I +  D Q KL     TRY QE +GTI  D+ +
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS-PDAQTKLQFLKTTRYFQEKVGTISEDEIA 60

Query: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTK 122
           KLP  YQ L++KS+A+EK  KR+L+VT+TFE+EGYDYPPN+TES++ WW  N+D      
Sbjct: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED------ 112

Query: 123 KPEKTKNDSSD-GSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXX----------- 170
             E  K  + D G  + L RSF+ AI KA  D   + ++L+E                  
Sbjct: 113 --ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKREEEA 170

Query: 171 ------------------------XXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEF 206
                                      ++N+   F  WS CYKNID+ K EMDSMI KEF
Sbjct: 171 EAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEF 230

Query: 207 NTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY 240
           N KL  ++  DFK VH    +V++SRL+FDT+R+
Sbjct: 231 NQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (83%)

Query: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESD 342
           FVSN TAAVE M E+T+S+E++ L KLFQN QLV++RQCVQE+EAS+K L  LE++
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 90.9 bits (224), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 98/199 (49%), Gaps = 21/199 (10%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE+K D ++   +  L VT  +E E YDYP  +TES++
Sbjct: 42  RLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVN 101

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           D+  +        K  E +   S+  +   L        PR+ + A+SK +   +    +
Sbjct: 102 DFSKI-----VAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLNH 156

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           + +H          + VA +   +S     + + + + D+MI+  FN +L+  +  +FKK
Sbjct: 157 IGDHDE--------AQVASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKK 208

Query: 221 VHASRKKVEESRLKFDTVR 239
              +RK VE  RL++D  R
Sbjct: 209 AQKARKDVEYKRLQYDVAR 227

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 127/287 (44%), Gaps = 44/287 (15%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP  Y  LE K D ++   +  L VT+ +E E YDYP N+ +S++
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           ++ S+      GTK  E ++  S++ + + L        P++ + A+SK A   +S + N
Sbjct: 121 EFSSI-----VGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVAL-TSSEYLN 174

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
            +  G         S V+     +S     I + +   D++I+ +FN KL   + +D  +
Sbjct: 175 -KSPGAED------SEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNR 227

Query: 221 VHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXXXXX 280
              +RK VE  RL++D  R  +      NA+   E                         
Sbjct: 228 AQKARKNVENKRLQYDIARANLA-----NARPEKEA------------------SLRVQM 264

Query: 281 XXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQ 327
                 F   T  AV IM +V ES+E+L   +     Q  Y++Q  +
Sbjct: 265 ESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 21/199 (10%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D +    +  L VT+ +E E YDYP N+ +S++
Sbjct: 61  RLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           ++ S+        K  + ++  S++ + + L        P++ + A+SK A   +S + N
Sbjct: 121 EFSSV-----VAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALSKVAL-TSSEYLN 174

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
               G         S V+     +S     + + + + D++I+  FN KL  I+  D  +
Sbjct: 175 KSVGGDD-------SEVSNALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNE 227

Query: 221 VHASRKKVEESRLKFDTVR 239
              +RK VE  RL++D  R
Sbjct: 228 AQKARKNVEHKRLQYDIAR 246

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 121/294 (41%), Gaps = 46/294 (15%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           RY+QE LG   D S++P +Y  L  K DA++      L VT+ ++ E YDYP  + ESI+
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           ++         G+K  E +   S+  + + L        P++ + A+S+ +   +    +
Sbjct: 97  EF-----SRTVGSKIQELSHASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECMEH 151

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           L  H            +A     +S     + + +   DS+++  FN KL + I+ + K+
Sbjct: 152 LSTHDDAL--------LASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKR 203

Query: 221 VHASRKKVEESRLKFDTVRYEI-KLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXXXX 279
            H  R+ VE  RL +D  R  + K K  + A+   + + A                    
Sbjct: 204 AHRVRRDVENKRLTYDASRTHLEKAKPEKEAQLRVQMETA-------------------- 243

Query: 280 XXXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASL 333
                  F   T  A+ +M EV   A  + L +     Q  Y     Q ++A L
Sbjct: 244 ----EEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETAAQRMQAFL 293

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 82.4 bits (202), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 101/217 (46%), Gaps = 22/217 (10%)

Query: 23  KTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCC 82
           KTQ+ L S I  V+        ++  R ++E LG +DD S LP +Y  LE K D  +   
Sbjct: 20  KTQE-LTSTIPTVA--------QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVY 70

Query: 83  KRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKTKNDSSDGSDAFLPRS 142
           +  L +T  +E E YDYP   +ES++++         G K  E +   S++GS    PR+
Sbjct: 71  EHFLKITSIYERESYDYPKEFSESVNEFTD-----SIGNKMYEFSNGVSTEGSSGKTPRT 125

Query: 143 FSQAISKAANDCNSVFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMI 202
            + A+SK +   +  F  L +             +A +  +      +I E +   D  I
Sbjct: 126 LNYAVSKVSMGASEQFQKLHDTDDK--------RIANLLTNVGNAEASIAEARLLQDHSI 177

Query: 203 RKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVR 239
           + +FN +L + I +  ++    RK+V   RLK+D  R
Sbjct: 178 QAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIAR 214

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 114/244 (46%), Gaps = 22/244 (9%)

Query: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKART--RYLQETLGTI 58
           MS Y  +FS  K+ +   + + K Q+          D +  L L A +  R LQE LG +
Sbjct: 1   MSQYFDSFS-KKVQELSTSVSQKAQEA--QLDQKFKDLKTNLPLLANSTQRMLQEKLGQV 57

Query: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118
            D S+LP +Y  LE + + ++   +  L VT+ +E E YDYP N+ ES+ ++  L     
Sbjct: 58  TDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGKL 117

Query: 119 FGTKKP---EKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVS 175
               K    E+ +N          P++ + A+SK A   +       EH           
Sbjct: 118 HDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSS-------EHVED-------E 163

Query: 176 NVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKF 235
           ++A     +S     I + + + D+MI+ +FN  +++ + +D +    +RK VE+ RL++
Sbjct: 164 SLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQY 223

Query: 236 DTVR 239
           D VR
Sbjct: 224 DVVR 227

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 95/199 (47%), Gaps = 22/199 (11%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE + D +    +  L VT+ +E E YDYP N+ +S++
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           ++          +K  E +   S+D +   L        P++ + A+SK A   +     
Sbjct: 121 EF-----SKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEY--- 172

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           L + G           +A     +S     I + + + D++I+ +FN KL + +  D  K
Sbjct: 173 LSKSGHEDE------TIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNK 226

Query: 221 VHASRKKVEESRLKFDTVR 239
              +RK+VE  RL++D  R
Sbjct: 227 AVKARKEVENKRLQYDIAR 245

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 79.0 bits (193), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 113/228 (49%), Gaps = 30/228 (13%)

Query: 20  AAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQYQSLEKKSDALE 79
            + +TQD L ++I +++         +  R +QE LG + D S+LP +Y  LEK+ D ++
Sbjct: 21  VSERTQD-LGTSIPSIAS--------STQRLVQEKLGNVTDISQLPQEYLELEKEIDTIK 71

Query: 80  KCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL 139
              +  L +T  ++ E YDYP  +++S++D+  L     F +K  + ++  S++ +   L
Sbjct: 72  LVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKL-----FQSKIEDLSRATSAEEAQNIL 126

Query: 140 --------PRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNI 191
                   PR+ + A+SK A   +     LQ+          VS VA     +S     I
Sbjct: 127 VTPGPITEPRTLNYALSKVALTSSESLNQLQDPN--------VSAVASTLLKFSDMQTKI 178

Query: 192 DEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVR 239
            + + + D++I+ + N  +++ ++   +K   SR+ V+  RL++D  R
Sbjct: 179 AQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRLQYDVAR 226

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 79.0 bits (193), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 125/296 (42%), Gaps = 44/296 (14%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE++ D ++   +  L +T  +E E YDYP  +++S++
Sbjct: 41  RLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVN 100

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           D+  +     F  K  E +   S+  +   L        PR+ + A+SK A + +     
Sbjct: 101 DFSKV-----FANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQ 155

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           L +             VA     +S     I + +   D++I+ +FN +L + +  D  K
Sbjct: 156 LADPNE--------GPVADALLKFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGK 207

Query: 221 VHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXXXXX 280
              +RK V+  RL++D  R   KL + +  K+++   E                      
Sbjct: 208 ASKARKDVQYKRLQYDVARS--KLTQAKPEKEASLRVE---------------------M 244

Query: 281 XXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKIL 336
                 F  +T  A  IM EV   ++ L   K     QL YF    Q ++  + +L
Sbjct: 245 ESLEEQFAQSTEDATIIMQEVIADSKFLSSLKELAEAQLSYFETSAQLLKEFMPVL 300

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 79.0 bits (193), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 112/237 (47%), Gaps = 33/237 (13%)

Query: 12  KITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQYQSL 71
           +  D       KTQD L S + +++        +   R +QE LG I D S++P +Y  +
Sbjct: 33  RFKDLSMTVTQKTQD-LTSTLPSIA--------QTTHRMVQEKLGQITDISQMPEEYVHM 83

Query: 72  EKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKTKNDS 131
           EK+ D +    +  L VT+ +E E YDYP +++ES+++            K  E TK  S
Sbjct: 84  EKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVNEI-----SKTVTGKIQELTKATS 138

Query: 132 SDGSDAFL--------PRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVSNV-AKMFD 182
           ++ +   L        P++ + A+SK +   +     L + G         SNV A +  
Sbjct: 139 TEEAQNILISPGPAKDPKTLNYALSKVSLTSSEY---LSKSGSD-------SNVTADILL 188

Query: 183 SWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVR 239
            +S     I + + + D +IR  FN +L++ +N +F     +RK+V+  RL++D  R
Sbjct: 189 KYSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 95/199 (47%), Gaps = 18/199 (9%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LEK+ DAL+   +  L VT  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           +W          T+  E     S+  +   +        P++   A+SK A + + +  N
Sbjct: 102 EW-----SRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDN 156

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           L             + ++     +S     + + + E D+ ++ +FN KL   ++ +  +
Sbjct: 157 L-----DAPRTPRETQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIAR 211

Query: 221 VHASRKKVEESRLKFDTVR 239
             A+RK+V + RL++D  R
Sbjct: 212 AAAARKEVFQKRLQYDVAR 230

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 114/236 (48%), Gaps = 31/236 (13%)

Query: 12  KITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQYQSL 71
           K+ D   + + +TQD L S + +++        +   R +QE LG + D S++P +Y  L
Sbjct: 33  KLKDLSLSVSQRTQD-LTSNLPSLA--------QTTQRRVQERLGQVTDISQMPEEYVEL 83

Query: 72  EKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKTKNDS 131
           E++ D  +      L V++ +E E YDYP ++++S++D+           K  E TK  +
Sbjct: 84  EQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF-----SKTVTGKVQELTKATT 138

Query: 132 SDGSDAFL--------PRSFSQAISKAANDCNSVFTNLQEHGXXXXXXXXVSNVAKMFDS 183
           ++ + + L        P++ + A+SK A   +     L + G            A +   
Sbjct: 139 TEEAQSILISPGPARNPKTLNYALSKVALTSSEY---LSKSGSDDVV------TADILLK 189

Query: 184 WSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVR 239
           +S     I + + + D++I+  FN +L + +N  F +   SRK+V++ RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 117/285 (41%), Gaps = 43/285 (15%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D ++   +  L VT  +E E YDYP  ++ES++
Sbjct: 42  RMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVN 101

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           ++           K  E +K  S+  +   L        P++ + A+SK A        N
Sbjct: 102 EF-----SKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVA-------LN 149

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
             E+          + ++K+  ++S     + + + + D+ I+ +FN  + + + E   +
Sbjct: 150 ASEYLNHSFDDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIAR 209

Query: 221 VHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEAXXXXXXXXXXXXXXXXXXXXX 280
            + +RK V+  RL++D  R  +     +NAK   E                         
Sbjct: 210 ANKARKDVQSKRLQYDVARTNL-----QNAKPEKEAG------------------LRVQM 246

Query: 281 XXXXXXFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQC 325
                 F   T  A  +M EV  SA  L   K     QL Y+ Q 
Sbjct: 247 ETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 97/200 (48%), Gaps = 14/200 (7%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE+K D ++      L VT TFE + YDYP    ES+ 
Sbjct: 45  RMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVI 104

Query: 109 DW----WSLNKDGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEH 164
           ++     S  ++    T   E  +  +++ +    P++ + A+SKA     S+ ++ Q +
Sbjct: 105 EFSKSAVSKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKA-----SLISSEQLN 159

Query: 165 GXXXXXXXXVSN-----VAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFK 219
                     SN     V+ +   +S     I + + + D +I+++FN  L   +N  F+
Sbjct: 160 KQFSTDDDNNSNSDFKLVSSILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFE 219

Query: 220 KVHASRKKVEESRLKFDTVR 239
           +    RK V+  RL++D  R
Sbjct: 220 RAQKVRKDVQNKRLQYDVAR 239

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 97/208 (46%), Gaps = 21/208 (10%)

Query: 45  KARTRYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLT 104
           + + R  QE LG I D S++P +Y  LE + D L+   + +L VTR +E   YD+P +  
Sbjct: 37  QVQQRLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQ 96

Query: 105 ESISDWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL---------PRSFSQAISKAANDCN 155
           ES+ DW         G++  E ++  S+  +   L         PR+ + A+S+A+    
Sbjct: 97  ESVQDW-----SRAIGSRVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAV- 150

Query: 156 SVFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIIN 215
           S  T+    G           ++    ++S     + + +   D+ ++ +FN +L +I+N
Sbjct: 151 STLTSSNMPGPNG------EGLSSGLIAYSDTQAKLAQIRIAQDTQVQTKFNKQLREILN 204

Query: 216 EDFKKVHASRKKVEESRLKFDTVRYEIK 243
               K +  RK V+  R+ +D  R  ++
Sbjct: 205 NPIAKANKYRKDVQYKRVLYDIARTNLQ 232

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 95/203 (46%), Gaps = 29/203 (14%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D ++      L VT  +E   YDYP  + ES++
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAA---NDC-NS 156
           ++ S        +K  E T   S+  +   L        P++ + A+SK A   ++C N 
Sbjct: 97  EFSS-----SLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 157 VFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINE 216
           +F   ++             +A     +S     I + + + D++I+ +FN KL + ++ 
Sbjct: 152 MFPTEEQP------------LASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSF 199

Query: 217 DFKKVHASRKKVEESRLKFDTVR 239
           +  K    RK+V   RL++D  R
Sbjct: 200 EIGKADKCRKEVHSMRLRYDVAR 222

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 93/199 (46%), Gaps = 20/199 (10%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LEKK D+++   +  L VT  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVN 101

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAANDCNSVFTN 160
           D+           K  + +   S+  +   L        P++ + A+SK +   + V   
Sbjct: 102 DF-----SKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASEVINQ 156

Query: 161 LQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKK 220
           +   G         S + +    +S     I + + + D++I+ +FN  L   ++    K
Sbjct: 157 V---GSTPNESALSSKLLE----FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAK 209

Query: 221 VHASRKKVEESRLKFDTVR 239
            +  RK+V+  RL++D  R
Sbjct: 210 ANKFRKEVQNKRLQYDVAR 228

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 92/202 (45%), Gaps = 27/202 (13%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE+K D ++      L VT  +E   YDYP  + ES++
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAA---NDCNSV 157
           ++          +K  E T   S+  +   L        P++ + A+SK A   ++C + 
Sbjct: 97  EF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 158 FTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINED 217
               +E             +A     +S     I + + + D++I+ +FN  L + ++ +
Sbjct: 152 MLPTEEQP-----------LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFE 200

Query: 218 FKKVHASRKKVEESRLKFDTVR 239
             K   +RK V   RL++D  R
Sbjct: 201 IGKADKTRKDVHSMRLRYDVAR 222

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 29/203 (14%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D ++      L VT  +E   YDYP  + ES++
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKAA---NDC-NS 156
           ++          +K  E T   S+  +   L        P++ + A+SK A   ++C N 
Sbjct: 97  EF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 157 VFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINE 216
           +F   ++             +A     +S     I + + + D++I+ +FN  L + ++ 
Sbjct: 152 MFPTEEQP------------LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSF 199

Query: 217 DFKKVHASRKKVEESRLKFDTVR 239
           +  K    RK V   RL++D  R
Sbjct: 200 EIGKADKCRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D ++      L VT  +E   YDYP  + ES++
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL--------PRSFSQAISKA---ANDC-NS 156
           ++          +K  E T   S+  +   L        P++ + A+SK    +++C N 
Sbjct: 97  EF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSECLNK 151

Query: 157 VFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINE 216
           +F   ++             +A     +S     I + + + D++I+ +FN KL + ++ 
Sbjct: 152 MFPAEEQP------------LASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSF 199

Query: 217 DFKKVHASRKKVEESRLKFDTVR 239
           +  K    RK V   RL++D  R
Sbjct: 200 EIGKADKCRKDVHSMRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 101/209 (48%), Gaps = 34/209 (16%)

Query: 51  LQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDW 110
           +QE  G + D S LP +Y  LE++ D+++      L +T  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 111 W--SLNKDGWFGTK--------------KPEKTKNDSSDGS----DAFLPRSFSQAISKA 150
              + ++     TK              +P +T + SS GS    +   PR+ + A+SKA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRT-SVSSVGSINNYNQNSPRTLNNALSKA 119

Query: 151 ANDCNSVFTNLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKL 210
           A     +F   Q             + + +F S+S+    I + + + D +I+K FNT+L
Sbjct: 120 A-----LFAAEQ--------LKMDKDSSTVFHSFSEAESIISDERIKQDKIIQKSFNTEL 166

Query: 211 EKIINEDFKKVHASRKKVEESRLKFDTVR 239
           + ++       +  RK V+  RL++D  R
Sbjct: 167 KNVLTNRIDVANKHRKDVQNKRLQYDISR 195

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 89/200 (44%), Gaps = 21/200 (10%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R +QE LG + D S+LP +Y  LE K D++++     L V+  +E + YDYP    ES+ 
Sbjct: 42  RMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLI 101

Query: 109 DWWSLNKDGWFGTKKPEKTKNDSSDGSDAFL---------PRSFSQAISKAANDCNSVFT 159
           ++          +K  E +   S+  +   L         P++ + A+SK A   +    
Sbjct: 102 EF-----SKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSS---- 152

Query: 160 NLQEHGXXXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFK 219
              EH           + A    ++S     I + + + D +I+++FN  L   +  +  
Sbjct: 153 ---EHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIA 209

Query: 220 KVHASRKKVEESRLKFDTVR 239
           K    RK+V+  RL++D  R
Sbjct: 210 KATKVRKEVQSKRLQYDIAR 229

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 19/193 (9%)

Query: 49  RYLQETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESIS 108
           R ++E LG   D S LP +Y  LE K D +++  +  L VT  +E E YDYP    ES  
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGES-- 94

Query: 109 DWWSLNKDGWFGTKKPEK--TKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGX 166
            +W       F     EK    N S   +   +P++ + A+       N     L E   
Sbjct: 95  -FWE------FTDSVGEKFSALNISEHNNKVKIPKTLNYALHNVFLTANEKVKLLHE--- 144

Query: 167 XXXXXXXVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRK 226
                   +++++   S S+   +I E +   DS+++   N +L++ ++++F++    RK
Sbjct: 145 -----PLDNSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKYRK 199

Query: 227 KVEESRLKFDTVR 239
            V   R  +D  +
Sbjct: 200 AVHHKRFNYDVAK 212

>KAFR0E04180 Chr5 complement(835423..838464) [3042 bp, 1013 aa] {ON}
           Anc_4.327 YLR442C
          Length = 1013

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 101 PNLTESISDWWSLNKDGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISK-AANDCNSVFT 159
           PNL  S+SD  S NK  ++G+ +P   KN   +G     P S   A +K AA + NSV T
Sbjct: 241 PNLQSSLSDNASSNKLAFYGSSQPSNIKN---NGIKLEAPISNKSAHNKLAAFESNSVTT 297

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 23  KTQDTLNSAIANVSDPQAKLSLKARTR-YLQETLGTIDDKSKLPPQYQSLEKKSDALEKC 81
           K +D+    + + SDP ++L  K RT+ Y QE     ++K+K   Q + +EK  +A E+ 
Sbjct: 484 KKEDSAGPTVDSKSDPFSRL--KTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERK 541

Query: 82  CKRILLV 88
            K +LL 
Sbjct: 542 EKELLLA 548

>KAFR0C04050 Chr3 (809102..810274) [1173 bp, 390 aa] {ON} Anc_2.624
           YKL077W
          Length = 390

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 100 PPNLTESISDWWSLNKDGWFGTKKPE----KTKNDSSDGSDAFLP---RSFSQAISKAAN 152
           P    + +  W SLNKDG   T KPE    +TKN   + S  F     R+FS    KA N
Sbjct: 65  PAATPDPLEPWVSLNKDGSPKTIKPELKNGRTKNPHPEYSTYFQTASVRTFSYEELKAHN 124

Query: 153 -DCNSVF 158
            D N V+
Sbjct: 125 MDPNDVY 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,709,652
Number of extensions: 1335099
Number of successful extensions: 4823
Number of sequences better than 10.0: 81
Number of HSP's gapped: 4921
Number of HSP's successfully gapped: 104
Length of query: 344
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 234
Effective length of database: 40,868,139
Effective search space: 9563144526
Effective search space used: 9563144526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)