Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055803.490ON1931939901e-138
ZYRO0D10032g3.490ON2092013601e-42
SAKL0F02816g3.490ON1921933331e-38
YGR129W (SYF2)3.490ON2152153228e-37
Skud_7.4403.490ON2132143174e-36
NCAS0E008203.490ON2021943166e-36
Smik_6.2253.490ON2132183021e-33
KLTH0F14784g3.490ON1951962904e-32
NDAI0G009503.490ON2132032906e-32
Suva_7.4173.490ON2122172898e-32
Kwal_55.212263.490ON1961982809e-31
Kpol_480.153.490ON2072002662e-28
Ecym_12393.490ON1931932503e-26
AFR308W3.490ON1921982425e-25
KLLA0E04643g3.490ON2211922323e-23
TPHA0D042403.490ON2092161878e-17
TBLA0C044703.490ON2222141801e-15
CAGL0I10538g3.490ON2001941668e-14
KNAG0B008203.490ON2071981412e-10
KAFR0C019503.490ON1571891032e-05
TPHA0I014502.145ON632117691.5
AFR519C8.48ON82064682.6
Suva_14.2262.164ON54388664.3
YGR089W (NNF2)3.425ON93685664.5
KLLA0C16797g5.355ON98059655.7
TDEL0F010708.126ON1471150656.2
ZYRO0G08294g6.190ON62478647.8
TDEL0D050403.119ON984131648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05580
         (193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   385   e-138
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   143   1e-42
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   132   1e-38
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   128   8e-37
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   126   4e-36
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   126   6e-36
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   120   1e-33
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   116   4e-32
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...   116   6e-32
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   115   8e-32
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   112   9e-31
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...   107   2e-28
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   100   3e-26
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    98   5e-25
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    94   3e-23
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    77   8e-17
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    74   1e-15
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    69   8e-14
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    59   2e-10
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    44   2e-05
TPHA0I01450 Chr9 complement(326094..327992) [1899 bp, 632 aa] {O...    31   1.5  
AFR519C Chr6 complement(1366768..1369230) [2463 bp, 820 aa] {ON}...    31   2.6  
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...    30   4.3  
YGR089W Chr7 (656960..659770) [2811 bp, 936 aa] {ON}  NNF2Protei...    30   4.5  
KLLA0C16797g Chr3 (1466983..1469925) [2943 bp, 980 aa] {ON} some...    30   5.7  
TDEL0F01070 Chr6 complement(190506..194921) [4416 bp, 1471 aa] {...    30   6.2  
ZYRO0G08294g Chr7 complement(674545..676419) [1875 bp, 624 aa] {...    29   7.8  
TDEL0D05040 Chr4 complement(917424..920378) [2955 bp, 984 aa] {O...    29   8.1  

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  385 bits (990), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/193 (100%), Positives = 193/193 (100%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKI 120
           ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKI
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKI 120

Query: 121 STDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKNKQF 180
           STDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKNKQF
Sbjct: 121 STDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKNKQF 180

Query: 181 NLKLDRQMKETER 193
           NLKLDRQMKETER
Sbjct: 181 NLKLDRQMKETER 193

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  143 bits (360), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 134/201 (66%), Gaps = 13/201 (6%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MDL+     F  LKK+S +++++ RK+   E+K+ +   KP++Y +E      + P    
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEP--SLPT-QD 67

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSR--------SKQN 112
           ++   +LMNY++++YEEW+ +Q+ +  KR   N+Q++AKY+Y+K+L++        ++  
Sbjct: 68  DKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYT 127

Query: 113 NGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADAR--ATPG 170
           NG  + K++ + KT +L +KDD++LV KLA D+ KT  ER+ AR+++ME+++ +  ++ G
Sbjct: 128 NGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGG 187

Query: 171 GYINEKNKQFNLKLDRQMKET 191
           GYINEKNKQFN KLDRQM ++
Sbjct: 188 GYINEKNKQFNEKLDRQMPQS 208

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  132 bits (333), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MDL  +  + K LK++ VDV+++ RK AE+E K     GKPK+YSM   NE  T      
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSM---NEDETFKDQKE 57

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQN---NGNRV 117
           E  R KL+NYS+++YE+W  K+  K     G++ Q+LAKY+Y+K++   +++   N  +V
Sbjct: 58  EDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKV 117

Query: 118 VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKN 177
            K   + K  R+Q+ DD+K + +LA++L K+T+ R++ RKK  EK D+ +T GG+IN+KN
Sbjct: 118 TKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFINDKN 175

Query: 178 KQFNLKLDRQMKE 190
           KQFN KL RQ K+
Sbjct: 176 KQFNEKLSRQFKQ 188

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  128 bits (322), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 127/215 (59%), Gaps = 23/215 (10%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MD   ++ + K+LK++ VDV+I+ RK+A+RE ++ S   KP++YSMED N+      D+ 
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 61  ERRRLKLMNYSMREYEEWDKKQ---KGKEVKRGGANVQELAKYSYEKDL--------SRS 109
              + K  +Y+++EY+ W+++    K  + +RGG +  +LAK SYEK L        + S
Sbjct: 61  SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120

Query: 110 KQNNG------------NRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARK 157
           KQ++              R+ K+  D KT ++ + DD+KLVNKLA  L+  +++R+ ARK
Sbjct: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARK 180

Query: 158 KDMEKADARATPGGYINEKNKQFNLKLDRQMKETE 192
           + M+ A        +IN+KNKQFN KL R+ K +E
Sbjct: 181 RQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE 215

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  126 bits (317), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 130/214 (60%), Gaps = 25/214 (11%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           M+L+ ++ + K LK++ V+V+I+ RK+A+RE ++  L  KPK+YSMED N+ G  PV+ +
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVND-GAEPVEDA 59

Query: 61  ERR-RLKLMNYSMREYEEWDKKQ---KGKEVKRGGANVQELAKYSYEKDL---------- 106
           E   + K  +Y+++EY  W +KQ   K  + +R G +  ++AK SYEK L          
Sbjct: 60  ETSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNK 119

Query: 107 ---------SRSKQNNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARK 157
                    S S   NG  + KI  + KT ++++ DD+KLVNKLA  L+  +++R+ AR+
Sbjct: 120 NENSVNKNDSNSSPKNG-AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARR 178

Query: 158 KDMEKADARATPGGYINEKNKQFNLKLDRQMKET 191
           K ME A   ++   +IN+KNKQFN KL R+ K++
Sbjct: 179 KQMENAKTPSSVESFINDKNKQFNEKLSREPKDS 212

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  126 bits (316), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 131/194 (67%), Gaps = 8/194 (4%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDT--NEMGTRPVD 58
           +DLE    + K+LK+++ D  I+ R + +RE+KD    GKP++Y+M+D   N++ T+  D
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 59  SSERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLS-----RSKQNN 113
           + ++   KLMNY++R+YEEW+KKQK K++K   +++++LA +SY+K +S     R+ +  
Sbjct: 62  ADDKV-AKLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTT 120

Query: 114 GNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYI 173
             R V+I  ++KT ++ ++D++KLVN LA +L KT  +R++  KK ++     ++  GYI
Sbjct: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180

Query: 174 NEKNKQFNLKLDRQ 187
           NE+NK FN KLDR+
Sbjct: 181 NERNKHFNEKLDRE 194

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  120 bits (302), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 135/218 (61%), Gaps = 31/218 (14%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEM--GTRPVD 58
           M+L+ +E R K+LKK+ V+V+I+ RK+A+RE ++ ++  KP++Y+MED N++       +
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 59  SSERRRLKLMNYSMREYEEWDKKQKGKEV---KRGGANVQELAKYSYEK--------DLS 107
           SS++ R    +Y+ +EY  W+++   +++   KR G +  +LAK SYEK        DLS
Sbjct: 61  SSDKDRA--FHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLS 118

Query: 108 R-----SKQNNGN-----RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARK 157
                 +++++ N     R+ +I  D KT ++++ DD KLVNKLA  L+  +++R+ ARK
Sbjct: 119 EYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARK 178

Query: 158 KDMEKADARATPGG---YINEKNKQFNLKLDRQMKETE 192
           + ME A     P G   +IN+KNKQFN KL R+ + +E
Sbjct: 179 RQMESA---VIPSGVESFINDKNKQFNEKLSRESRNSE 213

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  116 bits (290), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 118/196 (60%), Gaps = 7/196 (3%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MDL    +R K+LK++ V ++++ ++   +E K  S   KP +YSM+   E       + 
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTE 58

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGG-ANVQELAKYSYEKDLSRSKQNNGNRVVK 119
           E +  KL+ YSM+++E+W  K++ K  K    A  Q+LAK++Y+K++ + ++N  N+V K
Sbjct: 59  ESKEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEK 118

Query: 120 ---ISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEK 176
              +S + K  ++ VKDD  LV  LA+ L KT  ER+   +K + +     TPGG+INEK
Sbjct: 119 PKKVSINKK-GKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEK 177

Query: 177 NKQFNLKLDRQMKETE 192
           NKQFN K++RQ K+ E
Sbjct: 178 NKQFNDKIERQTKKRE 193

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score =  116 bits (290), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 126/203 (62%), Gaps = 14/203 (6%)

Query: 2   DLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVD--- 58
           +L+  E   K LK+  +D+  + RK A++E K++S   KPK+Y ++   +      D   
Sbjct: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64

Query: 59  ------SSERRRLKLMNYSMREYEEWDKKQKGKEVKR-GGANVQELAKYSYEKDLSR--S 109
                   E+R+ KLMNY++REYEEWDK+QK K+ KR  G+++ ELA ++YEK+LS+  S
Sbjct: 65  LGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNS 124

Query: 110 KQNNGNRVVK--ISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARA 167
           K  N +   K  I  + +  +L VKD+E+L+N L N+L +T ++R++ RKK ++   +  
Sbjct: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSD 184

Query: 168 TPGGYINEKNKQFNLKLDRQMKE 190
             G Y  +KNKQFN KL+R++KE
Sbjct: 185 IAGNYFKDKNKQFNEKLERELKE 207

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  115 bits (289), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 132/217 (60%), Gaps = 30/217 (13%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMED-TNEMGTRPVDS 59
           MDLE + N+ K+LK+R VD +++ RK+A+RE ++ S   KP++YSMED +++   R   S
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 60  SERRRLKLMNYSMREYEEWDKKQKGKE---VKRGGANVQELAKYSYEKDL-SRSKQNNG- 114
            ++ R    +Y+++EY  W++KQK ++    +  G +  +LAK SY+K L + + QN G 
Sbjct: 61  DDKDRA--FHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGK 118

Query: 115 ----------------NRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKK 158
                           +R+ KI  ++ T ++++ DD++LVNKLA+ L+  +++R  ARK+
Sbjct: 119 HESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKR 178

Query: 159 DMEKADARATPGG---YINEKNKQFNLKLDRQMKETE 192
            ME      TP G   +IN+KNKQFN KL R+ + +E
Sbjct: 179 QMENV---KTPSGVESFINDKNKQFNEKLGRESRGSE 212

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  112 bits (280), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 117/198 (59%), Gaps = 11/198 (5%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSM--EDTNEMGTRPVD 58
           MDL    +R K+LK++ +D++++ +    RE K  S   KP +YSM  E   E   + V 
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 59  SSERRRLKLMNYSMREYEEW-DKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRV 117
            +     KL+ YSM EYE+W DK +K      GGA+ Q+LAK +Y+K++ +  + +GNRV
Sbjct: 61  EAN----KLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRV 116

Query: 118 VKISTDAKTN---RLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYIN 174
            K +T  + N   ++ V+DD++LV  L   L KT  ER+   +K + +     T GGYIN
Sbjct: 117 NK-NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYIN 175

Query: 175 EKNKQFNLKLDRQMKETE 192
           EKNKQFN KL+RQ K+ E
Sbjct: 176 EKNKQFNDKLERQTKKRE 193

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score =  107 bits (266), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 120/200 (60%), Gaps = 17/200 (8%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNE---MGTRPV 57
           M+++     FK LK+++VD+ I+ RK+ +   ++     KPK YSME+  E   + T  V
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62

Query: 58  DSSERRRLKLMNYSMREYEEWDKKQ-KGKE---VKRGGAN-VQELAKYSYEKDLSR---- 108
           D ++R    L+NYS+REYEEW+KKQ + KE   V +   N   ++AK++Y+K + +    
Sbjct: 63  DEADR----LLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ 118

Query: 109 -SKQNNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARA 167
            S  +N  ++ KI  D KT ++ V D ++L+ +LA DL +TT+ER+    +  +K   + 
Sbjct: 119 KSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN 178

Query: 168 TPGGYINEKNKQFNLKLDRQ 187
               YINEKNK+FN KL+RQ
Sbjct: 179 ENYSYINEKNKEFNDKLERQ 198

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  100 bits (250), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 115/193 (59%), Gaps = 6/193 (3%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MD++ I +R + LK + VD++I+ RK    E   +    KP++YS+ D          +S
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKI 120
              R KL+NYS+ +YE+WD+K+  K+    G    ++A  +Y+ ++ + ++  G    KI
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKE--KQANFDGTYSGDIAYSTYKNEIKQLRK-GGLTKGKI 117

Query: 121 STD--AKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATP-GGYINEKN 177
           +    +++ ++ ++D+++LVNKLA  L+KT+RERFL  KK ++   A  +  G ++NEKN
Sbjct: 118 TKGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKN 177

Query: 178 KQFNLKLDRQMKE 190
           + FN KL RQ KE
Sbjct: 178 RHFNEKLSRQFKE 190

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 97.8 bits (242), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (54%), Gaps = 19/198 (9%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           M +E I  R + LKK+ VD +I+ RK A  E +     GKP++YSM +         D +
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPAD-EAEADDT 59

Query: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLS--------RSKQN 112
           +  +LKL+NY + +YE+WD+KQK  +    GA++ ELA  +Y  +L         + +  
Sbjct: 60  QSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRAT 119

Query: 113 NGNRVVKISTDAKTNRLQVKDDE-KLVNKLANDLKKTTRERFLARKKDMEKADARATPGG 171
           NG    +IS   K     V DDE +LV KLA  +++T + R   R+K   K   RAT G 
Sbjct: 120 NG----RISASGKV----VLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS 171

Query: 172 YINEKNKQFNLKLDRQMK 189
            +N+KN+ FN KLDR+ +
Sbjct: 172 -LNDKNRHFNEKLDREFR 188

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 94.0 bits (232), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 113/192 (58%), Gaps = 12/192 (6%)

Query: 2   DLESIENRFKDLKKRSVDVAIQIRK--IAEREAKDESLVGKPKIYSMEDTNEMGTRPVDS 59
           DL  IE + K L+K+ V+V+I+ +K  IAE +   E      ++YSM D  E   R   S
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER-----RVYSMADDGEDKARSNKS 92

Query: 60  SERRRLKLMNYSMREYEEWDKK-QKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRV- 117
                +KL NYS+REYE+W+ K Q  +  K    + Q +AK SY+K++    ++  + + 
Sbjct: 93  EPEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLK 152

Query: 118 VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKN 177
             I+ D K   +QV+D+ +LV K+ NDL + +++R++ RK+ ++K +      G+IN+KN
Sbjct: 153 GGITEDGK---VQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKN 209

Query: 178 KQFNLKLDRQMK 189
           K+FN KL+ + K
Sbjct: 210 KRFNAKLNSEFK 221

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 76.6 bits (187), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 113/216 (52%), Gaps = 39/216 (18%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSM-----EDTNEMGTR 55
           MD+ S+ + FK LKK+++D  I+ RK  E + K+   V KPK+YS+      D +     
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 56  PVDSSERRRLKLMNYSMREYEEWDK--KQKGKEV---KRGGANVQELAKYSYEKDLSRSK 110
             ++SER    L+ Y++R+YEEW++  K+K K V       ++ Q+ AK++Y+K++ R K
Sbjct: 61  LTNNSER---ALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMK 117

Query: 111 QNNGNRVVKISTDAKTNR------------LQVKDDEKLVNKLANDLKKTTRERFLARKK 158
           +  G    K +TD +  R            L +KDD+ LVN   +D+ K + +R++ R K
Sbjct: 118 KRQG----KFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMK 173

Query: 159 DMEKADARATPG---------GYINEKNKQFNLKLD 185
            +   +  AT            Y N KNK FN KL+
Sbjct: 174 -LNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 73.9 bits (180), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 107/214 (50%), Gaps = 29/214 (13%)

Query: 2   DLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMED--------TNEMG 53
           D+  +E  +K LK+++ +  I  +          +   KPK+YSM D         N+  
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 54  TRPVDSSERRRLKLMNYSMREYEEWDKKQK--GKEVKRGGANVQ-----ELAKYSYEKDL 106
            R   S E R  KLMNY++REY++W+ KQ     E +    + Q      LAK +Y+KD+
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122

Query: 107 -----------SRSKQNNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLA 155
                      S +K N   +++K   + ++N++ +KDD+ LV +L N+LK  T+   L 
Sbjct: 123 RKLNKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLK--TKSDRLY 179

Query: 156 RKKDMEKADARATPGGYINEKNKQFNLKLDRQMK 189
           +     + +   T  G++N KN++FN KL R+ K
Sbjct: 180 KHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWK 213

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 68.6 bits (166), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 105/194 (54%), Gaps = 10/194 (5%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGT--RPVD 58
           M+LE    + K LKK   D+ I+ R + ++EA+++    KP++YSM D  +     R  D
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 59  SSERRRLKLMNYSMREYEEWD----KKQKGKEVKRGGANVQELAKYSYEK---DLSRSKQ 111
                R  L  Y+++++ +W+    +K+K K   + G  +Q LAK +Y+K   +L R + 
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 112 NNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGG 171
               +  +   +  + ++ +KD+++LV +L+ +LK+T ++R+ + +K +       +  G
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRK-IANDKEHTSLSG 179

Query: 172 YINEKNKQFNLKLD 185
            IN KN QFN  LD
Sbjct: 180 SINAKNLQFNKSLD 193

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 98/198 (49%), Gaps = 32/198 (16%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           M L  + ++FK L + S  + ++IRK        ++ V KPK+YS++   E     +D +
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQ-AAEPSVDGIDGA 86

Query: 61  E---RRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQ--ELAKYSYEKDLSRSKQNNGN 115
           E      +KL+N  +R+ E  + + +G+      A V+   +AK +Y+K+L+   +    
Sbjct: 87  EVVDNVTVKLLNTPLRQLEAREAR-RGENGDDAVARVEGDRVAKDTYKKELALLGR---- 141

Query: 116 RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPG--GYI 173
                    K+ R   +D+   V +L   L   +++R+L RK  M++  AR      GYI
Sbjct: 142 ---------KSTRGTYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYI 189

Query: 174 NEKNKQFNLKLDRQMKET 191
           NEKNKQFN KL R    T
Sbjct: 190 NEKNKQFNKKLQRNGPST 207

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 91/189 (48%), Gaps = 42/189 (22%)

Query: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60
           MD+ ++   F+DL+K+  ++ I+ RK+        S+  KPK YS+ +  E+G    D  
Sbjct: 3   MDMANLREEFRDLRKKCREIKIENRKLI-------SIASKPKTYSIRE-EEIGAEVSDED 54

Query: 61  E--RRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVV 118
           E     +KL+   +RE+E      + KE         ++ + +Y K++     + G R  
Sbjct: 55  EDDSEIIKLLTKPLREFETEAHVAENKE---------DIDRLTYNKEV----MSLGKR-- 99

Query: 119 KISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKNK 178
                          +++ V  L +++ + + ER+  +K   ++   + T  G+INE+NK
Sbjct: 100 ---------------EKRDVESLVSEMNRISDERY--KKGAQKRRRLKDTERGFINEQNK 142

Query: 179 QFNLKLDRQ 187
            FNL+L+++
Sbjct: 143 AFNLRLEKE 151

>TPHA0I01450 Chr9 complement(326094..327992) [1899 bp, 632 aa] {ON}
           Anc_2.145 YNL125C
          Length = 632

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 21  AIQIRKIAEREAKDES--LVGKPKIYSMEDTNEMGTRPVD-SSERRRLKLMNYSMREYEE 77
           A+Q+   A R   ++S  L   P + ++E  +    + ++ SSE   +K ++     YE 
Sbjct: 46  ALQMDGNASRMNPEQSTDLEASPVVDNIESHDGAQRQDIETSSEAHSVKSIDSKAHLYEG 105

Query: 78  WDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKISTDAKTNRLQVKDD 134
              + + +E+K      + L++ S  +  S+  ++N + V ++ T+  T +L +  D
Sbjct: 106 QIGQHRIQEIKSSNNCTESLSRNSTRRSKSQHNEDNQSIVQRVYTNQTTGKLDLPPD 162

>AFR519C Chr6 complement(1366768..1369230) [2463 bp, 820 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL023W
           (BUD27)
          Length = 820

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 51  EMGTRPVDSSERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSK 110
           E G + VD++E   L LM   +RE  + D    G  V+R G NVQ   + +   D     
Sbjct: 166 EAGAKRVDAAEEG-LPLME--IREELDEDGNVTGGSVRRAGGNVQRAGRAASASDAGHKS 222

Query: 111 QNNG 114
           Q+ G
Sbjct: 223 QDTG 226

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 4/88 (4%)

Query: 103 EKDLSRSKQNNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEK 162
           E+D    +  NG   + ++TD     + VK     +N + N       E ++ R     +
Sbjct: 399 ERDWVLQEFRNGGSPIMVATDVAARGIDVKG----INYVINYDMPGNIEDYVHRIGRTGR 454

Query: 163 ADARATPGGYINEKNKQFNLKLDRQMKE 190
           A A  T   +  E+NK    KL   MKE
Sbjct: 455 AGATGTAVSFFTEENKGLGSKLISIMKE 482

>YGR089W Chr7 (656960..659770) [2811 bp, 936 aa] {ON}  NNF2Protein
           that exhibits physical and genetic interactions with
           Rpb8p, which is a subunit of RNA polymerases I, II, and
           III; computational analysis of large-scale
           protein-protein interaction data suggests a role in
           chromosome segregation
          Length = 936

 Score = 30.0 bits (66), Expect = 4.5,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 2   DLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSSE 61
           DL++ E RF+ + +  V +  ++ K+  R  K +  V +    + E+  +  T+ +   E
Sbjct: 835 DLKNSEGRFQKVNQELVQLGSKLDKLNARNEKLQKEVDQ----NAEEIEKFSTQFLSKRE 890

Query: 62  RRRLKLMNYSMREYEEWDKKQKGKE 86
           + R +   Y +RE  +++   KG E
Sbjct: 891 KDRFRRKEYRIREANKFELTIKGLE 915

>KLLA0C16797g Chr3 (1466983..1469925) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P38713 Saccharomyces
           cerevisiae YHR073W OSH3 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 980

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 80  KKQKGKEVKR--GGANVQELAKYSYEKDLSRSKQNNGNRVVKISTDAKTNRLQVKDDEK 136
           KK  G  + R  GG++  +L++ ++   +  S  +N N +++ISTDAK N + + D EK
Sbjct: 32  KKSIGFGIYRRFGGSSTTDLSETNH-GSVKASSNSNTNPLIRISTDAKPN-VALADHEK 88

>TDEL0F01070 Chr6 complement(190506..194921) [4416 bp, 1471 aa] {ON}
           Anc_8.126 YGL173C
          Length = 1471

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 23/150 (15%)

Query: 12  DLKKRSVDVAIQIRKIAEREAKDESLVGKPKIY--SMEDTNEMGTRPVDSSERRRLK-LM 68
           DL KR ++  +  R    RE+K  S+    K+Y  S     ++  RP D SE +  K L 
Sbjct: 783 DLSKRFLNKVVYTRWPFLRESKLVSITDGHKVYEKSEASNAKIVIRPADDSEVKLFKSLK 842

Query: 69  NYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKISTDAKTNR 128
           + ++R Y     K K   +K+  A V+ L       DL+R+ +  G  V   S++ +   
Sbjct: 843 SSTVRNY----SKDKAVSLKKVNAIVKVLPV----TDLARNAR--GAFVKMFSSEPEYYP 892

Query: 129 LQVKDDEKLVNKLANDLKKTTRERFLARKK 158
           LQ+     +V+ +AN+      ERF+ R+ 
Sbjct: 893 LQL-----MVDSVANE-----DERFIEREP 912

>ZYRO0G08294g Chr7 complement(674545..676419) [1875 bp, 624 aa] {ON}
           similar to uniprot|P53154 Saccharomyces cerevisiae
           YGL084C GUP1 Multimembrane-spanning protein and similar
           to uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2
          Length = 624

 Score = 29.3 bits (64), Expect = 7.8,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 65  LKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKIST-- 122
           LK+++Y+M   E+W +KQ   ++      ++ L K S     S S  +N +     S+  
Sbjct: 254 LKILSYNMDFLEKWQEKQSA-DINNSSIALKSLGKVSPPGSRSESPMSNASGSATGSSLE 312

Query: 123 --DAKTNRLQVKDDEKLV 138
               ++N+  +++ E+LV
Sbjct: 313 LHKTRSNQHPLEEKERLV 330

>TDEL0D05040 Chr4 complement(917424..920378) [2955 bp, 984 aa] {ON}
           Anc_3.119 YOL084W
          Length = 984

 Score = 29.3 bits (64), Expect = 8.1,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 23  QIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSSERRRLKLMNYSMREYEEWDKKQ 82
           +IR +A+ EAK++           +DTN    RP  S+E +R  L++ +     E    Q
Sbjct: 720 EIRDVAD-EAKNDF---------EQDTNSGVIRPATSAELKRAHLLSNTDSNTNEGSNDQ 769

Query: 83  KGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVVKIST--DAKTNRLQVKDDEKLVNK 140
             + +     N+ +      E   S ++  + N V K ST   A  N      DE    K
Sbjct: 770 -AESISEKPVNIFD------ENRRSSTESGSSNGVAKKSTLGGASKNESTFVPDENFHKK 822

Query: 141 LANDLKKTTRE 151
              DL+   RE
Sbjct: 823 TYKDLENRPRE 833

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,869,460
Number of extensions: 928004
Number of successful extensions: 4683
Number of sequences better than 10.0: 297
Number of HSP's gapped: 4599
Number of HSP's successfully gapped: 320
Length of query: 193
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 89
Effective length of database: 41,556,135
Effective search space: 3698496015
Effective search space used: 3698496015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)