Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055703.489ON64964933350.0
ZYRO0D10054g3.489ON66466619130.0
NCAS0E008303.489ON67168017070.0
Kpol_480.163.489ON65566116730.0
Suva_7.4163.489ON71371616410.0
SAKL0F02838g3.489ON65466116280.0
TPHA0D042303.489ON65266116160.0
Smik_6.2243.489ON70571016190.0
Skud_7.4393.489ON71371615930.0
TBLA0C044603.489ON69870615820.0
YGR128C (UTP8)3.489ON71371615700.0
KLTH0F14762g3.489ON65066215570.0
AFR307C3.489ON65066015550.0
KLLA0E04665g3.489ON64766014570.0
NDAI0G009603.489ON70071114540.0
CAGL0I10560g3.489ON67869613361e-176
Kwal_55.212223.489ON3733839441e-122
KAFR0C019403.489ON6096749261e-116
KNAG0B008303.489ON6076698211e-100
Kwal_55.21225singletonOFF2152144751e-54
ABR131W2.152ON594126790.61
KNAG0A036708.548ON42697780.68
KLTH0F09108g8.370ON71980771.3
KAFR0B060108.370ON68180751.7
AGL145W8.370ON69180742.3
Kpol_1036.1048.370ON68780743.0
TBLA0A045707.57ON1347180743.2
Skud_14.2112.152ON617126733.6
Suva_14.2192.152ON617126733.7
Kpol_312.67.140ON425177715.7
YNL121C (TOM70)2.152ON617126706.8
TBLA0B063004.338ON34586697.8
Smik_14.2072.152ON617126708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05570
         (649 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...  1289   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   741   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   662   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   649   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   636   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   631   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   627   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   628   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   618   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   613   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   609   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   604   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   603   0.0  
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   565   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   564   0.0  
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   519   e-176
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   368   e-122
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   361   e-116
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   320   e-100
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   187   1e-54
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    35   0.61 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    35   0.68 
KLTH0F09108g Chr6 complement(782647..784806) [2160 bp, 719 aa] {...    34   1.3  
KAFR0B06010 Chr2 (1243008..1245053) [2046 bp, 681 aa] {ON} Anc_8...    33   1.7  
AGL145W Chr7 (428550..430625) [2076 bp, 691 aa] {ON} Syntenic ho...    33   2.3  
Kpol_1036.104 s1036 (268670..270733) [2064 bp, 687 aa] {ON} (268...    33   3.0  
TBLA0A04570 Chr1 complement(1128781..1132824) [4044 bp, 1347 aa]...    33   3.2  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    33   3.6  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    33   3.7  
Kpol_312.6 s312 complement(12357..13139,13142..13636) [1278 bp, ...    32   5.7  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    32   6.8  
TBLA0B06300 Chr2 (1489321..1490358) [1038 bp, 345 aa] {ON} Anc_4...    31   7.8  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    32   8.7  

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score = 1289 bits (3335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/649 (98%), Positives = 638/649 (98%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLK 120
           KLVLSIPIPSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLK
Sbjct: 61  KLVLSIPIPSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLK 120

Query: 121 VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAND 180
           VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAND
Sbjct: 121 VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAND 180

Query: 181 FLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIG 240
           FLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIG
Sbjct: 181 FLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIG 240

Query: 241 HEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLTHNSILFQR 300
           HEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLTHNSILFQR
Sbjct: 241 HEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLTHNSILFQR 300

Query: 301 ELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKD 360
           ELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKD
Sbjct: 301 ELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKD 360

Query: 361 SLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLEKNKQSISSFDRI 420
           SLGKGFTVSNEPISQVLKPLFS           KFEHFDFNQIYQHLEKNKQSISSFDRI
Sbjct: 361 SLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLEKNKQSISSFDRI 420

Query: 421 FLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPLFPVDCTPK 480
           FLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPLFPVDCTPK
Sbjct: 421 FLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPLFPVDCTPK 480

Query: 481 LLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEV 540
           LLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEV
Sbjct: 481 LLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEV 540

Query: 541 RKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQE 600
           RKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQE
Sbjct: 541 RKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQE 600

Query: 601 RVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           RVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL
Sbjct: 601 RVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/666 (56%), Positives = 493/666 (74%), Gaps = 19/666 (2%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPS+ Q F+L+VLPR+ +LSN+  Q+++L+V+ DI P SN+ITIGISESAISQY+LNPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR-SDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSD--- 116
           KL+ +I IPSTN+V+ACDVA  +D++EIWCY +++GK   LN + K   A+  +++D   
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120

Query: 117 --DVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFF 174
             +  K+K+D + VG+ +    K IVVVL++GLIQ+YDFQL+ L SLD+SY +V V  +F
Sbjct: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180

Query: 175 TEGANDFLFILCSLPEDKVCFKLFELSLPNYNQ-VPIKELSSIILEDFSLATSKICYQSG 233
           +E   +F+F+L     +KVCFKLFEL   +  +  PIKELS+ ILE+F+L  SK+CYQSG
Sbjct: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240

Query: 234 RLYRLIGHEVLVYALPQCQLVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYLLNL 291
           +LY+L G  +  YALPQC LVQ   LPM+    +  +S+ P+S+NRIL+T +N++YLL+L
Sbjct: 241 KLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLLDL 300

Query: 292 THNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ----KTFVIGVGTKHGKNPTSSLE 347
            H+S+L +R LTH K+FQLL+SA ++  VSSSL       +T  IGV TK+G NPTS+LE
Sbjct: 301 VHSSVLSERTLTHAKTFQLLRSAPLN--VSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358

Query: 348 IVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFE--HFDFNQIYQ 405
           ++NVDVGTGTLKDSLGK F   N+  +  L+PLFS             E   F +  I++
Sbjct: 359 VINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFK 418

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465
            L KN +SIS FD  F + LNI+ EHYT+ +RFICD++FLS VV LIL +F +EYP+ALT
Sbjct: 419 ELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRALT 478

Query: 466 FLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISL 525
           FLLTHPLFP DCT  LL R R HPRLFKQAIVTCPNLPL +LLSELFSI NGEL LDISL
Sbjct: 479 FLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISL 538

Query: 526 RILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAI--RSSHQLFQLLSLVLDSIGL 583
           RILQD+TTDMIK EV+KLNK+DV NF+ F+IS  DE  I  +S+++LFQLLSLV+D+IGL
Sbjct: 539 RILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGL 598

Query: 584 FALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYT 643
           FALDG LL RL+DYI E+V +AERN++L +LLD +  +RG   S AGS  +  + +PKYT
Sbjct: 599 FALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYT 658

Query: 644 VEYLDL 649
           VEYL+L
Sbjct: 659 VEYLEL 664

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/680 (52%), Positives = 476/680 (70%), Gaps = 40/680 (5%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+L +LP++ASLSNFA Q++++QV D    PT+N+ITIGIS S++SQY++NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLVLSIPIPSTNIVTACDV--ARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDD 117
           PKL+ + PIPSTNIVTAC+V   +   +E WC+A  A K  TLN+ +K  +  N   S D
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120

Query: 118 V----------LKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSD 167
                       K+K DD  V + +  K K I+VVLKNG IQ YDF+LKLL+S++++Y++
Sbjct: 121 SAPSDSSVTSEFKIKADDHVVDIKILNK-KKIIVVLKNGKIQTYDFELKLLNSINMAYNN 179

Query: 168 VSVTKFFTEGANDFLFILCSLPEDKVCFKLFELS--LPNYNQVPIKELSSIILEDFSLAT 225
           V   + F E   DF+F+LC L  DKVC KLF+++  +   N   I EL+S ILE+F L  
Sbjct: 180 VRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAI-ELTSTILENFPLEN 238

Query: 226 SKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMV----QGADVISMKPISSNRILVT 281
           +K CYQ G+ Y+L   ++LVY+LPQ Q   ++TLPM+    +G  V+S KPIS NRIL+T
Sbjct: 239 AKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLT 298

Query: 282 ADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKN 341
            +NKIYLL+L HNSIL +RELTHLK+FQLLK+AV+D+ ++ +    +T  IGV TK G N
Sbjct: 299 VNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQN----RTLAIGVSTKFGSN 354

Query: 342 PTSSLEIVNVDVGTGTLKDSLGKGF-TVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDF 400
           PTSSLE++NVDVGT T+KDSLGK F T S E   Q LK LF            + ++F++
Sbjct: 355 PTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKK-QVKNFNY 413

Query: 401 NQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEY 460
            +IY+ L  +K  ++ FD IF +  +IK+E+YTE DRFI + +FL  ++ LI + F+EEY
Sbjct: 414 EKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEEY 473

Query: 461 PKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELS 520
           PK  T+LLT PLFP++ T  LL+RL  HPRLFKQAIVTCPNLPL ELL+ELF+I NGELS
Sbjct: 474 PKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELS 533

Query: 521 LDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIR---SSHQLFQLLSLV 577
           LDISLRILQDYT D IK+E++KL KI+V+NFIEF+I  ++E+ I+   ++  LFQLLSLV
Sbjct: 534 LDISLRILQDYTRDSIKKELKKLPKIEVENFIEFII--DEESDIKDTTNAPHLFQLLSLV 591

Query: 578 LDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLD--------DKQNSRGFAKSGA 629
           +DSIGLFALD  +L+RL+ YI E+VAIA+ N++L HLLD        + +     +K   
Sbjct: 592 VDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSN 651

Query: 630 GSVGSTREAVPKYTVEYLDL 649
            S+    E +PKY+VEYLDL
Sbjct: 652 TSLKLQEEVLPKYSVEYLDL 671

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/661 (52%), Positives = 453/661 (68%), Gaps = 18/661 (2%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPS SQ F+LAVLP++ SLSN   Q + LQ+ADD    SN+ITIGIS S ISQY++NPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR--SDEQ----EIWCYALQAGKVCTLNVASKVS----HAE 110
            LV ++PIPSTN VTAC++    SD      E W Y L   K  TLN++ K S    +A 
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYAT 120

Query: 111 NGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSV 170
           +G    +    K DD+   + +N K+K IVVVLKNGLIQFYDF LKLL S++V YSD+S 
Sbjct: 121 SGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISF 180

Query: 171 TKFFTEGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICY 230
            + F E    F  IL ++   K+ FKL+EL     ++  I ELSS ILED  L  S+ICY
Sbjct: 181 VEHFEEDGKQFAIILSNIEGKKISFKLYELF--TNDKTSINELSSTILEDADLGESQICY 238

Query: 231 QSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQ--GADVISMKPISSNRILVTADNKIYL 288
           Q G++YRL    + +Y LPQCQL Q + LP +Q   +DV+S  PI++NRIL+T +NKIYL
Sbjct: 239 QFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYL 298

Query: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348
           L+L HNSIL +R+L+H+K +QLLKS V+ S+  +   N KT  IGV  K+G +P SSLE+
Sbjct: 299 LDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENK--NSKTIAIGVSIKNGPSPISSLEV 356

Query: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLE 408
           +NVDVG+GTLKDSLGK F V+N   +  L+ LF            K   FD+  I Q L+
Sbjct: 357 INVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQK--SFDYKNILQELQ 414

Query: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468
            NK  I+ FD IF ++LNI +E+YTE DRFI D++FLS+V+ LI   F+++YP+ALTFLL
Sbjct: 415 NNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLL 474

Query: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528
           THPLFP+  T  LL++ R  PRLFKQA+VTCPNLPL+ELL+ELF+I NGEL LDISLRIL
Sbjct: 475 THPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRIL 534

Query: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDG 588
           QDYT D IKQE++ L+K+D+QNFIEFVI ++ E+  + + QLFQLLSLVLD+ GLFAL+ 
Sbjct: 535 QDYTRDSIKQELKTLSKVDIQNFIEFVIDTDSEDKSQFNPQLFQLLSLVLDASGLFALEE 594

Query: 589 VLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLD 648
             L++L+ YI  +V +AERN++L HLLD+  + R              +++  Y+VEYL+
Sbjct: 595 ETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLE 654

Query: 649 L 649
           L
Sbjct: 655 L 655

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/716 (49%), Positives = 476/716 (66%), Gaps = 70/716 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD      +N IT+GIS S+ISQY++NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTAC-----------DVARSDEQ---------------EIWCYALQ 93
           PKL    PIPSTNI+TAC           D   SD                 EIW + L 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 94  AGKV-CTLNVASKVSH----------AENGVN------SDDVL---KVKVDDQAVGVHVN 133
             K   TLNV +K              ENG +      +DD+L   K+K  D+ + + ++
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 134 GKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKV 193
            K+  ++ VL+NGL++FYDF+LKLLHS D+SY ++   K+FTE   +F+F+LC L +DKV
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240

Query: 194 CFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQ 252
           C+KLFELS        PIKELSS I+E FS  +SK CYQ G+LY+L   ++ VY+LP CQ
Sbjct: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300

Query: 253 LVQAVTLPMVQGA----DVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSF 308
           L Q + +P++       D+IS +P+S NRIL+T +N IYLL+L H SIL QRELTH+++F
Sbjct: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360

Query: 309 QLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTV 368
           QLL+SAVIDS  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F +
Sbjct: 361 QLLRSAVIDSEKSQ---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQI 417

Query: 369 S-NEPISQVLKPLFSXXXXXXXXXXXK-------FEHFDFNQIYQHLEKNKQS-ISSFDR 419
             N+  S VLKPLF                       F +++I + +   K + ++SFD 
Sbjct: 418 GKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDD 477

Query: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478
           IF ++L +K EHYTE DRFI D +FL+ V+ LI + F   +YPKALTFLLTHPLFP++ T
Sbjct: 478 IFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRT 537

Query: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538
             LLSRLR+ PRLFKQAIVTCPNLPL ELL ELFSI N EL LDIS RILQD+T D IKQ
Sbjct: 538 HNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQ 597

Query: 539 EVRKLNKIDVQNFIEFVISSNDENAIRS-----SHQLFQLLSLVLDSIGLFALDGVLLDR 593
           E++ L+K+D+QNFI+F+ ++++++ + +     S QLFQLLSLVLDSIGLF+L+G LLD 
Sbjct: 598 EMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDN 657

Query: 594 LADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           LA YI ++V IAERN++L +L++ K +  GF    + S  S ++A+P YT+EYL++
Sbjct: 658 LASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/661 (50%), Positives = 451/661 (68%), Gaps = 21/661 (3%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           M S+SQ F+L  LP++ASL+NF+ QT++LQVA+ + P++N+I IG+S S+ISQY++NPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR-------SDEQEIWCYALQAGKVCTLNVASKVSHAE--- 110
           KLV ++ IPST+IVTACDV+        ++ QE+WCYAL A K  TLN   K   A+   
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120

Query: 111 -NGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVS 169
            N   + +  KV +  +   V +    KTI+ VL+NGL+Q +DFQLKLLHS D+SY ++S
Sbjct: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180

Query: 170 VTKFFT-EGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKI 228
           + K+FT E   DF+ +L  L +DKVC+KLFE+   + N VP+KEL+S+ILE FSL  SK 
Sbjct: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSN-VPLKELNSVILEGFSLQNSKT 239

Query: 229 CYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYL 288
            YQ G++Y L   ++ +Y+LP  QL   + LP V   +V+S KPIS+NR L+T DN+IYL
Sbjct: 240 FYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYL 299

Query: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348
           L+L HN+IL QRELTH+K+FQLL +A+I    +    N KT  IGV TK   N TS+L+I
Sbjct: 300 LDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAE---NNKTIAIGVSTKSDNNATSALDI 356

Query: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLE 408
           VN++VG+GTLKDS+ KGF ++ +   +VL  LF                FD+NQI   LE
Sbjct: 357 VNINVGSGTLKDSMSKGF-LTQDATEEVLNSLFDEQDDELDEDGT--SQFDYNQILSELE 413

Query: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468
           K K     FD +F + LNIK+E+YTE DRF   + FL  V+ LI +NF +EYP+ALT+LL
Sbjct: 414 KAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLL 473

Query: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528
           THPLFP      LLS+ +EHPRLF+QAIVTCPNLPL  LL ELF++ N EL LD+SLRIL
Sbjct: 474 THPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRIL 533

Query: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISS-NDENAIRSSHQLFQLLSLVLDSIGLFALD 587
           QD+T D IKQ ++K++K+D+ NFI FVI+  +DE   +S  QLFQLL+LVLDSIGLFALD
Sbjct: 534 QDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALD 593

Query: 588 GVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTRE-AVPKYTVEY 646
           G  L+ L  +I+ +V I E+N +L +LLDD         S   +  ST E A+P Y+VEY
Sbjct: 594 GESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEY 653

Query: 647 L 647
           L
Sbjct: 654 L 654

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/661 (50%), Positives = 449/661 (67%), Gaps = 21/661 (3%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPSLSQ F+LA+LP++A LS++  Q+  LQVADD    SN+ITIG+S  A+SQYV+NPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVARSDEQ------EIWCYALQAGKVCTLNVASKVSHAEN-GV 113
            +  ++PIPSTN VTAC+VA+  +       EIW Y L   K  TL+VA K    +    
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120

Query: 114 NSDDVLK---VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSV 170
              D L+   VK D   VG+ +N +DKTIVV L NG IQ +DF+LKLL+S++ SY ++  
Sbjct: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180

Query: 171 TKFFTEGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICY 230
           ++ F E    F  IL ++  +K+ +KL+EL     ++  IKELSS ILED     SKI Y
Sbjct: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELF--GQDKTSIKELSSTILEDIQCKDSKISY 238

Query: 231 QSGRLYRLIGHEVLVYALPQCQLVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYL 288
           Q G+LYRL  +++ VY+LPQCQLV  +TLP +  + +  IS KP+S+NRIL+T DNKI++
Sbjct: 239 QFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298

Query: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348
           L+L H + L +R L H+K FQLLKS VI++  +S+  N KT  IGV  K+G +P ++LEI
Sbjct: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASN--NHKTIAIGVSVKNGPSPITALEI 356

Query: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLE 408
           +N +VGTGTLKDSLG  F VS    S +L+PLF+           K   F +  I + L 
Sbjct: 357 INANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLV-----KRHDFKYEAILKKLS 411

Query: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468
             +  I  FD IF  +L I++ +YT+ +RFI D  FLS+V+ LI +NFQ+EYP ALTFLL
Sbjct: 412 STENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLL 471

Query: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528
           THPLFP+  T  LL +LREHPRLFKQA+VTCPNLP+ ELL+ELFSI NGELS+DISLRIL
Sbjct: 472 THPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRIL 531

Query: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDG 588
           QDYT D IK E++ LNKID+QNFI+FVI  N+E   + + QLF LLSLVLD+ GLF+++G
Sbjct: 532 QDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEG 591

Query: 589 VLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLD 648
            LL +L++YI ++V + E+++KL HL+D     R      +G+     +A+  Y+VEYL+
Sbjct: 592 PLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLE 651

Query: 649 L 649
           L
Sbjct: 652 L 652

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/710 (49%), Positives = 468/710 (65%), Gaps = 66/710 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+LA LP++ASLSNF+ Q N++QVAD     ++N IT+GIS S++SQY++NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTACDVARS---------DEQ----------EIWCYALQAGKV-CT 99
           PKL+   PIPSTNI+TAC+   +         +E+          EIW + L   K   T
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 100 LNVASKVSHAENGVNSDD---------------------VLKVKVDDQAVGVHVNGKDKT 138
           LNV +KV   EN +N+ D                       K+K   + + + ++ K+  
Sbjct: 121 LNVITKV--LENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNL 178

Query: 139 IVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKVCFKLF 198
           I+ +L+NGLI+FYDF+LKLLHS D+SY ++   K+FTE   +F+F+LC L +DKVC+KL 
Sbjct: 179 IIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLL 238

Query: 199 ELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAV 257
           EL+   N    PIKELSS I+E FS   SK+CYQ G+LY+L   ++ VY+LP CQL Q +
Sbjct: 239 ELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVI 298

Query: 258 TLPMVQGAD----VISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKS 313
            LP++  +D    +IS +P+S NR+L+T +N +YLL+L H S L QREL+H+K+FQLL +
Sbjct: 299 ELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNT 358

Query: 314 AVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPI 373
           AVI+S  S S    KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F    +  
Sbjct: 359 AVINSEKSHS---SKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDS 415

Query: 374 SQVLKPLFSXXXXXXXXXXXK-------FEHFDFNQIYQHLEKNKQS-ISSFDRIFLREL 425
           S +LKPLF                       F +++I   L   K + I+SFD IF ++L
Sbjct: 416 SVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDL 475

Query: 426 NIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCTPKLLSR 484
            IK EHYTE DRFI D  FL+ V+ LI + F   +YPK LTFLLTHPLFP+D T  LLS 
Sbjct: 476 KIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSL 535

Query: 485 LREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLN 544
           LR+ PRLFKQAIVTCPNLPL ELL ELFSI N EL LDIS RILQD+T D IKQE+++L+
Sbjct: 536 LRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLS 595

Query: 545 KIDVQNFIEFVISSNDENAIRS-----SHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQ 599
           K+D+QNFIEF+ S+ ++N++       S QLFQLLSLVLDSIGLF+L+G LL+ L  YI 
Sbjct: 596 KLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYID 655

Query: 600 ERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           ++V IAERN++L +L+D K +  GF      S  S ++A+P YT+EYLD+
Sbjct: 656 KQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/716 (49%), Positives = 470/716 (65%), Gaps = 70/716 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD     ++N IT+GIS S+ISQY++NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTACDVAR----------------SDEQ-----------EIWCYAL 92
           PKL    PIPSTN++TAC  A                 +DE+           EIW +  
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 93  QAGKV-CTLNVASKVSHA----------ENGVNS------DDVL---KVKVDDQAVGVHV 132
              K   TLNV +K+  +          E+ ++S      DD L   K+K   + + + +
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 133 NGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK 192
           + K+  I+ VL+NGLI+FYD +LKLL+S D+SY ++   K+FTE   DF+F+LC L +DK
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 193 VCFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQC 251
           VC+K+ ELS   + +  PIKELSS I+E FS  +SK+CYQ G+LY+L   ++ VY+LP C
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 252 QLVQAVTLPMVQGA----DVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKS 307
           QL Q + LP++  +    D+IS +P+S NRIL+T +N IYLL+L H SIL  RELTH+K+
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 308 FQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFT 367
           FQLLKSA+IDS  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F 
Sbjct: 361 FQLLKSALIDSEKSH---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417

Query: 368 VSNEPISQVLKPLFSXXXXXXXXXXXK-------FEHFDFNQIYQHLEKNKQS-ISSFDR 419
           V     S +LKPLF                       F ++++ + L   K + I+SFD 
Sbjct: 418 VGKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDE 477

Query: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478
           IF  +L +K EHYTE DRFI D  FL+ V+ LI   F   +YPKALTFLLTHPLFP++ T
Sbjct: 478 IFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRT 537

Query: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538
             LLS LR+ PRLFKQAIVTCPNLPL ELL ELFSI N EL LDIS R+LQD+T D IKQ
Sbjct: 538 HGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQ 597

Query: 539 EVRKLNKIDVQNFIEFVISSNDENAIRS-----SHQLFQLLSLVLDSIGLFALDGVLLDR 593
           E++KL+K+D+QNFIE + ++ ++  +       S QLFQLLSLVLDSIGLF+L+G LL+ 
Sbjct: 598 EMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 594 LADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           L  YI ++V IAERN++L +L+D K +  GFA   +GS  S ++A+P Y +EYLD+
Sbjct: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/706 (47%), Positives = 463/706 (65%), Gaps = 65/706 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVA-DDIEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+LAVLP++ASLSN++ QT++LQVA D     +N++T+GIS S ISQY++NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTACDVARSDEQ---------------------------------- 85
           PKL+ +I IPSTN VTA +++   E+                                  
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 86  ------EIWCYALQAGKVCTLNVASKVSH-AENGVNSDDVLK---VKVDDQAVGVHVNGK 135
                 E+W Y L A K  TLN++ K +   E      ++++   +KVD + V + +  +
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 136 DKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK--V 193
            KTIVVVLKNGL++ +DF L L  SLD++Y+DV   + FTE   +FL IL ++ E+K  V
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240

Query: 194 CFKLFELSL-PNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQ 252
           CFKL++L L  + NQV   ELS  IL+DF L+ SK+ YQ G+LYRL G E+ VY+LPQCQ
Sbjct: 241 CFKLYQLRLDSDSNQV--SELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQ 298

Query: 253 LVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQL 310
           L+Q ++L  +     DV S+KP+++NR+++  +N +YL++  H SIL +RE TH+K+FQL
Sbjct: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358

Query: 311 LKSAVI-DSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVS 369
           L+SA I DS ++     Q+T  IGV TK G    S+LE++N++VG+GTLKDSLGKG +  
Sbjct: 359 LQSATIGDSNIT-----QRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKK 413

Query: 370 -NEPISQVLKPLFSXXXXXXXXXX-----XKFEHFDFNQIYQHLEKNKQSISSFDRIFLR 423
            +E     LKPLF                   + F+FN+I   L K+  +IS FD+ F  
Sbjct: 414 LSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFE 472

Query: 424 ELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPLFPVDCTPKLLS 483
            L IK  HYTE DRFI D+ F++N + LI + F  E+PKA TFLLTHPLFP+  T  LL 
Sbjct: 473 SLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLD 532

Query: 484 RLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKL 543
           +L++HPRLFKQAIVTCPNLPL ELL +LF+++NGEL+LDISLR+LQDY+ + +KQE++KL
Sbjct: 533 KLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKL 592

Query: 544 NKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVA 603
           + +D++NFIEF+I+   E    ++ QLFQLLSLVLDSIGLFAL G LL+RL++YI E+V 
Sbjct: 593 DNVDIENFIEFIITPTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVT 652

Query: 604 IAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           IAER+S+L HLLD     R F  +   SV   +E +  Y+V+YLD+
Sbjct: 653 IAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/716 (49%), Positives = 461/716 (64%), Gaps = 70/716 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD     ++N IT+GIS S+ISQY++NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTACDV------------ARSDEQ---------------EIWCYAL 92
           PKL    PIPSTNI+TAC+             A +D++               EIW + L
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 93  QAGKV-CTLNVASKV--------------SHAENGV--NSDDVL---KVKVDDQAVGVHV 132
              K   TLNV +K               S  +N     SD+ L   K+K   + + + +
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 133 NGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK 192
           + K+  ++ +L+NGLI+ +DF+L LLHS D+SY ++   K+FTE   +++F+LC L +DK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 193 VCFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQC 251
           VC+KL EL+   +    PIKELSS I+E FS   SK+CYQ G+LY+L   ++ +Y+LP C
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 252 QLVQAVTLPMVQ----GADVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKS 307
           QL Q +  PMV     G D+IS +P+S NR+L+T +N IYLL+L H S L QRELTH+K+
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 308 FQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFT 367
           FQLLKSAVI+S  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F 
Sbjct: 361 FQLLKSAVINSEKSH---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417

Query: 368 VSNEPISQVLKPLFSXXXXXXXXXXXKFEHFD-------FNQIYQHLEK-NKQSISSFDR 419
           V N   S +LKPLF                 D        N++ + L       I+SFD 
Sbjct: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477

Query: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478
           IF +EL IK EHYTE DR+I D  FL+ V+ LI   F   +YPK LTFLLTHPLFP+  T
Sbjct: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRT 537

Query: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538
             LLS LR+ PRLFKQAIVTCPNLPL ELL ELFSI N EL LDIS RILQD+T D IKQ
Sbjct: 538 RNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQ 597

Query: 539 EVRKLNKIDVQNFIEFVISSNDENAIR-----SSHQLFQLLSLVLDSIGLFALDGVLLDR 593
           E++KL+K+DVQNFIEF+ S  ++++        S QLFQLLSLVLDSIGLF+L+G LL+ 
Sbjct: 598 EMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 594 LADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           L  YI ++V IAERN++L +L+D K    GFA S   +  S + A+P YT+EYLD+
Sbjct: 658 LTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/662 (48%), Positives = 451/662 (68%), Gaps = 25/662 (3%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPS+SQ F+L  LP++ASL+N+A Q N+LQVAD + PT+N I +G+S SA+SQY++NPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR------SDEQEIWCYALQAGKVCTL-----NVASKVSHA 109
           KLV + PI STN+V+AC VA        D QE+ CY +Q+ +V +L      V+S  S +
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120

Query: 110 ENGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVS 169
             G  +    KV V DQ V + V    K+IV VL++GLIQF+DF+LKL HSLD SY +VS
Sbjct: 121 SFG-ETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179

Query: 170 VTKFFT-EGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKI 228
             + FT E    + F+L  +   KV FKLFE+   + +  P  ELSS+ILE+  L  S+I
Sbjct: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSD-SATPATELSSVILENMCLKDSQI 238

Query: 229 CYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYL 288
            YQ G++YRL G+ V +Y LP  Q  + + LP +    +IS KPIS+NR L+T+DNKI+L
Sbjct: 239 FYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFL 298

Query: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348
           L+L HN+IL QRE+ H+K FQLL++AVI     +S  N KT  +GV  KHG NP+SSL+I
Sbjct: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPG---NSTLNNKTIALGVSIKHGSNPSSSLDI 355

Query: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLE 408
           +N+DVGTGTL+DS+GKGF +S E  SQ L+PL S               F++++I + L 
Sbjct: 356 INIDVGTGTLRDSMGKGF-MSRENKSQHLQPLISTLNDTEAA------EFNYDRILKELS 408

Query: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468
           K   +I +FD +F + L IK  +YT+ DRF+ DR+FL +V  LI ++F+ EYPKALT+LL
Sbjct: 409 KAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLL 468

Query: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528
           T+PLFPV  T  LL +L++HPRLFKQAIVTCPNL L EL+ ELF++ N EL LD+SLRIL
Sbjct: 469 TNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRIL 528

Query: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISSN-DENAIRSSHQLFQLLSLVLDSIGLFALD 587
           QD+  D IK+ +++ +KIDV NFI FVIS N +E+ I++  +LFQLLSLVLDS+GLFAL+
Sbjct: 529 QDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALE 588

Query: 588 GVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYL 647
             +L++L  YI +++++ + N +L +L+++K    GF +    +  S    +  Y++E L
Sbjct: 589 NEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQL 648

Query: 648 DL 649
           +L
Sbjct: 649 EL 650

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/660 (48%), Positives = 460/660 (69%), Gaps = 23/660 (3%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           M  ++Q F+LA LP+++SL+N+A QT++LQVAD +EPTSN +T+G+S S+ISQYV+NPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDV-ARSDEQEIWCYALQA-GKVCTLNVASKVSHA---ENGVNS 115
           KLV +IPIPSTN+VT CDV A SD  E+W YAL A GKV TL+   + + A   E G+++
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120

Query: 116 --DDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKF 173
             D+  K  +  + V V +    K I+VVL  GLIQ YD+QL+LLHSLD+SY++V + ++
Sbjct: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180

Query: 174 FTEGAN-DFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQS 232
           FT+ A  D++F+LC +   K C+KLF+L+    N +PI EL+S+ILEDF+LA SK+ YQ 
Sbjct: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAEN-LPITELNSVILEDFALAESKMVYQF 239

Query: 233 GRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLT 292
           G+LYRL+  ++ VY+LP  QL   V LP V+  D +S++ IS+NR+L+T  NKI+LL+L 
Sbjct: 240 GKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLL 299

Query: 293 HNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVD 352
           HN+IL++REL+++K FQLL++AVI         + +TF IGV TK G NP+S+L++V + 
Sbjct: 300 HNAILYERELSNIKFFQLLRAAVIPGTTPGE--SNRTFAIGVSTKQGSNPSSALDVVTIA 357

Query: 353 VGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLEKNKQ 412
           VGTGTLKDSLGKGF       ++ LKPLF               + DF  I   L  ++ 
Sbjct: 358 VGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDES-------PNIDFAAILAEL-TSRT 409

Query: 413 SISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPL 472
           +  +FD IF + L  K+E+YTE DRFI + +FL+ ++  I   F +E+PKAL +LLTHPL
Sbjct: 410 TPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPL 469

Query: 473 FPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYT 532
           FP   T  LL +L+ HPRLFKQA+VTCPNLPL ELL ELF++ N ELSLD+SLR+LQ++T
Sbjct: 470 FPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFT 529

Query: 533 TDMIKQEVRKLNKIDVQNFIEFVI--SSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVL 590
            + IKQ +R+L+++D+ NF+ FVI  S++ E   ++  QLFQLLSLV+D++GL AL+G +
Sbjct: 530 KEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDI 589

Query: 591 LDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREA--VPKYTVEYLD 648
           L RL+ +I  +VA+A++  +L +LL++    +G   +    +  +  A  +P Y+VEYLD
Sbjct: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/660 (44%), Positives = 457/660 (69%), Gaps = 26/660 (3%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           M S+SQ F+L+ LP++ SL+N+A QT++LQV D++ P++N++ IGIS S+ISQY++NPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR-SDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDV- 118
           KLV ++PIPSTNIVTACDV   +   E+WCY L+A KV  L++A+K    ++ V+S +  
Sbjct: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATK-PMIQDAVSSSNAE 119

Query: 119 ----LKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFF 174
                K K+  + V + +  K + ++V+L+NGLIQ +D++LKL +++D+SY D+   +FF
Sbjct: 120 ITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFF 179

Query: 175 TEG-ANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSG 233
            +G  NDF F+LC L ++K+C+KLF++       V   EL+SIILE+++L  +K+C++ G
Sbjct: 180 QDGQGNDFFFVLCQLSDEKICYKLFQV---RSESVSCIELNSIILENYTLENAKLCFEFG 236

Query: 234 RLYRLIG-HEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLT 292
           +LY L   +E+ +Y LP  QL  ++ LP +    V+S+KP+SSNR+L+TADN IYL++L 
Sbjct: 237 KLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLL 296

Query: 293 HNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVD 352
           +N+ILFQ++L ++K+ QLL +AV+     +S  N+KT  + V TK+G NPTS L+++N+D
Sbjct: 297 YNAILFQKDLQNIKAIQLLSTAVVQE---NSEDNRKTIALDVTTKNGANPTSYLDVINID 353

Query: 353 VGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLEKNKQ 412
           VGTGTLKD++GKGF V  +   Q L+ LF            +    D+ +I + L   K+
Sbjct: 354 VGTGTLKDAMGKGFMVKQK---QKLQKLFEESNEDDDV---ELPSPDYERIIKQLHICKK 407

Query: 413 SISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPL 472
            I +FD IF + L++ +E+YT+ DRF+ D   L+ ++  +  NF++EYPKALT+LLTHPL
Sbjct: 408 -IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPL 466

Query: 473 FPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYT 532
           FP      LL++L+ +PRLFKQAIVTCPN+PL +LL+ELF+I N EL  DI+LR+LQDY 
Sbjct: 467 FPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYK 526

Query: 533 TDMIKQEVRKLNKIDVQNFIEFVISSN--DENAIRSSHQLFQLLSLVLDSIGLFALDGVL 590
            + IK  +RK+ K+D+ NF++ +++SN  D +   +  Q+FQL+SL++DSIGLFALD   
Sbjct: 527 KESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEY 586

Query: 591 LDRLADYIQERVAIAERNSKLCHLLD--DKQNSRGFAKSGAGSVGSTREAVPKYTVEYLD 648
           L++L+ ++  +V++  +N +L HL +   K +S    KS + +  S+ + +  YTV+YL+
Sbjct: 587 LEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLE 646

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/711 (46%), Positives = 454/711 (63%), Gaps = 73/711 (10%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59
           MPSLSQ F+L VLP++ASLSN++ Q +++QV      PT+N++ IG+S SAISQY++NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLVLSIPIPSTNIVTACDV----ARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNS 115
           PKL+ + PIPSTNIVTACDV      +   E+WC+ L A K  TL + +K     +    
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 116 -------------DDVLKVKVDDQAVGVHVNGKDK---TIVVVLKNGLIQFYDFQLKLLH 159
                         D   VK+D + V + +  K     +I++VL+NGLIQF++  LKLL+
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 160 SLDVSYSDVSVTKFFTEGANDFLFILCSLPED-KVCFKLFELSLPNYNQVPIKELSSIIL 218
           ++ ++Y +V   + F E   DF+F +C L ++ KVC KLF++     N     EL+SII+
Sbjct: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI-----NNDSAIELNSIIM 235

Query: 219 EDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGAD-VISMKPISSNR 277
           E+F+   +K CYQ G+ Y+L  + ++VY+LPQ QL    T+PM++  D ++SMKPIS+NR
Sbjct: 236 ENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNR 295

Query: 278 ILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTK 337
           IL+T +NKIYLL+L HNSIL +RELTHLKS QLL+SAVI    +    N KT  IGV TK
Sbjct: 296 ILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGEN----NNKTITIGVSTK 351

Query: 338 HGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSN-----EPISQVLKPLFSXXXXXXX--- 389
            G NPTSSLEI+NVDVG+ TLKDSLGK F   N     +  +Q LKPLF           
Sbjct: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDD 411

Query: 390 --XXXXKFEHFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSN 447
                   E F++++I   L +N   I  FD IF +  NIK+EHYTE DRFI + +F   
Sbjct: 412 LFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471

Query: 448 VVHLILQNF--------QEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTC 499
           ++ LI + F          EYPK LTFLLTHPLFP++ T  LLSR   HPRLFKQAIVTC
Sbjct: 472 LIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTC 531

Query: 500 PNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSN 559
           PNLPL ELL+EL +I+N ELSLDISLRILQDY+ D IKQE+R L +++++NFI+F++  N
Sbjct: 532 PNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFIL--N 589

Query: 560 DE-NAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDK 618
           DE    ++S QLFQLL+LVLDSIGLFAL   +L+ L+ YI  +V+I E+N++L +L+D  
Sbjct: 590 DEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSN 649

Query: 619 QN-------SRGFAKSGAGSVG-------------STREAVPKYTVEYLDL 649
            N          F+ + A +               + +EA+P Y+V+YL+L
Sbjct: 650 NNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  519 bits (1336), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 300/696 (43%), Positives = 442/696 (63%), Gaps = 65/696 (9%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPSLSQ F+LAVLP++ASL NF+ +  +++VAD   P SN + +GIS S+IS+YV+ PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLVLSIPIPSTNIVTACDV--------------ARSDEQ-----------------EIWC 89
           +L+ ++PIPST++V+AC++              A +DE                  EIWC
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 90  YALQAG-KVCTLN-VASKVSHAENGVNSDDV-LKVKVDDQAVGVHVNGKDKTIVVVLKNG 146
           YAL A  K  TLN +  +V +    +  ++     K  +Q + + V+ K K IV++ + G
Sbjct: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180

Query: 147 LIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKVCFKLFELSLPNYN 206
           L+QFYD QLKLL+S++  Y D+ + K F E   +++ ++  L + KV  +L+E+S     
Sbjct: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVST---E 237

Query: 207 QVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGAD 266
           +  +KEL+S I+E+F+L  S +CYQ GR+YRL   E+ VY++P  QL   V +P +   +
Sbjct: 238 EKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIE 297

Query: 267 ----VISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSS 322
               +IS+KPI++NR+L+T  NKIYLL+L H SIL +RE++H+K+FQ+LK+A+      S
Sbjct: 298 DKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSES 357

Query: 323 SLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFS 382
            L    T  +G+ TK+G+NPTS+LEI+N+DVG+ +LKDSLGK F   N  I   LK LF 
Sbjct: 358 KL----TLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFP 413

Query: 383 XXXXXXXXXXXKFE--HFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFIC 440
                      K+E    +F +I   L KN  S   FD  F   LNIK E +TE  RF+ 
Sbjct: 414 EP---------KYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLN 463

Query: 441 DRQFLSNVVHLILQ--NFQEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVT 498
           D++FL++V+ LI    ++ +  P++L FLLTHPLFP +    LL++++ + RLFKQAIVT
Sbjct: 464 DQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVT 523

Query: 499 CPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISS 558
           CPNLPLQELL ELF+I+N EL +DIS+RILQDYT D IK+E++KL+++ V+NF+ F+I  
Sbjct: 524 CPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKM 583

Query: 559 NDENAIRS-----SHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCH 613
           N+  A  S     + Q+F+LLSL+LDSIGLF L+  +L +L+  I++ V IAERN +L +
Sbjct: 584 NNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWN 643

Query: 614 LLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649
           ++D K  S   + S A S  +     P Y VEY+D+
Sbjct: 644 IMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  368 bits (944), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 266/383 (69%), Gaps = 11/383 (2%)

Query: 268 ISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ 327
           +S  PIS NR L+T DNK+YLL+L HN+IL QRE TH+K+FQLL +AVI    SS   N 
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSS---NN 57

Query: 328 KTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSXXXXX 387
            T  IGV TK G   TSSL++VN+DVGTGTLKDS+GKGF  S   + Q  + L       
Sbjct: 58  STIAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKV-QCPQSLLGTPNDT 116

Query: 388 XXXXXXKFEHFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSN 447
                 + +  ++ QI + L K K +   FD +F ++LNIK ++YT+ DRF+ D++FL N
Sbjct: 117 ------EVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGN 170

Query: 448 VVHLILQNFQEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQEL 507
            + LI +NFQ EYPKALT+LLTHPLFP+ CT  LL +L++HPRLFKQAIVTCPNLPL +L
Sbjct: 171 SLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDL 230

Query: 508 LSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSN-DENAIRS 566
           L ELF++ N EL LD+SLRILQD++ D IK  +++ +K+DV  FI FV++ N DE+ +++
Sbjct: 231 LQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKN 290

Query: 567 SHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAK 626
             +LFQLL+LVLDS+GLFAL+   LD+L++YI  ++++ ++N +L +L+D++       +
Sbjct: 291 KPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQ 350

Query: 627 SGAGSVGSTREAVPKYTVEYLDL 649
             A S+     A+  Y+VE L+L
Sbjct: 351 HHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  361 bits (926), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 244/674 (36%), Positives = 370/674 (54%), Gaps = 90/674 (13%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPS+SQ F +  +P+ +S S     ++ L         SN + + IS+ A+S++V+NPTP
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSHSLTA------NSNSLDVAISKYAVSKFVINPTP 54

Query: 61  KLVLSIPIPSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLK 120
           KL+ SIPIPS  +VTA                      T  V  K +   NG        
Sbjct: 55  KLINSIPIPSNEVVTA---------------FHDTVFATATVNQKYTLHLNGK------- 92

Query: 121 VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAND 180
            KV  Q+  + +   +   + +L+NG I+ YD  L +  +    + D+   +F       
Sbjct: 93  -KVPIQSKIMKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFI------ 144

Query: 181 FLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSII-LEDFSLATSKICYQSGRLYRLI 239
                    E K    + + S+  Y+   + EL ++  ++D  +  S      G+LY+  
Sbjct: 145 ---------ESKYALLISQNSISLYDINTMIELRNVANVQD--IVDSDFKSLDGKLYQFN 193

Query: 240 GH--EVLVYALPQCQLVQAVTLPMVQGA--DVISMKPISSNRILVTADNKIYLLNLTHNS 295
               +  ++ +    +V  +T+P +     DV+S   +  N +++  ++ IY LNL  +S
Sbjct: 194 QKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALNLHLSS 253

Query: 296 ILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGT 355
           ++   EL +LK F+L+           +L NQ  FV+G+      N     E++N+D+ +
Sbjct: 254 VISMSELLNLKWFKLI----------DNLSNQ--FVLGLS---FNNENYKFELINLDLNS 298

Query: 356 G-TLKDSLGKGF-----TVSNEPISQVLKPLFSXXXXXX---XXXXXKFEH-FDFNQIYQ 405
              LKDSLGKGF        +E  + VLK LFS                EH F++++I  
Sbjct: 299 NFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKIIV 358

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-----EEY 460
            L K  ++ S FD+IF  + NIK+EHYTE DRF+ ++ FL+ V+ LILQN++       Y
Sbjct: 359 DLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNY 418

Query: 461 PKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELS 520
           PK LT+LLTHPLFPV  T  LL + RE PRL+KQAIVTCPNLPL ELL++LF+IEN ELS
Sbjct: 419 PKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELS 478

Query: 521 LDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDS 580
           LDISLR+LQDYT D IK++++ L K+D++NFIEFV    D+   + S QLFQLLSL++DS
Sbjct: 479 LDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDQ---QVSSQLFQLLSLIIDS 535

Query: 581 IGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGST----- 635
           IGLFALD  +L R++++I E+  +A++NS+L HLLD   + +  A+  +  + +      
Sbjct: 536 IGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLINNNNKSLH 595

Query: 636 REAVPKYTVEYLDL 649
           R+ +P YTVE+LDL
Sbjct: 596 RKTLPTYTVEHLDL 609

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 236/669 (35%), Positives = 358/669 (53%), Gaps = 87/669 (13%)

Query: 3   SLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKL 62
           S+SQ F +A +PR AS      QT  L     +   +N + + +S+ +ISQY++NPTPKL
Sbjct: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57

Query: 63  VLSIPIPSTNIVTACD---VARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVL 119
           V S  IPS   VTA D    A     + +C  L       L  A         VN    L
Sbjct: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAV--------VN---CL 106

Query: 120 KVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAN 179
             K+ D++V             +L++G +Q Y    ++  +  +   D+   +F      
Sbjct: 107 SEKIHDESV---------VTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQVEFI----- 151

Query: 180 DFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYR-- 237
           D  + L    +    ++L  L+        ++  +++  E F     +I    G++Y+  
Sbjct: 152 DGQYALIVAAQSTALYELENLT-------ELRVSTTLHFEQFK----QIRQHLGKIYQFD 200

Query: 238 LIGHEVLVYALPQCQLVQAVTLPMV---QGADVISMKPISSNRILVTADNKIYLLNLTHN 294
           L  ++  ++ L     +  V +P +   +GA  ++   +  +R+ +   N+IYLL+L   
Sbjct: 201 LATNDFKIFELTTLNEIGVVNIPFLSASKGAP-LTFTVVGDSRVCLALANEIYLLDLHLG 259

Query: 295 SILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHG-KNPTSSLEIVNVDV 353
           S+L   +   LK  +L+  A              +F I +   HG ++   SL+I+N+++
Sbjct: 260 SVLSHNKFAQLKQVELIAGA-----------RDGSFAIALS--HGPQDNAVSLDIINLEL 306

Query: 354 GTGTLKDSLGKGFTV----SNEPISQV-LKPLFSXXXXXXXXXXXKFEHFDFNQIYQHLE 408
           G+ ++KDSLGKGF           SQV L+P+                 FD+  I + L 
Sbjct: 307 GSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTK-------RSFDYASILKKLT 359

Query: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEE----YPKAL 464
              +  + FD+IF +EL I +E YTE DRFI D+ FLS  V +IL+N+  E    YP A 
Sbjct: 360 AAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAF 419

Query: 465 TFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDIS 524
           T+LLTHPLFP D T  LLS++++ PRL+KQ IVTCPNLPL ELL+E F IEN ELSLD+S
Sbjct: 420 TYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLS 479

Query: 525 LRILQDYTTDMIKQEVRKLNKIDVQNFIEFVI---SSNDENAIRSSHQLFQLLSLVLDSI 581
           L+ILQDYT D IK+E++ L +++V NFI+FVI   +++DE+++ ++ QLFQLLSLV+DSI
Sbjct: 480 LKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSV-ATPQLFQLLSLVIDSI 538

Query: 582 GLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAV-P 640
           GLFALDG LL  LA YI   V IAE N++L +LL+ + N    A S       T++ V P
Sbjct: 539 GLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFP 598

Query: 641 KYTVEYLDL 649
            Y V++L++
Sbjct: 599 PYLVDHLEI 607

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  187 bits (475), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 16/214 (7%)

Query: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60
           MPS+SQ F+L  LP++ASL+N+A Q ++LQVAD + P +NR+ +GIS SAISQYV+NPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLVLSIPIPSTNIVTACDVAR---------SDEQEIWCYALQAGK---VCTLN--VASKV 106
           KLV ++PI STN+VTACDVA          ++  E+ CYALQA K   +C +   + S  
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 107 SHAENGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYS 166
           + +  G  +    KV + +QAV V V    K+IV VL +GLIQF+D+ LKL HS+D SY 
Sbjct: 121 TDSSFG-ETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYG 179

Query: 167 DVS-VTKFFTEGANDFLFILCSLPEDKVCFKLFE 199
           +V  V  F +E   DF+F+L  L   KV FKL +
Sbjct: 180 NVQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 56/126 (44%), Gaps = 21/126 (16%)

Query: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68
           K A+L R  S SNFA  T   ++A + +P S +  IG+++  + Q  ++   KL      
Sbjct: 487 KAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL------ 540

Query: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128
                  A D++R+ E+++        +  T   A+K+   +  + +D V+  K+ +   
Sbjct: 541 ----FEAAADLSRAFEEKL--------QATTFAEAAKI---QKRIRADPVMSAKIQETLD 585

Query: 129 GVHVNG 134
                G
Sbjct: 586 AYRAQG 591

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 115 SDDVLKVKVDDQAVGVHVNG-KDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKF 173
           +D+  +  VD++AV +  N  ++ T+ V   +G ++ +D Q   + +  +S ++   + F
Sbjct: 187 TDEARRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNF 246

Query: 174 FTEGANDFLF------ILCSLPEDKVCFKLFELSLPN 204
            + G ND  +      IL +  E      LF+    N
Sbjct: 247 DSRGVNDVSWMSQHDSILAACGERSDSLALFDTRAQN 283

>KLTH0F09108g Chr6 complement(782647..784806) [2160 bp, 719 aa] {ON}
           some similarities with uniprot|P05453 Saccharomyces
           cerevisiae YDR172W SUP35 Translation termination factor
           eRF3 altered protein conformation creates the [PSI( )]
           prion a dominant cytoplasmically inherited protein
           aggregate that alters translational fidelity and creates
           a nonsense suppressor phenotype
          Length = 719

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465
           H++KN  ++   +RI +  +NI  E   E+D  +C  Q     V L ++  +EE   +  
Sbjct: 547 HIKKNTSTLLMPNRIPVEIVNIYNETEAEVDMAVCGEQ-----VRLKIKGVEEE-DISPG 600

Query: 466 FLLTHPLFPVDCTPKLLSRL 485
           F+LT P  PV    K ++ +
Sbjct: 601 FVLTSPKNPVKNVTKFIAEI 620

>KAFR0B06010 Chr2 (1243008..1245053) [2046 bp, 681 aa] {ON}
           Anc_8.370 YDR172W
          Length = 681

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465
           H++K + ++   +RI +   NI  E  +E+D  +C  Q     V L ++  +EE   A  
Sbjct: 509 HIKKGQSTLLMPNRISVEVQNIYNETESEVDMAVCGEQ-----VKLRIKGVEEEDISA-G 562

Query: 466 FLLTHPLFPVDCTPKLLSRL 485
           F+LT P  PV    K ++++
Sbjct: 563 FVLTSPKNPVKNVTKFVAQI 582

>AGL145W Chr7 (428550..430625) [2076 bp, 691 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR172W (SUP35)
          Length = 691

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465
           H++K  Q++   ++I +  L I+ E   E+D  +C  Q     V L L+  +EE   A  
Sbjct: 519 HIKKGNQTLLMPNKIPVEILAIQNETEQEVDMAVCGEQ-----VRLRLKGVEEEDISA-G 572

Query: 466 FLLTHPLFPVDCTPKLLSRL 485
           F+LT P  PV    K + ++
Sbjct: 573 FVLTSPKNPVKNVTKFVDQI 592

>Kpol_1036.104 s1036 (268670..270733) [2064 bp, 687 aa] {ON}
           (268670..270733) [2064 nt, 688 aa]
          Length = 687

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465
           H++K   ++   +RI +   NI  E   E+D  IC  Q     V L ++  +EE   A  
Sbjct: 515 HIKKGNSTLLMPNRIPVEIQNIYNETENEVDMAICGEQ-----VKLRIKGVEEEEISA-G 568

Query: 466 FLLTHPLFPVDCTPKLLSRL 485
           F+LT P  PV    K ++ +
Sbjct: 569 FVLTSPKNPVKSVTKFVAEI 588

>TBLA0A04570 Chr1 complement(1128781..1132824) [4044 bp, 1347 aa]
           {ON} Anc_7.57 YOR336W
          Length = 1347

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 74/180 (41%), Gaps = 26/180 (14%)

Query: 3   SLSQSFKLAVLPRVASLSNFAFQTNFL-----QVADD----IEPTSNRITIGISESAISQ 53
           S +  F+   +P      NF+  T F+     +V D     +E  +  I I       S 
Sbjct: 188 STTGKFRYIWIPTCIPEGNFSPDTFFMSATPIKVTDKKFSRLEWNNEEINIPDDLKEASY 247

Query: 54  YVLNPTPKLVLSIPIPSTNIVTACDVARSDEQEIWCYA--------LQAGKVCTLNVASK 105
            V NPTP+ +  + I   +++T     R + ++I  Y         L   ++  LN+  K
Sbjct: 248 TVFNPTPEDLKDLDIKVASLITDRFQKRKNIKDIIMYTKELVNNFILLGERLLKLNINEK 307

Query: 106 VSHAENGVNSDDVLKVKVDDQAVGVHVNGKDKTIV----VVLKNGLIQFYDFQLKLLHSL 161
           +  A     S     + VD   +G+++NG++  +       L NG++  Y   + L +SL
Sbjct: 308 ILAANEEWKS-----LGVDYNLLGLYINGQNIKLTSLNEYTLLNGIVAEYKRMIFLKNSL 362

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 511 KATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIML------ 564

Query: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128
                  + D+AR+ E+++        +  T   A+KV      + SD +L  K+ +   
Sbjct: 565 ----FEESADLARTMEEKL--------QAITFAEAAKVQQK---IRSDPILAAKIQETLA 609

Query: 129 GVHVNG 134
            +   G
Sbjct: 610 KLREQG 615

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 511 KATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIAL------ 564

Query: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128
                  + D+AR+ E+++        +  T   A+KV      + SD VL  K+ +   
Sbjct: 565 ----FEESADLARTMEEKL--------QAITFAEAAKVQQR---IRSDPVLATKIQETLA 609

Query: 129 GVHVNG 134
            +   G
Sbjct: 610 KLREQG 615

>Kpol_312.6 s312 complement(12357..13139,13142..13636) [1278 bp, 425
           aa] {ON} complement(12357..13139,13142..13636) [1278 nt,
           426 aa]
          Length = 425

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 77/177 (43%), Gaps = 10/177 (5%)

Query: 467 LLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLR 526
           L  HPL  +    + L+ L E+ R FK        L  QE+ ++  SI       D   R
Sbjct: 19  LSIHPLKTLVLYDERLTELNEYSRFFKSLKDRSYELLYQEIGNDTESIP----LFDKEDR 74

Query: 527 ILQDYTTDMIKQEVRKLNK-IDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLF- 584
           +  +     +K   + LNK I V++F++F  +  D   + +   +   +   L+ +G++ 
Sbjct: 75  LYDNLVVFPVKG--KHLNKLIPVKSFLQFYENGGDILTVTNPDAVTDSVRFFLNELGVYP 132

Query: 585 -ALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVP 640
              D VL D   D I E+V+++  N     +   ++ +     SGA  + +  + VP
Sbjct: 133 SPKDYVLTDYFED-IPEKVSVSSENLLSNRVYSVREEAFCIQNSGAALLDNREQIVP 188

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 511 KATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITL------ 564

Query: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128
                  + D+AR+ E+++        +  T   A+KV      + SD VL  K+ +   
Sbjct: 565 ----FEESADLARTMEEKL--------QAITFAEAAKVQQR---IRSDPVLAKKIQETLA 609

Query: 129 GVHVNG 134
            +   G
Sbjct: 610 KLREQG 615

>TBLA0B06300 Chr2 (1489321..1490358) [1038 bp, 345 aa] {ON}
           Anc_4.338 YLR447C
          Length = 345

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 503 PLQELLSELFSIENGELSLDISLRILQ--DYTTDMIKQ---EVRKLNKIDVQNFIEFVIS 557
           P  E++SEL + E    S++ISL  LQ  D  +++ +Q   E  KL  I+    IE    
Sbjct: 203 PANEIMSELLAFEADRRSINISLNSLQSDDIDSNLKRQLLPEFGKLYPIETNRLIE---- 258

Query: 558 SNDENAIRSSHQLFQLLSLVLDSIGL 583
           +ND   IR++    Q    +LDS  L
Sbjct: 259 ANDFELIRTAINNVQEYKGILDSGNL 284

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 55/126 (43%), Gaps = 21/126 (16%)

Query: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 511 KATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITL------ 564

Query: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128
                  + D+AR+ E+++        +  T   A+KV   +  + SD +L  K+ +   
Sbjct: 565 ----FEESADLARTMEEKL--------QAITFAEAAKV---QKRIRSDPILAAKIQETLA 609

Query: 129 GVHVNG 134
            +   G
Sbjct: 610 KLREQG 615

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,538,956
Number of extensions: 2920355
Number of successful extensions: 9245
Number of sequences better than 10.0: 53
Number of HSP's gapped: 9396
Number of HSP's successfully gapped: 53
Length of query: 649
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 533
Effective length of database: 40,180,143
Effective search space: 21416016219
Effective search space used: 21416016219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)