Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055603.488ON31131115760.0
Kpol_480.173.488ON3133028251e-109
TBLA0C044503.488ON3093117711e-101
ZYRO0D10076g3.488ON3053097621e-100
TPHA0D042203.488ON3163187452e-97
YPR147C3.488ON3043107381e-96
Skud_16.4423.488ON3043107294e-95
Smik_16.4003.488ON3043107216e-94
Suva_16.4763.488ON3043107131e-92
CAGL0L08514g3.488ON3123136774e-87
NCAS0F035303.488ON3133156756e-87
Kwal_55.212193.488ON3022986573e-84
NDAI0B058303.488ON3293316332e-80
KLTH0F14740g3.488ON3023036147e-78
SAKL0F02860g3.488ON3053126113e-77
AFR306C3.488ON3192894836e-58
Ecym_12413.488ON3052894748e-57
KAFR0E03110singletonON356112880.014
ZYRO0F09064g8.524ON349112870.020
Skud_2.3318.524ON376155830.061
NDAI0C054308.524ON362118830.063
TBLA0H035408.524ON378147830.071
NCAS0B022608.524ON363136820.081
TPHA0L016008.524ON372118760.50
Smik_2.3458.524ON375183750.59
Suva_4.4598.524ON375156731.3
ZYRO0C16544g3.368ON75946731.4
KLTH0D05742g2.487ON313107721.4
Kwal_27.119758.524ON33694711.9
YBR204C (LDH1)8.524ON375157693.4
KLTH0G05720g5.612ON49744693.6
KNAG0J016308.662ON28867683.7
Ecym_55875.612ON52544684.5
TPHA0K00200na 1ON31472675.0
Ecym_28157.541ON152454685.4
CAGL0F01133g7.100ON53271675.8
KLTH0E12188g8.524ON336150676.1
SAKL0H10450g8.524ON39268659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05560
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   611   0.0  
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   322   e-109
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   301   e-101
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   298   e-100
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   291   2e-97
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   288   1e-96
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   285   4e-95
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   282   6e-94
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   279   1e-92
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   265   4e-87
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   264   6e-87
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   257   3e-84
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   248   2e-80
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   241   7e-78
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   239   3e-77
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   190   6e-58
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   187   8e-57
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               39   0.014
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    38   0.020
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    37   0.061
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    37   0.063
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    37   0.071
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    36   0.081
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    34   0.50 
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    33   0.59 
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    33   1.3  
ZYRO0C16544g Chr3 (1285279..1287558) [2280 bp, 759 aa] {ON} high...    33   1.4  
KLTH0D05742g Chr4 (512469..513410) [942 bp, 313 aa] {ON} similar...    32   1.4  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    32   1.9  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    31   3.4  
KLTH0G05720g Chr7 (455630..457123) [1494 bp, 497 aa] {ON} simila...    31   3.6  
KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662     31   3.7  
Ecym_5587 Chr5 complement(1203104..1204681) [1578 bp, 525 aa] {O...    31   4.5  
TPHA0K00200 Chr11 complement(33601..34545) [945 bp, 314 aa] {ON}...    30   5.0  
Ecym_2815 Chr2 (1579747..1584321) [4575 bp, 1524 aa] {ON} simila...    31   5.4  
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    30   5.8  
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    30   6.1  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    30   9.7  

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/311 (95%), Positives = 298/311 (95%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGW        
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 181 XXXXXILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRR 240
                ILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRR
Sbjct: 181 FLPSFILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRR 240

Query: 241 LIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCKIPHSFVLNHS 300
           LIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCKIPHSFVLNHS
Sbjct: 241 LIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCKIPHSFVLNHS 300

Query: 301 KYLISEYFEDS 311
           KYLISEYFEDS
Sbjct: 301 KYLISEYFEDS 311

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  322 bits (825), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 205/302 (67%), Gaps = 4/302 (1%)

Query: 11  YPTSIVHFKSISIR-GKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGM 69
           YPTSIVH   ++      + PLFVWIPGNPGL+EYY +FL L+H+++P WEVLGISHAGM
Sbjct: 12  YPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGM 71

Query: 70  STASVSKSEKSERND---VYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVL 126
           S     K +K+  ND   V+ L++Q+ HK++II  FSS NRPLIIMGHSVGAY+ Q +++
Sbjct: 72  SYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIM 131

Query: 127 SDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXXXXXXXI 186
           ++KL GK+ K+G LTPT++DIH S KG+ +TKV  W  +LP   GW              
Sbjct: 132 TNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFF 191

Query: 187 LRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCN 246
           ++  +S  + C  +S+ VL +  LL N   ++QALGL+ YEME I  DW F ++LI +CN
Sbjct: 192 VKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCN 251

Query: 247 ERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCKIPHSFVLNHSKYLISE 306
           E G+ TW LF++ DHWVA +TR+++I FY+ H + + I+I    IPH+FV+  SKY++ +
Sbjct: 252 ETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDTIPHAFVIKKSKYIVDQ 311

Query: 307 YF 308
           YF
Sbjct: 312 YF 313

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  301 bits (771), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 199/311 (63%), Gaps = 5/311 (1%)

Query: 1   MAAREYIKCAYPTSIVHFKSI-SIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEW 59
           M  + Y    YPTSIVHF      +   + PLF+WIPGNPGL+EYY + L  +H ++P W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EVLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAY 119
           E+LG+SHAGMS  +  K+  S +  VY+L +Q+ HK+E+I +FSS  R +IIMGHSVGAY
Sbjct: 61  EILGVSHAGMSNGNQIKNVLSTK--VYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAY 118

Query: 120 MVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXX 179
           M Q +++   L+G V K+GL+TPT++DIH S KG+ +T+     ++LP   G        
Sbjct: 119 MAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFS 178

Query: 180 XXXXXXILRILLSFFMGCHRNSS-GVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQ 238
                   R LL+  MGC  N +     +TV L NG FVKQ LGL+ +EM+ IR DW FQ
Sbjct: 179 KLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQ 238

Query: 239 RRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSFVL 297
           +RLI +CN+  +STW LFS +DHWV+D TR +LI FYR + ++D + +     IPHSFV+
Sbjct: 239 KRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVI 298

Query: 298 NHSKYLISEYF 308
           N S + ++ YF
Sbjct: 299 NFSDFTVNSYF 309

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  298 bits (762), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 205/309 (66%), Gaps = 5/309 (1%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M+ R       PTS++H K  S    S   LFVWIPGNPG+++YYEEFL L+H ++  +E
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPSSP--LFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +L ISHAGM+T      ++  +  +Y+L  QI HK+EII  FS+ +RPLI+MGHSVGAYM
Sbjct: 59  ILAISHAGMATEDPDLQKR--KATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYM 116

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
            QH+VL++KL+G+V K+GL+TPT++DIH S+KG  LT+  YW+K LP +A W        
Sbjct: 117 AQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNK 176

Query: 181 XXXXXILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRR 240
                    ++S FMG  + S  V T+  L++N E ++QALGL+  EM++IR  W FQ++
Sbjct: 177 LSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKK 236

Query: 241 LIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSFVLNH 299
           LI HCN   I T  +FS +D WV++ TRE L+ FYR++YR   ++I   + + HSF++ H
Sbjct: 237 LIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKH 296

Query: 300 SKYLISEYF 308
           SKY++ EYF
Sbjct: 297 SKYIVDEYF 305

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  291 bits (745), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 203/318 (63%), Gaps = 12/318 (3%)

Query: 1   MAAREYIKCAYPTSIVHFKSISI---------RGKSECPLFVWIPGNPGLIEYYEEFLML 51
           M    +    +PTSI+  K   +         +     PLFVWIPGNPGL+EYYEEFL L
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  IHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLII 111
           +H ++PEW++LGISHAGMS+ +   + K     VY+L +QI HK+EII  F++  R LI+
Sbjct: 61  LHVKNPEWDILGISHAGMSSGN--SNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIV 118

Query: 112 MGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAG 171
           MGHSVGA+M Q +V+S+KL GKV K+GLL PT++DIH S+KG  ++ +L W+ +LPQLAG
Sbjct: 119 MGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAG 178

Query: 172 WXXXXXXXXXXXXXILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEI 231
           W             +++ ++SFFM  +  +     T   L++  FV+Q+LGL+ YEM+ I
Sbjct: 179 WVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQII 238

Query: 232 RSDWAFQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCK 290
           R DW FQR L+  CN   I  W LF++SDHWV++ TR +LI+ YR+   +D      T +
Sbjct: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298

Query: 291 IPHSFVLNHSKYLISEYF 308
           +PH+FV+ +S +++  YF
Sbjct: 299 VPHAFVIKNSCHVVDNYF 316

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  288 bits (738), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 200/310 (64%), Gaps = 8/310 (2%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M  +EY K   P SI++ K    +   + PL VWIPGNPGL+ YY+E L  +H +HP+WE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +LGISHAGM+  + S +       ++SL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  ILGISHAGMTLNAHSNTP------IFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYI 114

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           VQ + LS+KLVG V K+GL+TPT++DIHTS+ G+ +T  L ++  L  +           
Sbjct: 115 VQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYW 174

Query: 181 XXXXXILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239
                  R ++  FMGC       VL+T + L + +FV+Q+LGL+  EMEEI ++W FQ 
Sbjct: 175 ILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQD 234

Query: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298
           R I +C E GIS W LFS +DHWV+  TR  L  +Y+D  + +++KI  T KIPHSFV+ 
Sbjct: 235 RFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVK 294

Query: 299 HSKYLISEYF 308
           H++Y I+ +F
Sbjct: 295 HAEYAINAFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  285 bits (729), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 200/310 (64%), Gaps = 8/310 (2%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M  +EY K   P SI++ K        + PL VWIPGNPGL+ YY+E L  +H +HP+WE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +LG+SHAGM+  + S +       ++SL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  ILGVSHAGMTLNAHSNTP------IFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           +Q + LSDKLVG V K+GL+TPT++DIHTS+ GV +T VL+++  L  +           
Sbjct: 115 LQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYW 174

Query: 181 XXXXXILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239
                + R ++  FMGC       VL+T +LL + +FV+Q+LGL+  EM+EI ++W FQ 
Sbjct: 175 ILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQD 234

Query: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298
             I +C E  I  W LFS  DHWVAD TR  L  +Y+D  + +++KI  T KIPHSFV+ 
Sbjct: 235 EFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVK 294

Query: 299 HSKYLISEYF 308
           H++Y ++ +F
Sbjct: 295 HAEYAVNTFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  282 bits (721), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 197/310 (63%), Gaps = 8/310 (2%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M  +EY K  +P SI++ K    R   +  L VWIPGNPGL+ YY+E L  +H +HP+WE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +LGISHAGM+  + S +       VYSL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  ILGISHAGMTLNAHSNTP------VYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           +Q + LS  LVG V K+GL+TPT++DIHTS+ GV LT  L+++  L  +           
Sbjct: 115 LQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYW 174

Query: 181 XXXXXILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239
                  R ++  FMGC   S   VL+T + L + +FV+Q+LGL+  EMEEI ++W FQ 
Sbjct: 175 ILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQD 234

Query: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298
           + I +C + G   W LFS +DHWV+  TR  L  +Y+D    ++++I  T KIPHSFV+ 
Sbjct: 235 KFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVK 294

Query: 299 HSKYLISEYF 308
           H+KY I+ +F
Sbjct: 295 HAKYAINTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  279 bits (713), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 202/310 (65%), Gaps = 8/310 (2%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M+ +EY K   P SI++ K        + PL VWIPGNPGL+ YY+E +  +H +HP+WE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +LGISHAGMS+ + S +       ++SL+ Q+DH++++I +FS  NR +IIMGHSVGAY+
Sbjct: 61  ILGISHAGMSSNARSNTP------IFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYI 114

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           VQ + LS++LVG V K+GL+TPT++DIH S+ GV +T   +++  L  +  +        
Sbjct: 115 VQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYW 174

Query: 181 XXXXXILRILLSFFMGCHR-NSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239
                + ++++  FMGC       VL+T + L + +FV+Q+LGL+  E++EI ++W FQ 
Sbjct: 175 VLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQD 234

Query: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298
           + I HC E+GI TW LFS  DHWV D TR+ L  +Y D  + + ++I  T K+PHSFV+ 
Sbjct: 235 KFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVK 294

Query: 299 HSKYLISEYF 308
           H++Y I+ +F
Sbjct: 295 HAEYAINAFF 304

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  265 bits (677), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 192/313 (61%), Gaps = 6/313 (1%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M+ + Y   A PT I+H K          PLFVWIPGNPGL+EYY+EFL  +H ++P WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERND--VYSLKQQIDHKLEIIKDFSS-TNRPLIIMGHSVG 117
           +LGISHAG    S S+ +K  +N   +Y LKQQ  HK++II   ++  NR L+IMGHSVG
Sbjct: 61  ILGISHAGTVIES-SQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVG 119

Query: 118 AYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXX 177
           AY+ QH+V S  LVG+V+K+GL+TPTI DIH S  G++ T+V  ++ ++ +   +     
Sbjct: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179

Query: 178 XXXXXXXXILRILLSFFMGCHRNSSGV-LTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236
                     ++L+SF MGC  +   + L T +LL   E ++Q LGL+ +EM EIR DWA
Sbjct: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239

Query: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSF 295
           FQ  L+  C + G   WLLFSD+DHWV+  T+ +LIKF +D Y    +++   K I HSF
Sbjct: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299

Query: 296 VLNHSKYLISEYF 308
           V+     +   YF
Sbjct: 300 VVKDVDLVTRRYF 312

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  264 bits (675), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 197/315 (62%), Gaps = 9/315 (2%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M+   Y    +PT +VH   + I+     P+FVWIPGNPG++EYY+E L+ +H +HP WE
Sbjct: 1   MSVEAYDDDEFPTCVVHI--LPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  VLGISHAGMSTASVS--KSEKSERNDVYSLKQQIDHKLEIIKDF-SSTNRPLIIMGHSVG 117
           +L ISH GM+T + S  K    + + V++LK+QI HK++II +F   +N P+ I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 118 AYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYW-LKDLPQLAGWXXXX 176
           AYMVQ IV SD+L+G+V KMGL+TPTI+DIH S+KG  +T+   W  + LP +  +    
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 177 XXXXXXXXXILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236
                    +   ++ + MGCH +S   ++T + L    FV+Q+LGL+  EM+ I  DW 
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQ 238

Query: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADK--IKIHTC-KIPH 293
           FQ  LI +C +  I    LFS +DHWV + TR+++I+FY++  +  K  +KI    + PH
Sbjct: 239 FQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPH 298

Query: 294 SFVLNHSKYLISEYF 308
           SFV+  SKY++  YF
Sbjct: 299 SFVVRRSKYVVEHYF 313

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  257 bits (657), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 181/298 (60%), Gaps = 8/298 (2%)

Query: 12  PTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMST 71
           P S+ H  +       E PLFV+IPGNPGLIE+YE FL  IH ++P WE+LGISHAGM++
Sbjct: 12  PCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNS 71

Query: 72  ASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLV 131
            S       E + VYSL+QQIDHK+EII  +    +P+IIMGHSVGA+MVQ I  S +L 
Sbjct: 72  CS------EEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLK 125

Query: 132 GKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXXXXXXXILRILL 191
            KV ++GLLTPT++DIH S+KGV LT +  W      +                I + ++
Sbjct: 126 SKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSII 185

Query: 192 SFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGIS 251
           S  +   ++  G  TT +L+ N  FVKQALGL+  E+  IRSDWA+Q+  ++ C E    
Sbjct: 186 SLLVDDPQSCLGA-TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTK 244

Query: 252 TWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLNHSKYLISEYF 308
            W LFS+ DHWV+ TTR D+I FYR H      +I  +  I H+FV  H+  +I +YF
Sbjct: 245 IWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  248 bits (633), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 197/331 (59%), Gaps = 25/331 (7%)

Query: 1   MAAREYIKCAYPTSIVHFKSISI--RGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPE 58
           M  + Y +  YPTSI+H ++  +     S  PLF+WIPGNPG+++YY++FL  +H++HP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEVLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSST---------NRPL 109
           WE+L I HAGM T+       ++R  +Y L +QI+HK+E+I  F +           RPL
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDR--IYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPL 118

Query: 110 IIMGHSVGAYMVQHIVLSDKLVGKV-------AKMGLLTPTILDIHTSKKGVVLTKVLYW 162
           +IMGHSVG YM+Q +VL+ +    +        K+G +TPTI+DI+ S KG++++  L  
Sbjct: 119 VIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQL 178

Query: 163 LKD-LPQLAGWXXXXXXXXXXXX--XILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQ 219
               LP +  +               I R L+++ MGC       + T +LL N   VKQ
Sbjct: 179 THGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQ 238

Query: 220 ALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHY 279
           +LGL+  EM+EIR +W  Q++ + +CN   I  WLLF ++DHWV + TR DLIKFY+ +Y
Sbjct: 239 SLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY 298

Query: 280 R-ADKIKIH-TCKIPHSFVLNHSKYLISEYF 308
           +   +++I  + + PHSFV+NHS +++  +F
Sbjct: 299 KDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  241 bits (614), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 18/303 (5%)

Query: 12  PTSIVHFKS-ISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMS 70
           P+SI+H KS +S  G   C LFV+IPGNPGLIEYY  FL  +H ++P+WE+LGISHAGM+
Sbjct: 12  PSSILHLKSGVSSLGSDAC-LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70

Query: 71  TASVSKSEKSERND----VYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVL 126
           +           ND    VY+L++QI+HK+++I  ++  N+ + IMGHSVGA++ Q +V 
Sbjct: 71  SC----------NDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120

Query: 127 SDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXXXXXXXI 186
           S  L  +VA++GLLTPT++DIH S+KG+ LT +        QL                +
Sbjct: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180

Query: 187 LRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCN 246
              ++S F    +   G   T +LL N  FVKQALGL+  EM+ IRSDW +Q+  + +C 
Sbjct: 181 TSWIISHFADDPKTCLGA-ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCE 239

Query: 247 ERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLNHSKYLIS 305
            +G   W LFSD+DHWV+  TR+DLI+FY  H   + + I  +  I H+FV  H++ ++ 
Sbjct: 240 TKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQ 299

Query: 306 EYF 308
            YF
Sbjct: 300 HYF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  239 bits (611), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 181/312 (58%), Gaps = 13/312 (4%)

Query: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60
           M  + Y K  + +S+ H K ++    S+ PLFV+IPGNPGLIE+Y+ FL  I ++H  WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120
           +LGISHAGM T      + ++   VYSLK Q+ HK+ +I DF S+NRPLII GHS+GAY+
Sbjct: 61  ILGISHAGMITKCKGLKKPTK---VYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYI 117

Query: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXX 180
           VQ I L   L+G V K+ LLTPT++DIH S+KG  L  +  W  +               
Sbjct: 118 VQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEK 177

Query: 181 XXXXXILRILLSFFMG----CHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236
                I   +LS F+G    C R ++ +L T     N EFV+Q+LGL+  EM+++R DW 
Sbjct: 178 MLPQTITEKILSLFVGSEQTCVREAAKLLVT-----NYEFVQQSLGLAREEMQKVRDDWN 232

Query: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKI-HTCKIPHSF 295
           FQ   +  C  + +    LF+  DHWV   TR DL +FY  +Y  D + I    KI HSF
Sbjct: 233 FQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSF 292

Query: 296 VLNHSKYLISEY 307
           VLN +K ++  Y
Sbjct: 293 VLNDTKSVVDRY 304

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  190 bits (483), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 163/289 (56%), Gaps = 12/289 (4%)

Query: 26  KSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDV 85
           + EC + +++PGNPGLI +Y EFL  IH ++P WE++GISH GMS    +K+   +   V
Sbjct: 37  QPEC-ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMS----AKTGPEDLKRV 91

Query: 86  YSLKQQIDHKLEIIKDF--SSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPT 143
           Y+L +Q++HK++ I DF  +  N  + ++GHS+GAYM Q +V+   L   V  +GLLTPT
Sbjct: 92  YTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPT 151

Query: 144 ILDIHTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXXXXXXXILRILLSFFMGCHRNSSG 203
           I+DIH S KGV LT++  W     +                  +  L    +G   +   
Sbjct: 152 IIDIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGG-SDECV 210

Query: 204 VLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWV 263
           + +   L++N  +V+QALG++  EM ++R+ W FQ   I  C ER  S WLLFS  DHWV
Sbjct: 211 LQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWV 270

Query: 264 ADTTREDLIKFYRDHY--RADKIKIHTCK--IPHSFVLNHSKYLISEYF 308
              T +D+++FY   Y   AD +   T    I HSFV+  +  +++ YF
Sbjct: 271 HSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  187 bits (474), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 158/289 (54%), Gaps = 18/289 (6%)

Query: 30  PLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLK 89
           PL ++IPGNPGLI +YEEFL  IH ++P WEV+GI H GMS+    +   S    V++L 
Sbjct: 25  PLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSL---RENNSLSGRVHTLD 81

Query: 90  QQIDHKLEIIKDF--SSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTILDI 147
           +QI+ K+++I +F  +  +R + ++GHS+GAYMVQ I L   L GK+  + LLTPTI+DI
Sbjct: 82  EQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDI 141

Query: 148 HTSKKGVVLTKVLYWLKDLPQLAGWXXXXXXXXXXXXX----ILRILLSFFMGCHRNSSG 203
           H S KGV LT++  W     + A                   I R L+     C   S+ 
Sbjct: 142 HRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECVLQSAQ 201

Query: 204 VLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWV 263
            L +T      EFVKQALGL+  EM ++R+ W FQ   I  C    I    LFS  DHWV
Sbjct: 202 KLVST-----PEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWV 256

Query: 264 ADTTREDLIKFYRDHYRADKIKIHTCKIP----HSFVLNHSKYLISEYF 308
              T +D+I+ Y   Y +D+  +    I     HSFV+  +  +++ YF
Sbjct: 257 HPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 31  LFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLKQ 90
           LF+ IPG  G +E +E  + LI   +  +  + +   G       KSE      +  +  
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFG-------KSEDYSNYSMTHIAT 134

Query: 91  QIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTP 142
            ID  LE +   +  N  + +MGHS+G ++  H          V K+ L++P
Sbjct: 135 LIDQMLETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 31  LFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLKQ 90
           LF++I G  G +E +E  L L+      +  L +   G          KS+  D Y + +
Sbjct: 85  LFLFIHGLGGELEQFEPLLRLVDAMDQRFLALDLPGFG----------KSDEWDEYPMLK 134

Query: 91  QIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTP 142
            ++   EI   F++    ++++GHS+G Y+  H   +   V  + ++ LL+P
Sbjct: 135 VVETIEEIAAKFNAAK--IVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 66/155 (42%), Gaps = 10/155 (6%)

Query: 22  SIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSE 81
            IRG +   +F+++PG  G +E +E  L LI      +  L +   G S+          
Sbjct: 83  GIRGDT---VFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKV 139

Query: 82  RNDVYSLKQQIDHK--LEIIKDFSST---NRPLIIMGHSVGAYMVQHIVLSDKLVGKVA- 135
              ++ L   +  K    + KD       NR +++ GHS+G ++  H+        KV  
Sbjct: 140 VELIFVLVCDVLKKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVE 199

Query: 136 KMGLLTPTILDIHT-SKKGVVLTKVLYWLKDLPQL 169
           KM LLTP    I   SK   ++   LY +  LP L
Sbjct: 200 KMVLLTPPKAHIEQLSKDRHLIQWALYGVFKLPWL 234

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

Query: 25  GKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERND 84
           G    PL+++I G  G++E +E  L L+     ++  L +   G S     + E     D
Sbjct: 85  GNHNEPLYLFIHGLGGVLEQFEPLLRLLDLNENKFLALDLPGFGKS----DEYEDYNMFD 140

Query: 85  VYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTP 142
           V S+   I  +L  I + +++N  ++++GHS+G Y+  H+           K+  L+P
Sbjct: 141 VISIIHTIVDRL--IPERTTSN--IVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 68/147 (46%), Gaps = 16/147 (10%)

Query: 30  PLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLK 89
           P++V++PG  G ++ YE  L L+       ++L     G        SE+      Y++ 
Sbjct: 95  PIYVFLPGLGGSLDQYEPLLRLM-------DILNEKFIGFDLPGFGGSEEDTSEGGYNMI 147

Query: 90  QQ---IDHKLE--IIKDFSSTNR-PLIIMGHSVGAYMVQHIVLS--DKLVGKVAKMGLLT 141
           +    I+  L+  I +++S+ +   L ++GHS+G Y+V H   S   K   K++++ L +
Sbjct: 148 KVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTS 207

Query: 142 PTILDIHTSKKGVVLTKV-LYWLKDLP 167
           P    I    K   L +  L  L  LP
Sbjct: 208 PPKKKIEPLDKNNRLNQFGLQLLYKLP 234

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 36.2 bits (82), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 10/136 (7%)

Query: 30  PLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLK 89
           PL ++I G  G +  +E  L L H +  ++  L +   G S    S S KS    + +++
Sbjct: 82  PLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSV---IETIR 138

Query: 90  QQIDHKLEIIKDFS-STNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTILDIH 148
             +D      K    +T   LI+ GHS+G Y+  H   +      + K+ LL+P    I 
Sbjct: 139 SVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPK-PIM 197

Query: 149 TSKKGVVLTKVLYWLK 164
           TS     L+K  YW +
Sbjct: 198 TS-----LSKRNYWTQ 208

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 16/118 (13%)

Query: 31  LFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLKQ 90
           ++++I G  G +E   +FL       P  ++  +S+       +    +SE ND Y++  
Sbjct: 91  IYIFIHGLGGSLE---QFL-------PLLKLTDLSNKSFIAVDLPGFGQSEFNDEYNIAN 140

Query: 91  QIDH------KLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTP 142
                     K ++   + +TN  +I+ GHS+G Y+  H     K   ++ K+ LL P
Sbjct: 141 YSMSSIIGFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 77/183 (42%), Gaps = 26/183 (14%)

Query: 5   EYIKCAYP---TSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEV 61
           E+ K   P   + I    +++ +G     +FV++PG  G +E +E  L L+      +  
Sbjct: 59  EFFKVQLPDRKSRIRTCHNLNDKGIRSDTVFVFVPGLAGNLEQFEPLLKLVDSDRKAFLA 118

Query: 62  LGISHAGMSTASVSKSEKSERN-------------DVYSLKQQIDHKLEIIKDFSSTNRP 108
           L +   G S      SE S+               DV   +  +  K + +  F+     
Sbjct: 119 LDLPGFGDS------SEWSDYPMLKVVELIFILLCDVLKGRPAVLSKDDNLNFFNG--HK 170

Query: 109 LIIMGHSVGAYMVQHIVLSDKLVGKVAK-MGLLTPTILDIHT-SKKGVVLTKVLYWLKDL 166
           L+++GHS+G ++  H+     +  KV K + LLTP    I   SK   +   VLY +  +
Sbjct: 171 LVLVGHSMGCFLACHLYEQHLVDAKVVKTLVLLTPPKAHIEQLSKDKRIYQWVLYGVFKM 230

Query: 167 PQL 169
           P L
Sbjct: 231 PWL 233

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 67/156 (42%), Gaps = 27/156 (17%)

Query: 31  LFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLKQ 90
           +FV++PG  G +E +E  L L+  +           A ++  S    + SE ND Y + +
Sbjct: 88  VFVFVPGLGGNLEQFEPLLKLLDSER---------KAFLAFDSPGFGQSSEWND-YPMLK 137

Query: 91  QIDHKLEIIKDF-----------SSTN----RPLIIMGHSVGAYMVQHIVLSD-KLVGKV 134
            ++    ++ D              TN    R ++++GHS+G ++  H+      ++  V
Sbjct: 138 VVELIFVLVCDVLKKWPTAVSKDDDTNLLNGRKIVLVGHSMGCFLACHLYEQHLAILNVV 197

Query: 135 AKMGLLTPTILDI-HTSKKGVVLTKVLYWLKDLPQL 169
            +  LLTP    I   SK   +    LY +  LP L
Sbjct: 198 KRFVLLTPPKAHIEQLSKDRRLFQWALYGIFKLPWL 233

>ZYRO0C16544g Chr3 (1285279..1287558) [2280 bp, 759 aa] {ON} highly
           similar to uniprot|P31244 Saccharomyces cerevisiae
           YBR114W RAD16 Protein that recognizes and binds damaged
           DNA in an ATP-dependent manner (with Rad7p) during
           nucleotide excision repair subunit of Nucleotide
           Excision Repair Factor 4 (NEF4) member of the SWI/SNF
           family
          Length = 759

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 74  VSKSEKSERNDVYSLKQQIDHKLEI--IKDFSSTNRPLIIMGHSVG 117
           V K +  E NDV  +KQ+ D   EI  IKD S  ++PL   G   G
Sbjct: 40  VKKEDDQEENDVQEIKQEQDDSGEILVIKDESDDDKPLAGRGSKRG 85

>KLTH0D05742g Chr4 (512469..513410) [942 bp, 313 aa] {ON} similar to
           uniprot|P28321 Saccharomyces cerevisiae YKL094W YJU3
           Protein of unknown function localizes to lipid particles
          Length = 313

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/107 (19%), Positives = 45/107 (42%), Gaps = 3/107 (2%)

Query: 41  LIEYYEEFLMLIHRQHPEWEVLGISHAGM---STASVSKSEKSERNDVYSLKQQIDHKLE 97
           ++  ++E+ +L  R   +   +GI         +   S  ++  R + Y     +DH +E
Sbjct: 56  VVHGFDEYTLLYSRLMDQLSKVGIESFAFDQRGSGETSPGKQRGRTNEYHTFNDLDHFIE 115

Query: 98  IIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTI 144
              +      PL + GHS+G  +V +   + +   ++A +    P I
Sbjct: 116 WNLEDKDPETPLFLFGHSMGGGIVLNYGCAGRFRDQIAGIVCTGPLI 162

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 11/94 (11%)

Query: 30  PLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLK 89
           P++V+I G  G +  +E          P   VL + + G  T  +     S+  D YS+ 
Sbjct: 79  PVYVFIHGLGGTLTQFE----------PLLRVLDVLNEGFLTIDLPGFGHSDELDSYSML 128

Query: 90  QQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQH 123
                  E++ + ++ N+ +I++GHS+G ++  H
Sbjct: 129 DIAKIIREVLVE-TTKNKKVIVVGHSMGCHIALH 161

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 14/157 (8%)

Query: 22  SIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSE 81
            IRG +   +FV++PG  G +E +E  L L+      +  L +   G S+          
Sbjct: 82  GIRGDT---VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKV 138

Query: 82  RNDVYSLKQQIDHKLEIIKDFSSTNRP-----LIIMGHSVGAYMVQHIV---LSDKLVGK 133
              ++ L   +  K       +    P     ++++GHS+G ++  H+    ++D     
Sbjct: 139 VELIFVLVCDVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMAD--TKA 196

Query: 134 VAKMGLLTPTILDIHT-SKKGVVLTKVLYWLKDLPQL 169
           V  + LLTP    I   SK   ++   LY +  LP L
Sbjct: 197 VQTLVLLTPPKAHIEQLSKDKHIIQWALYGVFKLPWL 233

>KLTH0G05720g Chr7 (455630..457123) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53687 Saccharomyces cerevisiae YOR025W HST3
           Member of the Sir2 family of NAD( )-dependent protein
           deacetylases involved along with Hst4p in telomeric
           silencing cell cycle progression radiation resistance
           genomic stability and short-chain fatty acid metabolism
          Length = 497

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 242 IVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIK 285
           I  CN  GI  + + SD D WV D  +ED+ +F++   + +K +
Sbjct: 322 IGDCNWHGIIDYQILSDCDAWV-DHLKEDIPEFFKTQQQVEKAR 364

>KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662
          Length = 288

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 80  SERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGL 139
           S R DV  +K+ +D+   +  +   + + ++IMGHS G+  V H +L+    G   + G+
Sbjct: 75  SLRTDVEEMKELVDY---LRSEEGGSRKKIVIMGHSTGSQDVIHYLLT---YGDSVQGGI 128

Query: 140 LTPTILD 146
           L  ++ D
Sbjct: 129 LQASVSD 135

>Ecym_5587 Chr5 complement(1203104..1204681) [1578 bp, 525 aa] {ON}
           similar to Ashbya gossypii AEL229W
          Length = 525

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 242 IVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIK 285
           I  CN  GI  + L SD D WV+D  +  + +F+    + DK++
Sbjct: 325 IGDCNWHGIIDYQLVSDCDEWVSDLKKR-IPEFFLSQQQVDKLR 367

>TPHA0K00200 Chr11 complement(33601..34545) [945 bp, 314 aa] {ON}
           YKL216W
          Length = 314

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 13/72 (18%)

Query: 43  EYYEEFLMLIHRQHPEWEVLGISHAGMST----ASVSKSEKSERNDVYSL---------K 89
           EYY ++ +   ++HP+ E L  S AGMS     + + K + SE N +  L         K
Sbjct: 80  EYYLDYALQRQKKHPDSEPLFFSIAGMSIDENLSMLEKLQNSEFNGITELNLSCPNVPGK 139

Query: 90  QQIDHKLEIIKD 101
            Q+ +  E+ K+
Sbjct: 140 PQLAYDFELTKE 151

>Ecym_2815 Chr2 (1579747..1584321) [4575 bp, 1524 aa] {ON} similar
           to Ashbya gossypii AEL276C
          Length = 1524

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 14  SIVHFKSISIRGKSECP--LFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGIS 65
           +++HF  +  RGKS+ P  LF  +  +P   +   + + ++++ H E+ +L ++
Sbjct: 170 NMIHFTPLQKRGKSDSPYSLFDQLQFDPTFFQDKNDVIQMVNKLHKEYGILTMT 223

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 17/71 (23%)

Query: 23  IRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSER 82
           IRG+       W+P  P  I  YE F          WE    +H  + T +  K     R
Sbjct: 253 IRGEE------WLPSTPKHIALYEAF---------GWEPPKFTHLPLLTTTEDKKLSKRR 297

Query: 83  ND--VYSLKQQ 91
           ND  V SLK+Q
Sbjct: 298 NDMSVMSLKEQ 308

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 62/150 (41%), Gaps = 20/150 (13%)

Query: 27  SECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVY 86
            E P++++  G  G +  +E  L L          LG  + G     +     SE  D Y
Sbjct: 76  GEGPIYLFFHGLGGNLTQFEPLLRL----------LGELNEGFVAMDLPGFGLSEEQDGY 125

Query: 87  SLKQ--QIDHK--LEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTP 142
            + Q  Q+ H   L+I     + ++ +I++GHS+G ++V H  +   L   +     L+P
Sbjct: 126 QMLQVTQVIHDAFLQI-----TDHKKIILVGHSMGCHLVLHFAILFGLEFDIKDSVFLSP 180

Query: 143 TILDIHTSKKGVVLTKVLYWLKDLPQLAGW 172
               +   +K V     L  L  LP L  W
Sbjct: 181 PAPTLPQLQK-VSTRLALSVLCRLPFLFDW 209

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 104 STNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGV--VLTKVLY 161
           + +R L+++GHS+G Y+  H   + +      ++ LL P  LD+   ++    VL  +L+
Sbjct: 193 TPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDLPQVERTSTRVLMSLLF 252

Query: 162 ---WLKDL 166
              W+ D+
Sbjct: 253 RWPWMFDI 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,823,840
Number of extensions: 1289893
Number of successful extensions: 3462
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3505
Number of HSP's successfully gapped: 48
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)