Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055503.487ON31031016680.0
Smik_6.2233.487ON3133166903e-89
SAKL0F02882g3.487ON2983086739e-87
NCAS0E008403.487ON3363176647e-85
YGR127W3.487ON3123156601e-84
Suva_7.4153.487ON3133166574e-84
Skud_7.4383.487ON3133166574e-84
KAFR0C019303.487ON3133186443e-82
NDAI0G009703.487ON3323356263e-79
CAGL0I10582g3.487ON3193186183e-78
KNAG0B008403.487ON3133165896e-74
Kpol_1017.93.487ON3103185741e-71
KLTH0F14718g3.487ON3003075617e-70
ZYRO0D10098g3.487ON2762765465e-68
Kwal_55.212173.487ON3033085356e-66
KLLA0E04687g3.487ON3063175331e-65
TPHA0D032603.487ON3143045262e-64
Ecym_12423.487ON3113165052e-61
AFR305W3.487ON3093144495e-53
TBLA0D029903.487ON3183154332e-50
CAGL0L05676g1.223ON2211146721.7
TDEL0B053701.464ON102638685.2
Kpol_505.52.177ON68760685.9
CAGL0J07788g1.110ON130565669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05550
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   647   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   270   3e-89
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   263   9e-87
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   260   7e-85
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   258   1e-84
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   257   4e-84
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   257   4e-84
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   252   3e-82
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   245   3e-79
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   242   3e-78
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   231   6e-74
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   225   1e-71
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   220   7e-70
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   214   5e-68
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   210   6e-66
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   209   1e-65
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   207   2e-64
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   199   2e-61
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   177   5e-53
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   171   2e-50
CAGL0L05676g Chr12 (621731..628366) [6636 bp, 2211 aa] {ON} high...    32   1.7  
TDEL0B05370 Chr2 (950954..954034) [3081 bp, 1026 aa] {ON} Anc_1....    31   5.2  
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    31   5.9  
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    30   9.8  

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60
           MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60

Query: 61  ANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQG 120
           ANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQG
Sbjct: 61  ANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQG 120

Query: 121 LEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKI 180
           LEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKI
Sbjct: 121 LEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKI 180

Query: 181 SLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVPP 240
           SLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVPP
Sbjct: 181 SLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVPP 240

Query: 241 LKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYKE 300
           LKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYKE
Sbjct: 241 LKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYKE 300

Query: 301 QKRYDFDLPR 310
           QKRYDFDLPR
Sbjct: 301 QKRYDFDLPR 310

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  270 bits (690), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 198/316 (62%), Gaps = 11/316 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDS-SGEDLGTWI 59
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  D+F+L P D    S  G++ GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           G N++GK+ T+LNLKL S+   R  +  +SRG +P  FLS+  ANFKDWD+Y KF + + 
Sbjct: 61  GINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174
           GL+ T DFNFFYGD     Y+VIDSLG T  VL  T  K    Y+V+SN  F   S+   
Sbjct: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177

Query: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE--LS 232
           + W+K+ LA  +L  LV +    DE+  I  CF +AS +         +     V+  ++
Sbjct: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237

Query: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292
           M T++VPPL+    D LGAS+P G++YGTRSQ V+L+SKD +  T++ERII+ SD D  Q
Sbjct: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297

Query: 293 YSRDHYKEQKRYDFDL 308
           YS    KE+KR++F+L
Sbjct: 298 YSVSAPKEEKRFEFEL 313

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  263 bits (673), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 193/308 (62%), Gaps = 10/308 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60
           MCIL+ T+ HP+Y L+L+SNRDE+F R+  P     D+F++ P D  + + G + GTW G
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60

Query: 61  ANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQG 120
            N+DGK+  +LNL++ S    +   CP+SRG +P+ FL+ +  +F +WD+Y+KF H + G
Sbjct: 61  VNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYPG 120

Query: 121 LEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKI 180
           +E T +FN FYGDCS G+Y++I SL  TT    + ++ Y+VVSND+   +    + W KI
Sbjct: 121 IEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-QNDDGYMVVSNDLISSK----KKWGKI 175

Query: 181 SLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVPP 240
           SLA   L +LV    D  +D  + +CF +AS +    K       +K   ++ +T++VPP
Sbjct: 176 SLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEK-----IVVKHESVTNETIYVPP 230

Query: 241 LKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYKE 300
           L       L  S+P G+YYGTRSQ VILVSKD+  +T+VER+++  D D L+Y   + KE
Sbjct: 231 LLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKE 290

Query: 301 QKRYDFDL 308
           Q  ++FD+
Sbjct: 291 QIEFEFDI 298

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  260 bits (664), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 189/317 (59%), Gaps = 15/317 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED---LGT 57
           MCIL+AT+ HP+Y+L+L+SNRDE+F RK   + W  D+F+L P D        +    GT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQ 117
           WIG NRD KI T+LNLKL S    +  V P+SRG IP  FLS   ++F  WDTY+KF  +
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 118 FQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF--------QG 169
           +  L  T DFNFFYGD    +YR+IDS GNT KVL  + + Y+ VSND+F        + 
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL--SGDPYLTVSNDMFATGGITVERA 194

Query: 170 ESNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAV 229
            +N+   W KI      L  LV E    DED  I++CF +AS      K +    + +  
Sbjct: 195 SNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKEN--TKFNQNS 252

Query: 230 ELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLD 289
            L M+T+FVPPL+   +D +G S+ +G+YYGTRSQ VIL+SK+   +  VE I++ SD D
Sbjct: 253 TLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312

Query: 290 ALQYSRDHYKEQKRYDF 306
              YS  + KE K ++F
Sbjct: 313 IQHYSSTNPKEVKSFEF 329

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  258 bits (660), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 197/315 (62%), Gaps = 10/315 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  ++F+L P D    S+ + + GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           G N++GK+ T+LNLKL ++     +    SRG +P  FLS   A+F+DWD Y KF   + 
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174
           GL+ T DFNFFYGD     Y+VIDSLG T  VL  T  K    Y+VVSN  F   S+   
Sbjct: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177

Query: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYY-MKAVELSM 233
           + W+K+ +A  +L +LV E  ++DE+K I  CF +AS +   S   + +   M    ++M
Sbjct: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237

Query: 234 QTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQY 293
            T++VPPL+    D LGAS+P G+YYGTRSQ V+LVSKD + +T++ER+++ SD D  +Y
Sbjct: 238 NTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297

Query: 294 SRDHYKEQKRYDFDL 308
           S    KE+KR+ F L
Sbjct: 298 SVTSPKEEKRFKFKL 312

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  257 bits (657), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 135/316 (42%), Positives = 195/316 (61%), Gaps = 11/316 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59
           MCIL+AT  HP Y+L+L+SNRDE+  RK     W  D+F+L P D    S  + + GTW 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           G N++GK+ T+LNLK+      R     +SRG +P +FL+S  A F+DWD Y+KF   + 
Sbjct: 61  GINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174
           GL  T DFNFFYGD     Y+VIDSLG+T  VLG T  +    Y+V+SN  +   S+   
Sbjct: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177

Query: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE--LS 232
           + W+K+ +A  +L  L+ +  ++DE+  I  CF +AS +         +     V+  ++
Sbjct: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237

Query: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292
           M T++VPPL+    D LGAS+P G+YYGTRSQ V+LVSKD S +T++ER+++ SD D   
Sbjct: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297

Query: 293 YSRDHYKEQKRYDFDL 308
           YS    KE+KR++F+L
Sbjct: 298 YSASAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  257 bits (657), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 192/316 (60%), Gaps = 11/316 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  D+F+L P D    S  + + GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           G NR+GK+ T+LNLKL      R  +  +SRG +P +FLS+  A+F++WD YDKF   + 
Sbjct: 61  GINREGKLATILNLKLDGQ---RDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSN-DIFQGESNKN 174
           GL  T DFNFFYGD     Y++IDSLG T  VL  T +     Y+ VSN + +   S   
Sbjct: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177

Query: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASIN--PFHSKHDHGNYYMKAVELS 232
           + W K+ +A   L  LV    D+DE+  I  CF +AS +  P  +   +    +    + 
Sbjct: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237

Query: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292
           M T++VPPL+   DD LGAS+P G+YYGTRSQ V+LVSK+ S +T++ERI++ SD D   
Sbjct: 238 MNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297

Query: 293 YSRDHYKEQKRYDFDL 308
           YS    KE+KR++F L
Sbjct: 298 YSVATPKEEKRFEFKL 313

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  252 bits (644), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 198/318 (62%), Gaps = 16/318 (5%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSS--GEDLGTW 58
           MCIL AT  H +Y+L+L+SNRDEY  RK     W  DNF+L P D   + +   +  GTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 59  IGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN---FKDWDTYDKFC 115
           +G N+ GKI T+LNL+ FS    +  V P SRG IP +FL S   N   F++W+T++KF 
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ--GESNK 173
            ++  L+ + DFNFFYGD   G+YR+IDSLGNT KVL   N + +++SND++Q   E   
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNN-RNMIISNDLYQHKDEYEG 179

Query: 174 NRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIAS---INPFHSKHDHGNYYMKAVE 230
              W KI +  + L+  ++E   ++ED+ + +CF +AS   I+   ++ ++ N      E
Sbjct: 180 KPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPN-----KE 234

Query: 231 LSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290
           L+ +T++VPPLK   D+ +G +   G+YYGTR+Q V+LV KDR H+T VE  IH+SD + 
Sbjct: 235 LAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEI 294

Query: 291 LQYSRDHYKEQKRYDFDL 308
            +YS  + KE +R DF +
Sbjct: 295 YKYSGLNPKEVQRLDFTI 312

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  245 bits (626), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 136/335 (40%), Positives = 186/335 (55%), Gaps = 28/335 (8%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED---LGT 57
           MCIL+AT+ HP Y+L+L+SNRDE+  RK   + W  D+F+L P D   +    D    GT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFCH 116
           W+G N+DGKI TVLNLKL      +  V P+SRG +P  +LS    + F +WD YD F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 117 QFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ-----GES 171
           ++ GL+ T DFN FYGD     YR++DS+GNT   L  +N +Y+VVSND+F      GE 
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLN-SNCQYLVVSNDVFTCNGQLGEL 179

Query: 172 NKN--------------RVWDKISLADQALHHLVRE--FNDTDEDKFIQECFGIASINPF 215
             N                W K+ L    L  LV +      DED  I ECF ++S    
Sbjct: 180 QSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSV 239

Query: 216 HSKHDHGNYYMKAVELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSH 275
            +  DH  ++  +  L  +T+ VPPL+    D +G S+PIGEYYGTRSQ VIL+ +    
Sbjct: 240 -TVEDHCKFHQNST-LPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYE 297

Query: 276 ITYVERIIHDSDLDALQYSRDHYKEQKRYDFDLPR 310
           + + E +I+ SD D   +S  + KE  R+DF L R
Sbjct: 298 VKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLNR 332

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  242 bits (618), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 124/318 (38%), Positives = 185/318 (58%), Gaps = 10/318 (3%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDK---GLDSSGEDLGT 57
           MCIL AT +HP Y+L+++SNRDE+  RK     W  D+F+L P D    G   S +  GT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQ 117
           W G NR G++ TVLNL++  +   +  +   SRG +P  FL+ R  NF+DWDTY KFC  
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 118 FQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF-------QGE 170
           +  ++ T DFN FYGD   G Y +IDSLGNT  +  K  + Y+V+SN+I        Q  
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 171 SNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE 230
           ++    W KI    Q +   V+   +  ++  I+ CF +AS N    K       +K++ 
Sbjct: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240

Query: 231 LSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290
           ++ +T++V PL T   + +G+ +  G+YYGTRSQ V+LV K ++  T++ERII+ SD D 
Sbjct: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300

Query: 291 LQYSRDHYKEQKRYDFDL 308
             YS  + KE+ RY++D+
Sbjct: 301 SLYSTSNPKEELRYEYDI 318

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  231 bits (589), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 183/316 (57%), Gaps = 13/316 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLD--KGLDSSGEDL-GT 57
           MCIL+ T +HP YDLVL+SNRDE+F R      W   +++L P D  KGL   G+ + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCP---ESRGKIPVSFLSSRGANFKDWDTYDKF 114
           W+G NR G++ TVLNLKL  +   + +  P    SRG IP  FLS RG     WD+++KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119

Query: 115 CHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKN 174
             ++  LE + DFN F GD    DY+V+DS GNT  VL +T    +VVSND ++ E N+N
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYK-EFNEN 178

Query: 175 RV--WDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232
            +  W+K+ L    LH LV    + D+  FI +CF  AS       H+      K  E+ 
Sbjct: 179 DISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHED---ISKTPEVI 235

Query: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292
             T+FVPPLK      +G +   G Y+GTRSQ V LVSKDR  +T  ERI+H SDLD   
Sbjct: 236 SNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDF 295

Query: 293 YSRDHYKEQKRYDFDL 308
            S  + KE K++ FDL
Sbjct: 296 NSPHNPKEVKQFTFDL 311

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  225 bits (574), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 188/318 (59%), Gaps = 18/318 (5%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLCPLD--KGLDSSGEDLG 56
           MCIL+A+ DHP YDL+L+SNRDE+  R+     W +  +  +LCP D  K  + +   +G
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 57  TWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFC 115
           TW G N  G++ T+LNLK     +       +SRG +P+ FL ++  +   +WD+Y+KF 
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120

Query: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESN--K 173
            ++  ++ T DFNFFYGD  IG Y VIDS+G+T +VL   N  Y+V+SND F G+SN   
Sbjct: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDN-PYLVISNDKF-GKSNGKS 178

Query: 174 NRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSM 233
            + W+KI+LA   L HL     +T ED  I +CF IAS N  +         +   EL  
Sbjct: 179 TKEWEKITLAKNLLKHL--PLCET-EDDLIHKCFDIASTNTLNEDLIKD---VDVRELMT 232

Query: 234 QTVFVPPLKTSC---DDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290
           +T+ VPPL        + +GAS+PIG+YYGTRSQ VILV+K+R+ + ++ERI+++SD D 
Sbjct: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292

Query: 291 LQYSRDHYKEQKRYDFDL 308
                    +   Y+F +
Sbjct: 293 TTQKLSSPIQDLTYNFTI 310

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  220 bits (561), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 181/307 (58%), Gaps = 13/307 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED-LGTWI 59
           MCIL+A+  HPKY L+ +SNRDE+F RK S      D+++L PLD  L S+ +  LGTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           G NR G++  +LNL+     +  P   P SRG +P+ +L  RG +  DW++++KF  ++ 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDK 179
            +    +FN FYGDC  G+Y  IDSLG +++ L   N+  +V+SND     S     W K
Sbjct: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALT-ANKPNLVLSNDHIDSSSR----WPK 173

Query: 180 ISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVP 239
           +  AD  L  LV+      E++ I++CF +AS N   ++ D+ +      E +  ++F+P
Sbjct: 174 VQKADILLQELVQSSQHDSEEELIEKCFALAS-NTEPAEIDNSD----KEEFTCSSIFIP 228

Query: 240 PLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYK 299
           P++      +GAS+P G +YGTRSQ VILV +    I++ ER++HDSD +   +S  H K
Sbjct: 229 PVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPK 288

Query: 300 EQKRYDF 306
           E+ +++ 
Sbjct: 289 EKLQFNL 295

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  214 bits (546), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 170/276 (61%), Gaps = 21/276 (7%)

Query: 43  PLDKGLDSSGEDLGTWIGANRDGKIGTVLNLKLFSDP-RGRPAVCPESRGKIPVSFLSSR 101
           PL    +      GTW G N+DG++GTVLNLKL     RG P +   SRGK+P +FLS  
Sbjct: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHP-LHLSSRGKVPTAFLSQH 69

Query: 102 GANFKDWDTYDKFCHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVL----GKTNE 157
             +++ W++Y+KF +QF  L+ T DFNFFYGDC  G Y++IDSL  T  VL     + + 
Sbjct: 70  DLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDS 129

Query: 158 KYIVVSNDI--FQGESNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINP- 214
            Y+VVSND+  +QGE      W K+ LA + L  L+ +  + D+D FI +CF +AS +P 
Sbjct: 130 SYMVVSNDVYRYQGE----ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPG 185

Query: 215 --FHSKHDHGNYYMKAVELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKD 272
             + S+       +K+ +++ Q++FVPPLK   D  LG +   G +YGTRSQ V+LVSKD
Sbjct: 186 LDWQSEE-----LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKD 239

Query: 273 RSHITYVERIIHDSDLDALQYSRDHYKEQKRYDFDL 308
           R  +T+VER++H+SD    Q S DH  EQ ++ FDL
Sbjct: 240 RQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  210 bits (535), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 181/308 (58%), Gaps = 14/308 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGE-DLGTWI 59
           MCIL+A+S HP+Y L+L+SNRDE+  R+        D++++ PLD  L  + E +LGTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119
           GANR+G+I  +LNL+  +  + +      SRG + + +L+ +     DW++Y KF  +  
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-VSRGNVTMRYLTDKQP-ASDWNSYAKFASKCP 118

Query: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDK 179
            ++ + +FN FYGDC  GDY  IDS G++ +VL   N  Y+V+SND  +  +     W K
Sbjct: 119 DIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNP-YLVISNDSIESATK----WPK 172

Query: 180 ISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVP 239
           I LA++ +  LVR+  +  ED  +  CF +AS      K D+   +M   +++   +FVP
Sbjct: 173 IELAEKLMRDLVRDSVNDSEDDLLARCFSLAS-----HKQDYNVDHMDKEKVTSSNIFVP 227

Query: 240 PLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYK 299
           PL+    + LGASVP G +YGTRSQ V+LVSK+   I +VE +++DSD +   +   + K
Sbjct: 228 PLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPK 287

Query: 300 EQKRYDFD 307
           +   Y  +
Sbjct: 288 KCVSYKIN 295

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  209 bits (533), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 176/317 (55%), Gaps = 22/317 (6%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60
           MCIL AT  HP Y L+L+SNRDE+F RK     W  D F+L P D  ++  G+  GTW+G
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60

Query: 61  ANRDGKIGTVLNLKLFSDPRGRPAVC----PESRGKIPVSFLSSR-GANFKDWDTYDKFC 115
            NR G+I  +LNLK+ S P    +V     P SRG +P+ FL     A F +WD+++KF 
Sbjct: 61  INRRGRIAVILNLKIDS-PLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ---GESN 172
            Q   L  T  F  FYGD    +Y VID L ++T    K   +++V+SNDIF    GE  
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM--EHMVISNDIFHCAVGEHT 177

Query: 173 KNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232
               W+K       L  L +      +++ +Q+CF + S + F+   D          ++
Sbjct: 178 SR--WNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGED-------VDSVT 228

Query: 233 MQTVFVPPLK-TSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDAL 291
             +++VPPL+ T   D +G S+PIG+YYGTRSQ VILV KD + +TY E +I++SD D  
Sbjct: 229 TSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESDEDCE 287

Query: 292 QYSRDHYKEQKRYDFDL 308
            YS    KE  ++ F++
Sbjct: 288 TYSFMDPKEVIQFQFNM 304

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  207 bits (526), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 176/304 (57%), Gaps = 23/304 (7%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLCPLDKGLDSSG-EDLGT 57
           MCIL  T  HP Y+L+L+SNRDE+  RK + + W E +   +LCP D   + +     GT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFCH 116
           W G N  G++ +VLNLK+  +      V  +SRG +PV FL +R  N F DW++Y KF  
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 117 QFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK---YIVVSNDIFQGESNK 173
           Q+  LE T  FN F GD    +Y +IDS G T ++L   +E     +V+SN  F   SN 
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFI--SND 178

Query: 174 NRVWDKIS----LADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAV 229
              W KIS    L D+ L   +R     DE+  I+ CF IAS +   +++ H   +   +
Sbjct: 179 KERWHKISNGEKLMDEFLSKDIR-----DENSVIESCFKIASTSELTNEYLHS--HDDIL 231

Query: 230 ELSMQTVFVPPLKTSC---DDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDS 286
           +L  +TVFVPP+K       D +GAS+P+G++YGTRSQ VILV+K+R+ + Y+ER++++ 
Sbjct: 232 DLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYEC 291

Query: 287 DLDA 290
           D D 
Sbjct: 292 DDDV 295

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  199 bits (505), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 172/316 (54%), Gaps = 14/316 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLD-----KGLDSSGEDL 55
           MCIL+AT+DHP Y L+L+SNRDE++ R+     W +D  +L P D        D+S  +L
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 56  --GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSS-RGANFKDWDTYD 112
             GTW+G NR G +  +LNLK  S+     A   +SRG + V+FL      N+  W+ Y+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 113 KFCHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESN 172
           KF   F  L+ T+ F  FYGD   GD+ +IDS   +      + + Y+V+SN     E  
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFS-SKQPYVVISNSRVNCEDE 179

Query: 173 KNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232
             R W K+   +Q L  LV+   +  ++  +Q+CF +A  + F     +G   +    L 
Sbjct: 180 GPR-WKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDV---NGVIQVTDTSLP 235

Query: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292
            +T+FVP LK + +  +G S  +GEYYGTR+  VILV  + +H+T  E +IHDSD D   
Sbjct: 236 EKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGL 294

Query: 293 YSRDHYKEQKRYDFDL 308
            S  + K +  Y+FD+
Sbjct: 295 SSAMNPKTKVAYEFDI 310

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  177 bits (449), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 159/314 (50%), Gaps = 14/314 (4%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSS-----GEDL 55
           MCIL AT+ HPKY LVL+SNRDEYFARK     W+ ++ +L P D  L  +     G   
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 56  GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSS-RGANFKDWDTYDKF 114
           GTWIG NR G +  +LNL               SRG + + +L      N+  W+TY+KF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 115 CHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKN 174
              F  L  T+ F  FYGD     + VI+SLG T     ++   Y VVSN    G     
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS--PYYVVSNGPSDGAKALG 178

Query: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQ 234
           + W K+   +Q    +++E  D  E++ +Q CF +AS + + S    G   +    +  +
Sbjct: 179 Q-WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIG---VHDDSIPKR 234

Query: 235 TVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYS 294
           T+FVP L          S   G YYGTRS  V+LVS+D + +T  E +IHDSD D   YS
Sbjct: 235 TIFVPALYNLSGQA-NLSFAAGMYYGTRSTIVMLVSEDGNVVTR-EHVIHDSDQDLDSYS 292

Query: 295 RDHYKEQKRYDFDL 308
             + KEQ  + F L
Sbjct: 293 ILNPKEQVTHRFSL 306

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  171 bits (433), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 167/315 (53%), Gaps = 30/315 (9%)

Query: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGL----DSSGEDL- 55
           MCIL+ T+ HP Y L+L+SNRDE F R+     W  ++ +L P D       D  G++  
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 56  ----GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCP---ESRGKIPVSFLSSRGANFKDW 108
               GTW G N+DGKI TVLNL    + R R   C    +SRG IP+ +L      F+DW
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEAR-RDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119

Query: 109 DTYDKFCHQFQGLEFTRD-FNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF 167
           +TYDKF  Q   ++     FN F GD    +Y +I+S+G + +VL + N  Y+VVSN I 
Sbjct: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEEN-PYMVVSN-IN 177

Query: 168 QGESNKNRVWDKISLADQALHHLVREFNDT---DEDKFIQECFGIASINPFHSKHDHGNY 224
            G+  K   W KI    + L  L+ +  D    DE + +++CF I+S      K   GN 
Sbjct: 178 WGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGN- 236

Query: 225 YMKAVELSMQTVFVPPLKTSCDD---------GLGASVPIGEYYGTRSQTVILVSKDRSH 275
            ++ +E +   +FVPPLK S  +         G  A     +YYGTRSQ V+L  +  + 
Sbjct: 237 -IERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNK 295

Query: 276 ITYVERIIHDSDLDA 290
           +T+VERI+H  + DA
Sbjct: 296 VTFVERILHCKNEDA 310

>CAGL0L05676g Chr12 (621731..628366) [6636 bp, 2211 aa] {ON} highly
            similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130c URA2
          Length = 2211

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 29/146 (19%)

Query: 107  DWDTYDKFCHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLG-----NTTKVLGKTNEKYIV 161
            D+D  D+    F+ +   R  + +  + S G   V+ S+G     N    L + N K + 
Sbjct: 1027 DYDEADRL--YFETINLERVLDIYEAEASNG---VVVSMGGQTSNNIAMSLHRENVKILG 1081

Query: 162  VSNDIFQGESNK---NRVWDKISLADQALHHLVREFNDTDEDKFIQECFGI--------- 209
             S D+     N+   +R+ D+I +   A     +E    DE +   E  G          
Sbjct: 1082 TSPDMIDSAENRYKFSRMLDQIGVDQPAW----KELTSMDEAEDFAEKVGYPVLVRPSYV 1137

Query: 210  ---ASINPFHSKHDHGNYYMKAVELS 232
               A++N  +SK+D  +Y  +AVE+S
Sbjct: 1138 LSGAAMNTVYSKNDLESYLNQAVEVS 1163

>TDEL0B05370 Chr2 (950954..954034) [3081 bp, 1026 aa] {ON} Anc_1.464
           YEL025C
          Length = 1026

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 173 KNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIA 210
           KNR+ D+   +DQ  + LV+ F D+  D F+Q  F + 
Sbjct: 734 KNRIIDRYEPSDQISNALVKPFCDSSSDLFLQRFFLVC 771

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 175 RVWDKISLADQALHHLVREFNDTDED-KFIQE--CFGIASINPFHSKHDHGNYYMKAVEL 231
           + W+ + +  +A++HL  +  D + D K +QE   FGIAS N F + +   N Y +A E+
Sbjct: 171 KSWNPVKMGSRAVNHLKLKIIDDEADLKVLQEKGSFGIAS-NHFITVNYSDNKYFQATEI 229

>CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]
           {ON} similar to uniprot|P12753 Saccharomyces cerevisiae
           YNL250w RAD50 DNA repair protein
          Length = 1305

 Score = 30.0 bits (66), Expect = 9.8,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 142 IDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKISLADQALHHLVREFNDTDEDK 201
           I+ L  + ++L K N + I   +   + +  + + ++++ L    LHH + ++N +DE +
Sbjct: 913 INDLSKSVEMLNKENSEKISTLDKDAKRKKGEFQSFNELVLQVNQLHHQLMQYNTSDE-Q 971

Query: 202 FIQEC 206
            +QEC
Sbjct: 972 HLQEC 976

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,107,183
Number of extensions: 1721924
Number of successful extensions: 4012
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4066
Number of HSP's successfully gapped: 35
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)