Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055403.486ON2162169781e-136
CAGL0I10604g3.486ON2112233787e-45
NCAS0E008503.486ON2302293683e-43
YGR126W3.486ON2302463492e-40
Skud_7.4373.486ON2302263441e-39
Smik_6.2223.486ON2302463381e-38
Suva_7.4143.486ON2302263328e-38
KNAG0B008503.486ON2252273311e-37
SAKL0F02904g3.486ON2221903162e-35
NDAI0G009803.486ON2342392963e-32
KLTH0F14696g3.486ON2191612804e-30
KAFR0C019203.486ON2232382771e-29
Kwal_55.212153.486ON1421482613e-28
KLLA0E04709g3.486ON1661501921e-17
Kpol_1017.103.486ON2342291767e-15
TPHA0D032503.486ON2192161661e-13
KLLA0E03829g3.503ON609641589e-12
KLTH0G02266g3.503ON644791518e-11
AFR322C3.503ON592691491e-10
SAKL0F02442g3.503ON610641411e-09
TPHA0D033103.503ON6131311393e-09
CAGL0I10384g3.503ON630761384e-09
Kwal_47.189193.503ON640641384e-09
TDEL0D057103.503ON616821375e-09
KNAG0B007303.503ON622641366e-09
Smik_16.4083.503ON6221271366e-09
KAFR0C020303.503ON624641331e-08
Skud_16.4503.503ON6221271331e-08
NDAI0I027703.503ON626761332e-08
NCAS0F036203.503ON634711332e-08
Suva_16.4843.503ON6221281322e-08
YPR156C (TPO3)3.503ON622641271e-07
Kpol_1017.33.503ON621641261e-07
Smik_6.2333.503ON614641251e-07
Skud_7.4483.503ON611711242e-07
YGR138C (TPO2)3.503ON614641223e-07
Suva_7.4253.503ON613641224e-07
TBLA0D029003.503ON6911211225e-07
NCAS0E007503.503ON620641191e-06
ZYRO0G19646g3.503ON594771145e-06
SAKL0B01606g8.46ON104560692.6
ZYRO0F05786g7.309ON71564649.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05540
         (216 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   381   e-136
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   150   7e-45
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   146   3e-43
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   139   2e-40
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   137   1e-39
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   134   1e-38
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   132   8e-38
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   132   1e-37
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   126   2e-35
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   118   3e-32
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   112   4e-30
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   111   1e-29
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   105   3e-28
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    79   1e-17
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    72   7e-15
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    69   1e-13
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    65   9e-12
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    63   8e-11
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    62   1e-10
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    59   1e-09
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    58   3e-09
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    58   4e-09
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    58   4e-09
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    57   5e-09
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    57   6e-09
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    57   6e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    56   1e-08
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    56   1e-08
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     56   2e-08
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    56   2e-08
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    55   2e-08
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    54   1e-07
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    53   1e-07
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    53   1e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    52   2e-07
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    52   3e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    52   4e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    52   5e-07
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               50   1e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    49   5e-06
SAKL0B01606g Chr2 complement(155482..158619) [3138 bp, 1045 aa] ...    31   2.6  
ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {...    29   9.0  

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  381 bits (978), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/216 (87%), Positives = 190/216 (87%)

Query: 1   MAPGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLN 60
           MAPGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPD         GTTLN
Sbjct: 1   MAPGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDSSSRRSSKSGTTLN 60

Query: 61  HQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRI 120
           HQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRI
Sbjct: 61  HQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRI 120

Query: 121 ETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTXXXXXXXXXX 180
           ETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDT          
Sbjct: 121 ETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQEAAQN 180

Query: 181 XXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                  IEKNKHRIEKFEKHRHEKGLKGFVHRLFD
Sbjct: 181 AENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  150 bits (378), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 121/223 (54%), Gaps = 26/223 (11%)

Query: 4   GTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQE----------KNPDXXXXXXX 53
           GTT+   D   + +++SSFSS+DSY+P+PFTG E    E          +          
Sbjct: 5   GTTS---DTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSK 61

Query: 54  XXGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQ 113
             G TL   DS  IEK VT NA+ G SET +SL+  GLD ++KAIPD N P+T    T+Q
Sbjct: 62  HSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTG-TNQ 120

Query: 114 FPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTXXX 173
           FPEEYR+ET TGLVK+KTL  L R  T+VS  SD            + SK +    +   
Sbjct: 121 FPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSD------------LSSKDKSISKSQSN 168

Query: 174 XXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                         +E+NK  I K++KH+ EKG+KGF HR+FD
Sbjct: 169 KSEVSDIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  146 bits (368), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 113/229 (49%), Gaps = 40/229 (17%)

Query: 16  FDEVSSFSSIDSYQPQPFTG-------------------QEELPQEKNPDXXXXXXXXXG 56
           F++VSSFSSIDSYQP+PFTG                   + EL QE             G
Sbjct: 14  FEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDG 73

Query: 57  -------TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNA 109
                  +TL   DSN IE+ +T NA  G +ET  SL   GLD  KKA  DIN P+T N 
Sbjct: 74  ITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNP 133

Query: 110 DTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGK--ISRKSSGPGTIDSKIEPK 167
               FPEEY +ET+TGLVK KT+  L R  +RVS    G   +S KS   G         
Sbjct: 134 ADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRRGDDVVSHKSQATG--------- 184

Query: 168 PDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                               +EKNK  +EK EKH+H+KGLKGF++RLFD
Sbjct: 185 ---KSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  139 bits (349), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 130/246 (52%), Gaps = 49/246 (19%)

Query: 2   APGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXG----- 56
            P  T   D   N+++++SSFSSIDSY+P+PFTG ++    + P          G     
Sbjct: 3   VPSVTVTTD---NEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDD 59

Query: 57  ------------------TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98
                             +TL    SN+IEK VTHNA+ G SET  SL++ GL+  KKA+
Sbjct: 60  SNVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKAL 119

Query: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIG--------SDGKI 150
           PDI  P+T +A  + FPEEYR+ET+TGLVKLKTL  L R D+RVS          +D   
Sbjct: 120 PDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHS 179

Query: 151 SRKSSGPGTIDSKIEPKPDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGF 210
           +R      +  S +EP                     +EKNK RIEK++KH+ EKG+KGF
Sbjct: 180 TRSKVTTNSQGSSLEP---------------NKLNMAVEKNKKRIEKYQKHKSEKGIKGF 224

Query: 211 VHRLFD 216
            HR+FD
Sbjct: 225 FHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  137 bits (344), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 122/226 (53%), Gaps = 30/226 (13%)

Query: 14  NQFDEVSSFSSIDSYQPQPFTG-------------------QEELPQEKNPDXXXX---- 50
           N+++++SSFSSIDSY+P+PFTG                   + +   E+N D        
Sbjct: 12  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV 71

Query: 51  XXXXXGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNAD 110
                 +TL    SN+IEK +THNA+ G SETA SL++ GL+  KKA+PDI  P+T +A 
Sbjct: 72  YSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAH 131

Query: 111 TSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDT 170
              FPEEYR+ET+TGLVKLKTL  L R D+RVS       +  +    T       +   
Sbjct: 132 NGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST-------RSKV 184

Query: 171 XXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                            +EKNK +IE++ KH+ EKG+KGF HR+FD
Sbjct: 185 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  134 bits (338), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 133/246 (54%), Gaps = 49/246 (19%)

Query: 2   APGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTG--QEELP--------------QEKNP 45
            P  T   D   N+++++SSFSSIDSY+P+PFTG    +LP              Q +N 
Sbjct: 3   VPSVTVTTD---NEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSEND 59

Query: 46  D-------XXXXXXXXXGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98
           D                 +TL    SN+IEK VT NA+ GTSET  SL++ GL+ +KKA+
Sbjct: 60  DILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKAL 119

Query: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIG--------SDGKI 150
           PDI  P+T +A  + FPEEYR+ET+TGLVKLKTL  L R D+RVS          +D   
Sbjct: 120 PDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHS 179

Query: 151 SRKSSGPGTIDSKIEPKPDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGF 210
           +R      +  S +EP                     +EKNK +IE+++KH+ EKG+KGF
Sbjct: 180 TRSKVTTNSQGSSLEP---------------NKLNMAVEKNKKKIEQYQKHKSEKGIKGF 224

Query: 211 VHRLFD 216
            HR+FD
Sbjct: 225 FHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  132 bits (332), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 90/226 (39%), Positives = 122/226 (53%), Gaps = 30/226 (13%)

Query: 14  NQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXG----------------- 56
           N+++++SSFSSIDSY+P+PFTG ++    + P          G                 
Sbjct: 12  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDDSVDDQHRHSDV 71

Query: 57  ------TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNAD 110
                 +TL    SN+IEK VTHNA+ G SET  SL++ GL+  KK  PDI  P+T +A 
Sbjct: 72  HSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAH 131

Query: 111 TSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDT 170
            + FPEEYR+ET+TGLVKLKTL  L R D+RVS       ++K  G    D+    +   
Sbjct: 132 DAAFPEEYRLETETGLVKLKTLETLKREDSRVS------GAKKDHGHDHTDAH-STRSKA 184

Query: 171 XXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                            +EKNK RIEK++KH+ EKG+KG  HR+FD
Sbjct: 185 TAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 122/227 (53%), Gaps = 40/227 (17%)

Query: 15  QFDEVSSFSSIDSYQPQPFTG--------------------QEELPQEKNPDXXXXXXXX 54
           +FDEVSSFSS+DSY+P+PF G                     E+L +             
Sbjct: 12  EFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKA 71

Query: 55  XGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKA-IPDINGPITGNADTSQ 113
             TTL  +DSN IE+ VT NAMN  SE+A +L+  GLDT K+  IPDIN P+T     S 
Sbjct: 72  SSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT--LTQSH 129

Query: 114 FPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGT-----IDSKIEPKP 168
           FPEEY++ET+TGLVK+KT+  L    +R S G+    S+KS G  T     + S +E   
Sbjct: 130 FPEEYQVETETGLVKMKTIESLK---SRHSGGTHN--SKKSKGASTRSKNSLTSSMEEHG 184

Query: 169 DTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLF 215
           +                  +E+N+  +E++EK+R +KG+KGF+ ++F
Sbjct: 185 EA-------GLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  126 bits (316), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 107/190 (56%), Gaps = 17/190 (8%)

Query: 26  DSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVTHNAMNGTSETAKS 85
           D   P+P +G         P+           TL   DSN IEK +THNA+ G +ET +S
Sbjct: 49  DEIDPEPLSGNP-----VRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLES 103

Query: 86  LQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIG 145
           L+  GLD  KKAIPD N P   + D SQFPEEY+IET+TGLVK+KTL  L+R DTRVS+G
Sbjct: 104 LKTRGLDLRKKAIPDYNNPAM-HTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLG 162

Query: 146 SDGKISRKSSGPGTIDSKIEPKPDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEK 205
           +    ++        D   E +P                   ++KNK +IEK++KH+HEK
Sbjct: 163 NKPSTNQNMEAESAHD---EQRP--------VGYDEEKLKKAVDKNKKKIEKYQKHKHEK 211

Query: 206 GLKGFVHRLF 215
           G+KGF+ RLF
Sbjct: 212 GIKGFMSRLF 221

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  118 bits (296), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 127/239 (53%), Gaps = 35/239 (14%)

Query: 4   GTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQE--ELPQ----------EKNPDXXXXX 51
           G     D+  N+FD++SSFSSIDSYQP+PFTG +  ELP           E++ D     
Sbjct: 5   GNIISADNTDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQPSTTATTTEQDHDDTVIS 64

Query: 52  XXXXGT------------TLNHQDSNT--IEKEVTHNAMNGTSETAKSLQQAGLDTEKKA 97
                T            TL   DSN   IEK +T N MN  +ET  SL + GL+T KK+
Sbjct: 65  SHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKS 124

Query: 98  IPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGP 157
           + DIN P+  NA T++FPEEYRIET+TGLVK KT+  L R ++  S       SR+S   
Sbjct: 125 VADINTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASAN-----SRRSQDQ 177

Query: 158 GTIDSKIEPKPDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
           G+  S      +T                 +EKNK  +EK+ KH+ +KG+KGF +RLFD
Sbjct: 178 GSFKSA--RTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  112 bits (280), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 97/161 (60%), Gaps = 9/161 (5%)

Query: 58  TLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEE 117
           TL  QDSN IE+ +THNA  G SET +SL++ GL+ +KKAIPDIN P   N     FPEE
Sbjct: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNP-AANYKNCAFPEE 124

Query: 118 YRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKS--SGPGTIDSKIEPKPDTXXXXX 175
           Y++ET TGLVK +TL+ L+R ++R S G  G   +KS  +   T +S +    +T     
Sbjct: 125 YQMETDTGLVKAQTLHGLNRLESRTS-GRSGASQKKSIRTANSTTNSDLASANNT----- 178

Query: 176 XXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
                       +EKN+ +I+K++KH+   GL+ F+ ++FD
Sbjct: 179 INGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 115/238 (48%), Gaps = 60/238 (25%)

Query: 17  DEVSSFSSIDSYQPQPFTGQ----------------------------EE----LPQEKN 44
           +++SSFSSI+SY+P+PF GQ                            EE    L Q + 
Sbjct: 8   EDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQT 67

Query: 45  PDXXXXXXXXXGTT------LNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98
            D          T+      L  Q S  IE+ VT NAM G +ET  SL+  GLD  K+A+
Sbjct: 68  NDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAV 127

Query: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPG 158
           PDIN PI+     S+  +E + ET TGL+K KTL  L+RS+TR S      +   +S   
Sbjct: 128 PDINSPISHE---SKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKILGNDNSNTS 184

Query: 159 TIDSKIEPKPDTXXXXXXXXXXXXXXXXXIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
            +D      P+                  +E+N+ ++EK+++H+ EKGLKGF +++FD
Sbjct: 185 GLD------PE-------------RMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  105 bits (261), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (58%), Gaps = 8/148 (5%)

Query: 71  VTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLK 130
           +THNA  G SET  SLQ+ GL+  +KA+PD N P   N    +FPEEY++ET TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNP-AANFTNCEFPEEYQLETDTGLVKVQ 59

Query: 131 TLNDLSRSDTRVSIGSDGKISRKS--SGPGTIDSKIEPKPDTXXXXXXXXXXXXXXXXXI 188
           TL  L+R ++R SI S G   RKS  S P T D  I P   +                 +
Sbjct: 60  TLQKLNRLESRTSIRS-GNSQRKSMRSTPST-DHSISP---SAGRSSNSGLDAEKLRKAV 114

Query: 189 EKNKHRIEKFEKHRHEKGLKGFVHRLFD 216
           EKNK +I+K++KH+   GLK F+ ++FD
Sbjct: 115 EKNKRQIDKYQKHKASGGLKKFLGKIFD 142

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 27/150 (18%)

Query: 67  IEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGL 126
           +E  V  N   G +++  SL+   LD  KKAIP  N PI   A+ ++FPEEY IET+TGL
Sbjct: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYEIETRTGL 98

Query: 127 VKLKTLNDLSRSDTRVSIGSDGKISR-KSSGPGTIDSKIEPKPDTXXXXXXXXXXXXXXX 185
           VK+ TL+ L+R DTRV+  S  K ++ K++  G  + K++                    
Sbjct: 99  VKVATLHQLNRLDTRVTTHSSKKSTKEKNTSCGYDNDKLQ-------------------- 138

Query: 186 XXIEKNKHRIEKFEKHRHEKGLKGFVHRLF 215
             IE+N+  I+ + K   + G K F+ +LF
Sbjct: 139 KCIERNQKEIDSYHK---KSGFKKFIGKLF 165

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 72.4 bits (176), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 103/229 (44%), Gaps = 34/229 (14%)

Query: 11  DASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGT----TLNHQDSNT 66
           D+SN F+++SSF S +S+ PQ F G   L    + D         GT    TL    SN 
Sbjct: 14  DSSN-FEDISSFDSQNSFAPQEFKGN--LDSNNDNDTGVFNKTKSGTSETNTLKVNSSNE 70

Query: 67  IEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGL 126
           IEK VT NA+   +ET  +L++   +++   +P  N       + + FPEEYRIET+TGL
Sbjct: 71  IEKIVTRNALENNTETVATLRET--ESKLSKVPTENVLPATMENNAAFPEEYRIETKTGL 128

Query: 127 VKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTI-----------------DSKIEPKPD 169
           V +KTL ++       S  S+GK                            D  +E K  
Sbjct: 129 VPIKTLEEMH------SNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEK 182

Query: 170 TXXXXXXXXXXXXXXXXXI-EKNKHRIEKFEKHRHEKG-LKGFVHRLFD 216
                             + E+NK ++EK+E+H+HE   +K F+++  D
Sbjct: 183 HPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 101/216 (46%), Gaps = 23/216 (10%)

Query: 13  SNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXX--------XXXGTTLNHQ-- 62
           S  FD+VSSF+S +SY PQ F G + L +E +                   GT+ N+   
Sbjct: 13  SENFDDVSSFNSDNSYTPQEFIG-DTLGKESSTKMDDRASHLSHAIKETRSGTSDNNTIK 71

Query: 63  --DSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRI 120
              SN + + V+ N M+   E+ ++L+    + E +   DI  P +   + S FPEEY +
Sbjct: 72  PVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGN-SNFPEEYTM 129

Query: 121 ETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTXXXXXXXXXX 180
           ET TGLV +KTL D+ +  T      D + SRKS     +  K     +T          
Sbjct: 130 ETTTGLVPVKTLEDIKKKKT-----IDSENSRKSLVSSEL--KASKSNNTVKSRNEGGLN 182

Query: 181 XXXXXXXIEKNKHRIEKFEKHRHEKG-LKGFVHRLF 215
                  +EKNK  +EK++ H+ EK  +K  + +LF
Sbjct: 183 PAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 65.5 bits (158), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ETAKSLQ  GL +E   IPD N P T  A  + FPEEY +ET TGLV + TL+ L R+ 
Sbjct: 48  TETAKSLQDMGLTSEVP-IPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 140 TRVS 143
           T +S
Sbjct: 107 TAIS 110

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 6/79 (7%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSR-- 137
           +ET KSLQ  G+ T +  +PD+N P TG    + FPEEY +ET TGLV + TL  L R  
Sbjct: 57  TETVKSLQDMGV-TPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 138 ---SDTRVSIGSDGKISRK 153
              S TR  +  +G  +R+
Sbjct: 116 SAVSRTRTRVMREGAAARR 134

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ+ GL +EK  IPD+N P T       FPEEY +ET TGLVK+ TL  L R+ 
Sbjct: 45  TETVKSLQEMGLSSEKP-IPDVNAPSTSAGVI--FPEEYTLETPTGLVKIATLVSLGRTG 101

Query: 140 TRVSIGSDG 148
           + V  G  G
Sbjct: 102 SAVPRGGSG 110

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ETAKSLQ+ G+ +E   IPDIN P   N  +  FPEEY +ET TGLV + TL+ + R+ 
Sbjct: 44  TETAKSLQEMGVSSEAP-IPDINAP--QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTT 100

Query: 140 TRVS 143
           + VS
Sbjct: 101 SAVS 104

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 63/131 (48%), Gaps = 27/131 (20%)

Query: 13  SNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVT 72
           SN+++++ SF   DS +     G EE PQ+  P          G  LN   +        
Sbjct: 2   SNEYEDIESF---DSTESSTGVGNEEQPQQYVPSGDNG-----GAALNLSRT-------- 45

Query: 73  HNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTL 132
                   ET KSLQ  GL T    IPD+N P T N   S FPEEY +ET TGLV + TL
Sbjct: 46  --------ETVKSLQDMGL-TSDAPIPDVNAP-TSNKH-SIFPEEYTMETPTGLVPVATL 94

Query: 133 NDLSRSDTRVS 143
           + L R+ T ++
Sbjct: 95  HSLGRNSTTIT 105

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 46/76 (60%), Gaps = 2/76 (2%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ+ G+ T+   IPD+N P T   + + FPEEY +ET TGLV + TL  L R+ 
Sbjct: 51  TETVKSLQEMGM-TQDAPIPDVNAPQTTTKN-AIFPEEYTMETPTGLVPVATLQSLGRTS 108

Query: 140 TRVSIGSDGKISRKSS 155
           T +S     +I R  S
Sbjct: 109 TAISKSRTRQIERSVS 124

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ+ G+ T +  +PD+N P    +  + FPEEY +ET TGLV + TL  L R+ 
Sbjct: 51  TETVKSLQEMGV-TPEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 140 TRVS 143
           + V+
Sbjct: 110 SGVT 113

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ+ G+ T    +PD+N P T  A    FPEEY +ET TGLV + TL  + R+ 
Sbjct: 45  TETVKSLQEMGM-TATAPVPDVNAPQT-TARPQIFPEEYTMETPTGLVPVATLQSIGRTS 102

Query: 140 TRVSIGSDGKISRKSSGPGTID 161
           T +S     ++ R SS   ++D
Sbjct: 103 TAISRSRTRQMERTSSESSSMD 124

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ T+   IPD+N P T    T+ FPEEY +ET TGLV + TL  + R+ 
Sbjct: 51  TETVKSLQDMGM-TKNAPIPDVNAPQTAK-KTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 140 TRVS 143
           T +S
Sbjct: 109 TSIS 112

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 61/127 (48%), Gaps = 29/127 (22%)

Query: 17  DEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVTHNAM 76
           DE SS S ++S QPQ     + +P E                 N   SN    ++     
Sbjct: 13  DETSSLSDVESQQPQ-----QYIPSE-----------------NGSKSNMAPNQLKLT-- 48

Query: 77  NGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLS 136
              +ET KSLQ  G+ + K  +PD+N P +G      FPEEY +ET TGLV + TL+ + 
Sbjct: 49  --RTETVKSLQDMGVSS-KAPVPDVNAPQSGKNKI--FPEEYTLETPTGLVPVATLHSIG 103

Query: 137 RSDTRVS 143
           R+ T +S
Sbjct: 104 RTSTAIS 110

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G++    A+PD+N P +     + FPEEY IET TGLV + TL  L R+ 
Sbjct: 52  TETVKSLQDMGMNA-TPAVPDVNAPQSNR--NAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 140 TRVS 143
           T +S
Sbjct: 109 TAIS 112

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 61/127 (48%), Gaps = 29/127 (22%)

Query: 17  DEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVTHNAM 76
           DE SS S ++S QPQ     + +P E                 N   SN    ++     
Sbjct: 13  DETSSLSDVESQQPQ-----QYIPSE-----------------NGSKSNMAPNQLKLT-- 48

Query: 77  NGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLS 136
              +ET KSLQ  G+ + K  IPD+N P   ++    FPEEY +ET TGLV + TL+ + 
Sbjct: 49  --RTETVKSLQDMGVSS-KAPIPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIG 103

Query: 137 RSDTRVS 143
           R+ T +S
Sbjct: 104 RTSTAIS 110

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET K+LQ  G+ T    +PD+N P T +A  + FPEEY +ET TGLV + TL  L R+ 
Sbjct: 52  TETVKTLQDLGV-TRDAPVPDVNAPQT-SARNTIFPEEYTMETTTGLVPVSTLQSLGRTA 109

Query: 140 TRVSIGSDGKISRKSS 155
           T ++     +I R+S+
Sbjct: 110 TSITRTRTRQIERRST 125

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 74  NAMNGT-SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTL 132
           N +N T +ETAK+LQ  G+ +E   +PDIN P  G+   + FPEEY +ET TGLV + TL
Sbjct: 43  NQLNLTRTETAKTLQDMGMTSEAP-LPDINAP-QGSKKPAIFPEEYTMETPTGLVPVVTL 100

Query: 133 NDLSRSDTRVS 143
             + R+ + +S
Sbjct: 101 QSIGRNSSAIS 111

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 65/128 (50%), Gaps = 31/128 (24%)

Query: 17  DEVSSFSSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVTHNAM 76
           DE SS S+++S QPQ     + +P E+                    SN     ++ N +
Sbjct: 13  DETSSLSNVESQQPQ-----QYIPSERG-----------------SKSN-----MSPNQL 45

Query: 77  NGT-SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDL 135
             T +ET KSLQ  G+ + +  +PD+N P   ++    FPEEY IET TGLV + TL+ +
Sbjct: 46  KLTRTETVKSLQDMGVSS-RAPVPDVNAP--QSSKNKIFPEEYTIETPTGLVPVATLHSI 102

Query: 136 SRSDTRVS 143
            R+ T +S
Sbjct: 103 GRTSTAIS 110

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ + K  +PD+N P   ++    FPEEY +ET TGLV + TL+ + R+ 
Sbjct: 50  TETVKSLQDMGVSS-KAPVPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 140 TRVS 143
           T +S
Sbjct: 107 TAIS 110

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ +E   IP +N P T       FPEEY +ET TGLV + TL  L RS 
Sbjct: 48  TETVKSLQDMGMTSEAP-IPGVNAPQTSRVQI--FPEEYTMETPTGLVPVATLQSLGRSS 104

Query: 140 TRVS 143
             V+
Sbjct: 105 LAVT 108

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ T    +PDIN P T  A  + FPEEY +ET +GLV + TL  + R+ 
Sbjct: 45  TETVKSLQDLGV-TSNAPVPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 140 TRVS 143
           T +S
Sbjct: 102 TALS 105

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 74  NAMNGT-SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTL 132
           N +N T +ET KSLQ  G+ T    +PDIN P T  A  + FPEEY +ET +GLV + TL
Sbjct: 38  NQLNLTKTETVKSLQDLGV-TSAAPVPDINAPKT--AKNNIFPEEYTMETPSGLVPVATL 94

Query: 133 NDLSRSDTRVS 143
             + R+ + +S
Sbjct: 95  QSMGRTASALS 105

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ T    +PDIN P T  A  + FPEEY +ET +GLV + TL  + R+ 
Sbjct: 45  TETVKSLQDLGV-TSAAPVPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 140 TRVS 143
           + +S
Sbjct: 102 SALS 105

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET KSLQ  G+ T    +PDIN P T  A  + FPEEY +ET +GLV + TL  + R+ 
Sbjct: 45  TETVKSLQDLGV-TSAAPVPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 140 TRVS 143
           + +S
Sbjct: 102 SALS 105

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 23  SSIDSYQPQPFTGQEELPQEKNPDXXXXXXXXXGTTLNHQDSNTIEKEVTHNAMNGTSET 82
           + ++  QPQ +  Q    Q ++ D          TT  ++ SN    +         +ET
Sbjct: 18  TGLEDTQPQQYIYQSVSRQSRD-DLQSSINSYLTTTPTNRSSNASTNQRLKLV---KTET 73

Query: 83  AKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRV 142
            KSL   G+ +     P IN P T  +  + FPEEY +ET+TGLV + TL+ L R++T +
Sbjct: 74  VKSLIDMGVSSYIPN-PAINAPKT--SKKAIFPEEYTLETETGLVPVSTLHSLGRTNTNL 130

Query: 143 S 143
           S
Sbjct: 131 S 131

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 80  SETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSD 139
           +ET K+LQ  G+ T    +PDIN P   +   + FPEEY +ET TGLV + TL  + R+ 
Sbjct: 46  TETVKTLQDLGV-TSHVPVPDINAP-QSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 140 TRVS 143
           + +S
Sbjct: 104 SAIS 107

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 67  IEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGL 126
           +E++VT  A++   ETA++LQ  G+      +PD+  P    A    FPEEY +ET +G+
Sbjct: 28  LEQDVTSRALS-RHETAETLQTMGM-ARGTPLPDVVAPTYAAAPV--FPEEYTMETPSGI 83

Query: 127 VKLKTLNDLSRSDTRVS 143
           V L  L  L R+ T VS
Sbjct: 84  VPLAQLESLGRTVTTVS 100

>SAKL0B01606g Chr2 complement(155482..158619) [3138 bp, 1045 aa]
           {ON} similar to uniprot|P43571 Saccharomyces cerevisiae
           YFL025C BST1 GPI inositol deacylase of the ER that
           negatively regulates COPII vesicle formation prevents
           production of vesicles with defective subunits required
           for proper discrimination between resident ER proteins
           and Golgi-bound cargo molecules
          Length = 1045

 Score = 31.2 bits (69), Expect = 2.6,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 78  GTSETAKSLQQAGLDTEKKAIPDINGPITGNAD--TSQFPEEYR-IETQTGLVKLKTLND 134
           G+ + A+S+  A  +   +++ DIN P+T N D  T+ F E++     +T L + + LND
Sbjct: 160 GSFKQARSIAAASANLYFESVNDINNPLTSNLDFFTADFNEDFTAFHGRTMLDQAEYLND 219

>ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {ON}
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194W SNF3 glucose sensor
          Length = 715

 Score = 29.3 bits (64), Expect = 9.0,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 1/64 (1%)

Query: 57  TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQA-GLDTEKKAIPDINGPITGNADTSQFP 115
           T +N +   T+  E  H   N  S+    L    GL+T K+  P I    +   DT   P
Sbjct: 623 TIMNTKQEATVTNESPHTEFNDLSQNYVDLGNGLGLNTYKRGPPSIPSDSSDEEDTEGGP 682

Query: 116 EEYR 119
             +R
Sbjct: 683 SSHR 686

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.127    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,270,858
Number of extensions: 824309
Number of successful extensions: 2023
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1978
Number of HSP's successfully gapped: 62
Length of query: 216
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 111
Effective length of database: 41,441,469
Effective search space: 4600003059
Effective search space used: 4600003059
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 63 (28.9 bits)