Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055303.485ON1031103151400.0
Suva_7.4133.485ON1037104631130.0
Skud_7.4363.485ON1036104530860.0
YGR125W3.485ON1036104030770.0
NCAS0E009503.485ON1052105730730.0
Smik_6.2213.485ON1036104630720.0
ZYRO0C07986g3.485ON1024105230320.0
NDAI0G009903.485ON1054106030300.0
CAGL0I10626g3.485ON1070101329240.0
KNAG0B008603.485ON1088108528610.0
Kpol_480.183.485ON1057105128360.0
KAFR0C019103.485ON1020104328090.0
SAKL0F02926g3.485ON105082527060.0
TPHA0D042103.485ON1049105426840.0
KLTH0F14674g3.485ON1010103726490.0
TBLA0C044403.485ON115086226080.0
Kwal_55.212013.485ON1011103725960.0
KLLA0E04731g3.485ON1060106624480.0
AFR304W3.485ON1015104424000.0
TDEL0C012808.99ON7272871496e-09
Skud_16.2868.99ON7452911452e-08
SAKL0B03124g8.99ON7445981452e-08
NCAS0B048008.99ON7242791415e-08
Kpol_467.118.99ON7442831406e-08
Smik_16.2418.99ON7442871399e-08
Suva_16.3228.99ON7423471372e-07
KLTH0G16764g8.99ON7104151334e-07
ZYRO0F04796g8.99ON7351241335e-07
Kwal_27.110398.99ON7263301292e-06
KNAG0D023908.99ON7163911221e-05
AGR213Cna 1ON6892031182e-05
KLLA0E14059g8.99ON7062691174e-05
YPR003C8.99ON7542871165e-05
CAGL0L09207g8.99ON7252881147e-05
TBLA0C052708.99ON7761061149e-05
SAKL0H08800gna 1ON6201361058e-04
Ecym_7084na 1ON6892041050.001
TPHA0H007208.99ON7871261050.001
NDAI0B022108.99ON706253970.008
TPHA0B015207.441ON115091735.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05530
         (1031 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1984   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1203   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1193   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1189   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1188   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1187   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1172   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1171   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1130   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1106   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1097   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1086   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1046   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1038   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1025   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1009   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1004   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   947   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   929   0.0  
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    62   6e-09
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    60   2e-08
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    60   2e-08
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    59   5e-08
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    59   6e-08
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    58   9e-08
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    57   2e-07
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    56   4e-07
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    56   5e-07
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    54   2e-06
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    52   1e-05
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    50   2e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    50   4e-05
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    49   5e-05
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    49   7e-05
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    49   9e-05
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    45   8e-04
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    45   0.001
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    45   0.001
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    42   0.008
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    33   5.8  

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1984 bits (5140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 973/1031 (94%), Positives = 973/1031 (94%)

Query: 1    MPSXXXXXXXXXXXXHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNY 60
            MPS            HSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNY
Sbjct: 1    MPSTGNTGGPRNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNY 60

Query: 61   LGRSYVSGFLSCSPYGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDN 120
            LGRSYVSGFLSCSPYGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDN
Sbjct: 61   LGRSYVSGFLSCSPYGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDN 120

Query: 121  NIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGAHGGY 180
            NIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGAHGGY
Sbjct: 121  NIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGAHGGY 180

Query: 181  RAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMIIFPITE 240
            RAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATI              MIIFPITE
Sbjct: 181  RAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITE 240

Query: 241  PIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG 300
            PIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG
Sbjct: 241  PIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG 300

Query: 301  RDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGL 360
            RDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGL
Sbjct: 301  RDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGL 360

Query: 361  EVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATL 420
            EVTTRVAKLEYTWPFISHMFTDVS                  QRHFQNSLVLPTFYIATL
Sbjct: 361  EVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATL 420

Query: 421  VAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLA 480
            VAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLA
Sbjct: 421  VAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLA 480

Query: 481  LSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFI 540
            LSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFI
Sbjct: 481  LSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFI 540

Query: 541  RAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVT 600
            RAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVT
Sbjct: 541  RAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVT 600

Query: 601  NFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRD 660
            NFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRD
Sbjct: 601  NFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRD 660

Query: 661  YVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLK 720
            YVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLK
Sbjct: 661  YVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLK 720

Query: 721  NINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLN 780
            NINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLN
Sbjct: 721  NINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLN 780

Query: 781  GALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQNLMSLPF 840
            GALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQNLMSLPF
Sbjct: 781  GALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQNLMSLPF 840

Query: 841  NTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSEDTNVKN 900
            NTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKE              YRPGILSEDTNVKN
Sbjct: 841  NTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALKPYRPGILSEDTNVKN 900

Query: 901  SELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCY 960
            SELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCY
Sbjct: 901  SELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCY 960

Query: 961  GIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRY 1020
            GIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRY
Sbjct: 961  GIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRY 1020

Query: 1021 RQILGYTLVSA 1031
            RQILGYTLVSA
Sbjct: 1021 RQILGYTLVSA 1031

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/1046 (58%), Positives = 768/1046 (73%), Gaps = 58/1046 (5%)

Query: 20   EAISVSLGLQNTNTPRDH-HDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLS--CSPYG 76
            EAI+VSLG+   ++ ++  H  + S          MSP    L RSY+SGF +   SP  
Sbjct: 16   EAITVSLGINYQDSSKNKIHRASAST---------MSPP---LCRSYMSGFFTGGSSPMN 63

Query: 77   SNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDY---VSATE 130
             N +   +LP + +   K IH ++NLHRQTA+L  +F   +VE+N+  I+DY   + + +
Sbjct: 64   YN-MSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDD 122

Query: 131  EPRPMEISDAERMYDQE--DE----LRNPVHVNTEDRGD---------DIEDVYESLVTG 175
                  +   E   D+E  DE    L +P   N +D  +         D+ED       G
Sbjct: 123  RKDDQSMRTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLED-------G 175

Query: 176  AHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMII 235
              GGY+++   P   LR   RS +W+ F S  SK   YLPA +              MII
Sbjct: 176  HGGGYQSV--HPSHDLRFGPRS-VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMII 232

Query: 236  FPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIK 295
            FPITEP+FSHLGP+G+SMFY+STIISQ +YS G+S+FP+GVGSEMIE+TPF+H+MAL IK
Sbjct: 233  FPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIK 292

Query: 296  DALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFL 355
            +AL G DDEI+TTTIFCYVISS++TG+ FYVLGK++LGKIVGFFPRHILIGCIGGVGYFL
Sbjct: 293  EALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 352

Query: 356  VVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTF 415
            ++TG+EVTTRVAK EY+WPF+S +FT+                    QR F+NSLVLPTF
Sbjct: 353  IITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTF 412

Query: 416  YIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQA 475
            YI TLV FHF+VAIIP +SL  LR+ GWIFP+A+S  +WYDHYKLF  H+VHW L+ +Q 
Sbjct: 413  YILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQI 472

Query: 476  PTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTN 535
            PTM+AL+FFGILHVPINVPALA+SLQMDKYDVDKELIAHGYSN  SG LGS+QNYLVYTN
Sbjct: 473  PTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTN 532

Query: 536  SLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIET 595
            S+LFIRAGADS+ AG+LL  LT  +MVIGPVIIS+IPICIVGSLIFLLGYELL EAL++T
Sbjct: 533  SVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDT 592

Query: 596  RGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKS 655
              K+  FEY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVDSTKLQT+NGEY+G +AKS
Sbjct: 593  WSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKS 652

Query: 656  TVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCL 715
            TVYRDYVQ++FLDGIGEQIYVLKLQ++LFFGTIISIEEKI +LLEIS ++ ++KRRIK L
Sbjct: 653  TVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEIS-NKDSTKRRIKYL 711

Query: 716  ILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVEL 775
            ILD KNINADNIDYSAAEGFNRIKRFT++K I+LIISSI E DHIY AF+ V LL+DVEL
Sbjct: 712  ILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVEL 771

Query: 776  FGDLNGALEWCENELLFKYKELRAKARDRLQNKMQ---MANLAANNDTKAID--GVP--- 827
            F DLNGALEWCENE LF+YK+LR KA+ RL+ + Q   ++ + A    K ID  G+    
Sbjct: 772  FADLNGALEWCENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNK 831

Query: 828  --KSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXX 885
                   ++LMSLP NTPRN QMLSVAQ VF N+++ V +LK  YKE             
Sbjct: 832  GGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALK 891

Query: 886  XYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDL 945
             YRP I+SE   V+  E++ W++LCPYF+RRRLASQS+LLH  ++FF++ETG+LK VY+L
Sbjct: 892  QYRPDIVSEVQKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYEL 951

Query: 946  PQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLY 1005
            PQG +YE +SN TC+G ++ PG     E K+TI+TET+ +LWVIDSS L ++K+ENL+LY
Sbjct: 952  PQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALY 1011

Query: 1006 TELILLIATVKEQRYRQILGYTLVSA 1031
             E+ L+I  +K+ R++++LGYTLVSA
Sbjct: 1012 VEVTLMIMCIKDTRFKELLGYTLVSA 1037

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1045 (57%), Positives = 752/1045 (71%), Gaps = 57/1045 (5%)

Query: 20   EAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLS--CSPYGS 77
            EAISVSLG+   ++    H  + S          MSP    L RSY+SGF +   SP   
Sbjct: 16   EAISVSLGINQDSSKNKMHRASVSA---------MSPP---LCRSYMSGFFTGGSSPMVK 63

Query: 78   NSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDYVSATEEPRP 134
            N +   +LP + +     IH ++NLHRQTA+L  +F   +VE+N+  I+DY+   +    
Sbjct: 64   N-MSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDR 122

Query: 135  MEISDAERMYDQEDE---------LRNPVHVNTEDRGD---------DIEDVYESLVTGA 176
             +      + +  DE         L +P   N +D  +         ++ED Y       
Sbjct: 123  KDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDY------- 175

Query: 177  HGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMIIF 236
             GGY+++   P   LR   R+ +W+   S   K  HYLPA +              MIIF
Sbjct: 176  GGGYQSL--RPSHNLRFRPRN-IWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIF 232

Query: 237  PITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKD 296
            PITEP+FSHLGP+G+SMFY+STIISQ +YS G+S+FP+G+GSEMIE+TPF+H+MALA+KD
Sbjct: 233  PITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKD 292

Query: 297  ALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLV 356
            AL G DDEI+TTTIFCYVISS++TG+ FYVLGK++LGKIVGFFPRHILIGCIGGVGYFL+
Sbjct: 293  ALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLI 352

Query: 357  VTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFY 416
            +TG+EVTTRVAK EY+WPF S +FT+                    QR+F+NSLVLPTFY
Sbjct: 353  ITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFY 412

Query: 417  IATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAP 476
            I TLV FHF+VAIIP +SL  LR  GWIFP+A S  +WYDHYKLF  H+VHW L+ +Q P
Sbjct: 413  ILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIP 472

Query: 477  TMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNS 536
            TM+AL+FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYSN  SG LGS+QNYLVYTNS
Sbjct: 473  TMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNS 532

Query: 537  LLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETR 596
            +LFIRAGADS+ AG+LL  LT  +M+IGPVIIS+IPICIVGSLIFLLGYELL EAL++T 
Sbjct: 533  VLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 592

Query: 597  GKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKST 656
             K+  FEY+T+ IIV TMG+FDFVLG+IVGILIACFSFLVDSTKLQTINGEY+G +AKST
Sbjct: 593  NKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKST 652

Query: 657  VYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLI 716
            VYRDYVQ++FLDGIGEQIYVLKLQ++LFFGTIISIEEKI KLL+IS ++   KRRIK LI
Sbjct: 653  VYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQIS-NKDAKKRRIKYLI 711

Query: 717  LDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELF 776
            LD KNINADNIDYSAAEGFNRIKRFT +K I+LIISSI E D IY AF+ V LL+DVELF
Sbjct: 712  LDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELF 771

Query: 777  GDLNGALEWCENELLFKYKELRAKARDRLQNKMQ---MANLAANNDTKAIDGV------- 826
             DLN ALEWCENE LF+YK+LR KA+ RL+ + Q    + + A    K IDG+       
Sbjct: 772  ADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTG 831

Query: 827  PKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXX 886
                H +NLMSLP NTPRN QMLSVAQ VF N+++ V + K+ YK               
Sbjct: 832  ENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQ 891

Query: 887  YRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLP 946
            YRP I+SE   V+  E++ W++LCPYFTRRRLASQS+LLH  +IFF++ETG+LK  Y+LP
Sbjct: 892  YRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELP 951

Query: 947  QGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYT 1006
            QG +YE  SN TC+G ++ PG     E K+TI+TET+ VLWVIDSS L ++K+ENL+LY 
Sbjct: 952  QGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYV 1011

Query: 1007 ELILLIATVKEQRYRQILGYTLVSA 1031
            E+ L++  +K+ R++++LGYTLVSA
Sbjct: 1012 EVTLMVMCIKDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1189 bits (3077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1040 (59%), Positives = 757/1040 (72%), Gaps = 47/1040 (4%)

Query: 20   EAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSC--SPYGS 77
            EAISVSLG+   ++    H  + S          MSP    L RSY+SGF +   SP   
Sbjct: 16   EAISVSLGINQDSSVNKMHRASVSA---------MSPP---LCRSYMSGFFTGGNSPM-I 62

Query: 78   NSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDY---VSATEE 131
            N+L   +LPI+ +   K IH ++NLHRQTA+L  +F   +VE+N+  I+DY   +   + 
Sbjct: 63   NNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDR 122

Query: 132  PRPMEISDAERMYDQE--DE----LRNPVHVNTED---RGDDIEDVYESLVTGAHGGYRA 182
                 +   E   D+E  DE    L +P   N +D   RG     + E L  G  GGY++
Sbjct: 123  KDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPE-LEDGYAGGYQS 181

Query: 183  IPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMIIFPITEPI 242
            +   P   LR   R+ LW    S  SK  HYLPA +              MIIFPITEP+
Sbjct: 182  L--RPSHNLRFRPRN-LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPV 238

Query: 243  FSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRD 302
            FSHLGP+G+SMFY+STIISQ +YS G+S+FP+G+GSEMIE+TPF+H+MALAIK+AL G D
Sbjct: 239  FSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGND 298

Query: 303  DEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEV 362
            DEI+TTTIFCYVISS++TG+ FY LGK++LGKIVGFFPRHILIGCIGGVGYFL++TG+EV
Sbjct: 299  DEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEV 358

Query: 363  TTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVA 422
            TTRVAK EY+WPF S +FTD                    QR+F+NSLVLP+FYI TLV 
Sbjct: 359  TTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVL 418

Query: 423  FHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALS 482
            FHF+VAIIP +SL  LR  GWIFP+A S  +WYDHY+LF  H+VHW L+ +Q PTM+AL+
Sbjct: 419  FHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALT 478

Query: 483  FFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRA 542
            FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYSN  SG LGS+QNYLVYTNS+LFIRA
Sbjct: 479  FFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRA 538

Query: 543  GADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNF 602
            GADS  AG+LL  LT  +M+IGPVIIS+IPICIVGSLIFLLGYELL EAL++T  K+  F
Sbjct: 539  GADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRF 598

Query: 603  EYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYV 662
            EY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVDSTKLQTINGEY+G +A+STVYRDYV
Sbjct: 599  EYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYV 658

Query: 663  QSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNI 722
            Q++FLDGIGEQIYVLKLQ+LLFFGTIISIEEKI +LL+IS ++  +KRRIK LILD KNI
Sbjct: 659  QTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQIS-NKDATKRRIKYLILDFKNI 717

Query: 723  NADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGA 782
            NADNIDYSAAEGFNRIKRFT++K I+LIISSI E D IY AF+ V LL+DVELF DLN A
Sbjct: 718  NADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSA 777

Query: 783  LEWCENELLFKYKELRAKARDRL----QNKMQMANLAANNDTKAIDGV-------PKSHH 831
            LEWCENE LF+YK+LR KA++RL    QN +  A +AA  + K ID +            
Sbjct: 778  LEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKN-KKIDTIGNGLNRGSNGDT 836

Query: 832  MQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGI 891
             +NLMSLP NTPRN Q+LSVAQ VF N+++ V + K  YK+              YRP I
Sbjct: 837  ARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDI 896

Query: 892  LSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVY 951
            +SE   V+  E++ W++LCPYFTRRRLASQS LLH  +IFF++ETG+LK  Y+LPQG +Y
Sbjct: 897  ISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLY 956

Query: 952  ESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILL 1011
            E  SN TC+G ++ PG     E K+TI+TET+ VLWVIDSS L +LK++NL+LY E+ L+
Sbjct: 957  EIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALM 1016

Query: 1012 IATVKEQRYRQILGYTLVSA 1031
            +  +K+ R++++LGYTLVSA
Sbjct: 1017 VMCIKDTRFKELLGYTLVSA 1036

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1057 (58%), Positives = 761/1057 (71%), Gaps = 61/1057 (5%)

Query: 16   HSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSCSP- 74
             SIS +ISVSLGLQ    PRD +       +D +N       NNY+GRSYVSGFLS SP 
Sbjct: 16   QSISGSISVSLGLQQEEEPRDDY-------FDDENVN----NNNYMGRSYVSGFLSVSPA 64

Query: 75   -YGSNSLESDRLPIA-----RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQDYVSA 128
              GS   + + LP+A     R+  + IHA++ LH+QTA + ED  E + +D  I+DY++ 
Sbjct: 65   LMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISED-FEDDEDDTRIKDYITL 123

Query: 129  TEEPRPMEISDAERMYDQ----------EDELRNPV----HVNTEDR----------GDD 164
             +      ++D     DQ          E++   PV     V+   R            +
Sbjct: 124  FQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNINPN 183

Query: 165  IEDVYESLVTGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXX 224
            I+D+  ++       Y++I  +    L  +S + +W+       + +HYLPA +      
Sbjct: 184  IDDLLPTVTGEDVSSYQSIYRTATPSLSRNSET-IWQNIADFPYQFIHYLPAAVLGLLLN 242

Query: 225  XXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVT 284
                    MIIFPITEPIFSHLGP+GLSMFY+STIISQ IYSSG+S+FP+G+GSEMIEVT
Sbjct: 243  ILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVT 302

Query: 285  PFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHIL 344
            PFFH+MALAIK+ LPGRDDEI+TTTIFCYVISS++TGLTFY LGK+ LGKIVGFFPRHIL
Sbjct: 303  PFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHIL 362

Query: 345  IGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQR 404
            IGCIGGVGYFL+VTG+EVTTRVAK EY+ PF++ +F+D +                  QR
Sbjct: 363  IGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQR 422

Query: 405  HFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPH 464
             F+NSLVLP+FYI TL+ FHF+VAIIP+++L +LR+ GWIFP+A S  +WYDHYKLF   
Sbjct: 423  CFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFK 482

Query: 465  RVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGAL 524
            +VHW L+ KQ PTMLAL+FFGILHVPINVPALA+SL +DKYDVDKELIAHG SN +SGA+
Sbjct: 483  KVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAV 542

Query: 525  GSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLG 584
            GSIQNYLVYTNS+LFIRAGADSAMAGY+L  LT I+M IGPVIIS+IPICIVGSLIFLLG
Sbjct: 543  GSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLG 602

Query: 585  YELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTI 644
            YELL EAL +  GK++NFEYITI IIVLTMGIFDFVLG+IVGILIACFSFL+DSTKLQTI
Sbjct: 603  YELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTI 662

Query: 645  NGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDD 704
            NGEYDG +AKSTVYRD +Q++FL+GIGEQIYVLKLQ+LLFFGTIISIEEKI++LLEI   
Sbjct: 663  NGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEIC-H 721

Query: 705  QKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAF 764
            + +S+ RIK LILD KNINADNIDYSAAEGFNRIKRFTQ+K IQL+ISSI E DHIY AF
Sbjct: 722  KDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAF 781

Query: 765  SKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKM----------QMANL 814
              V LL  VELF DLN ALEWCENE LFKYK+LR KA+ RL  K           Q    
Sbjct: 782  DNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQF 841

Query: 815  AANNDTKAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXX 874
             A ND K+   +P+     NLMSLP NTPRN Q+LSVAQ VF+NE++TV +LK   K+  
Sbjct: 842  TAGNDKKSNLDIPR-----NLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQA 896

Query: 875  XXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVM 934
                        YRPGI+S D  VK +E++ WS+LCPYF +  LASQS L+HN++IFF++
Sbjct: 897  PFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIV 956

Query: 935  ETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSIL 994
            ETGILK  ++LPQG +YE++SNRTCYG +         ++ +TI+ E + +LWVIDS  L
Sbjct: 957  ETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKT-LTIRAEIDSILWVIDSGSL 1015

Query: 995  ARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
             +++ EN  L+TEL LLI  VK+ R++++LGYTLVSA
Sbjct: 1016 IKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1046 (58%), Positives = 770/1046 (73%), Gaps = 59/1046 (5%)

Query: 20   EAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSC--SPYGS 77
            EAISVSLG+   ++    H  + S          MSP    L RSY+SGF +   SP   
Sbjct: 16   EAISVSLGINQDSSINKMHRASVSA---------MSPP---LCRSYMSGFFTGGNSPM-I 62

Query: 78   NSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDY---VSATEE 131
            NS+   +LP++ +   K IH ++NLHRQTA+L  +F   +VE+N+  I+DY   + + + 
Sbjct: 63   NSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDR 122

Query: 132  PRPMEISDAERMYDQE--DE----LRNPVHVNTED---RG------DDIEDVYESLVTGA 176
                 +   E   D+E  DE    L +P   N  D   RG       ++ED YE      
Sbjct: 123  KDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYE------ 176

Query: 177  HGGYRAIPTSPGGGLRTSSRSALWRQFMSS-SSKLVHYLPATIXXXXXXXXXXXXXXMII 235
             GGY+++ +S    LR+  R+  +R+  +S  SK +HYLPA +              MII
Sbjct: 177  -GGYQSLRSS--HNLRSRPRN--FRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMII 231

Query: 236  FPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIK 295
            FPITEP+FSHLGP+G+SMFY+STIISQ +YS G S+FP+G+GSEMIE+TPF+H+MALA+K
Sbjct: 232  FPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVK 291

Query: 296  DALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFL 355
            +AL G DDEI+TTTIFCYVISS++TG  FYVLGK++LGKIVGFFPRHILIGCIGGVGYFL
Sbjct: 292  EALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFL 351

Query: 356  VVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTF 415
            ++TG+EVTTRVAK EY+WPF   +FT+                    QR+F+NSLVLP+F
Sbjct: 352  IITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSF 411

Query: 416  YIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQA 475
            YI TLV FHF+VAIIP +SL  LR  GWIFP+A S  +WYDHYKLF  H+VHW L+ +Q 
Sbjct: 412  YILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQI 471

Query: 476  PTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTN 535
            PTM+AL+FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYSN  SG LGS+QNYLVYTN
Sbjct: 472  PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531

Query: 536  SLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIET 595
            S+LFIRAGADS+ AG+LL  LT  +M+IGPVIIS+IPICIVGSLIFLLGYELL EALI+T
Sbjct: 532  SVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDT 591

Query: 596  RGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKS 655
              K+  FEY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVDSTKLQTINGEY+G +AKS
Sbjct: 592  WNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKS 651

Query: 656  TVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCL 715
            TVYRDYVQ++FLDGIGEQIYVLKLQ+LLFFGTI+SIEEKI KLL+IS ++  +KRRIK L
Sbjct: 652  TVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQIS-NKDATKRRIKYL 710

Query: 716  ILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVEL 775
            ILD KNINADNIDYSAAEGFNRIKRFT++K I+LIISSI E D IY AF+ V LL+DVEL
Sbjct: 711  ILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVEL 770

Query: 776  FGDLNGALEWCENELLFKYKELRAKARDRL----QNKMQMANLAA--NNDTKAI-DGVPK 828
            F DLN ALEWCENE LF+YK+LR KA++RL    QN +  A +AA  N +  A+ +G+ K
Sbjct: 771  FADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNK 830

Query: 829  SHHM---QNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXX 885
             +++   +NLMSLP NTPRN QMLSVAQ VF N+++ V + K  YK+             
Sbjct: 831  GNNIDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALK 890

Query: 886  XYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDL 945
             YRP I+SE   V+  E++ W++LCPYFTRRRLASQS+LLH  ++FF++ETG+LK  Y+L
Sbjct: 891  QYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYEL 950

Query: 946  PQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLY 1005
            PQG +YE  SN TC+G ++ PG     E K+TI+TET+ +LWVIDSS L ++K+ENL+LY
Sbjct: 951  PQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALY 1010

Query: 1006 TELILLIATVKEQRYRQILGYTLVSA 1031
             E+ L++  +K+ R++++LGYTLVSA
Sbjct: 1011 VEVALMVMCIKDTRFKELLGYTLVSA 1036

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1172 bits (3032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1052 (58%), Positives = 741/1052 (70%), Gaps = 76/1052 (7%)

Query: 16   HSISEAISVSLGLQNTNTPRDHHD-----------GNHSNPYDSQNDQFMSP----RNNY 60
             SIS AISVSLGL N    R+              G   N  DS + + +SP     NNY
Sbjct: 13   QSISGAISVSLGL-NRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFYNSNNY 71

Query: 61   LGRSYVSG-FLSCSP---YGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPN 116
             GRSY+ G FLS SP       + +S  LPI R R+KSIH ++ +HRQTA+L        
Sbjct: 72   AGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTAELS------- 124

Query: 117  VEDNNIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGA 176
               NN  D  +  EE R        R    EDE  +  H  T                  
Sbjct: 125  ---NNFSDDTTGMEEVR-------NRYDAMEDENSSLHHYMT------------------ 156

Query: 177  HGGYRAIPTSPGGGLRTSSRSALWRQFMSS----SSKLVHYLPATIXXXXXXXXXXXXXX 232
            H  Y+ +P         ++ S   R   SS       ++HY P+ +              
Sbjct: 157  HQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVLGLLLNILDGLSYG 216

Query: 233  MIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMAL 292
            MIIFPITEPIFSHLG +GLSMFY+STIISQ +YS G S+F +G+GSEMIEVTPFFH+MA 
Sbjct: 217  MIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAF 276

Query: 293  AIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVG 352
            AI+DA+PG+DD+I+TTTIFCY ISS+VTG+TFY+LGK++LGKIVGFFPRHILIGCIGGVG
Sbjct: 277  AIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVG 336

Query: 353  YFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVL 412
            YFL++TGL VTTR+AK+EYTW F+  +F D                    Q+ FQNSLVL
Sbjct: 337  YFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVL 396

Query: 413  PTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIA 472
            P+FYI TL+ FHFVVAI+P++SL +LR++GWIFP A SKD+W+DHYKLF  H+VHW L+ 
Sbjct: 397  PSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVL 456

Query: 473  KQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLV 532
             Q PTMLAL+FFGILHVPINVPALAISL MDK+DVDKELIAHGYSN +SG +GSIQNYLV
Sbjct: 457  AQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLV 516

Query: 533  YTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEAL 592
            YTNS+LFIRAGADS  AGY+LA LTF +MVIGPVI+S+IPICIVGSLIFLLGYELL EAL
Sbjct: 517  YTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEAL 576

Query: 593  IETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKI 652
            ++TRGKVTNFEYITI IIVLTMGI+DFVLGVIVGILIACFSFLVDSTKLQTINGE+DGK+
Sbjct: 577  LDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKV 636

Query: 653  AKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRI 712
            A+STV RDYVQS FL+G+GEQIYVLKLQ++LFFGTIISIEEKI+KLLEI+D + +SKRRI
Sbjct: 637  ARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRI 696

Query: 713  KCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDD 772
            K LILD KNINADNIDYSAAEGFNRIKRFTQ+K I+LIISSI E DHIY  FS V LLDD
Sbjct: 697  KYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDD 756

Query: 773  VELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSH-- 830
            VELF DLNGALEWCENE L +YK+LR +AR+++Q+     N+ +  +  A   VP  +  
Sbjct: 757  VELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY---NVTSAIEAAAAKKVPTDNNQ 813

Query: 831  ---------HMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNY--KEXXXXXXX 879
                     + +NL SLP NTPRN QMLSVAQ +F N+++ VD+L+              
Sbjct: 814  ISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVLPL 872

Query: 880  XXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGIL 939
                   YR  I S D +++  E +LWS+L PYF +RRL +QSILLHN D FFV+E+G+L
Sbjct: 873  LLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLL 932

Query: 940  KIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQ 999
            KI  DLPQG+VYE++SNRTC G ++    +   E KVTI TET+  LW+ID   L +L+ 
Sbjct: 933  KIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDGLQKLRA 992

Query: 1000 ENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
            ENL LYTEL+LL   +K +R+ Q+LGYTLVSA
Sbjct: 993  ENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1171 bits (3030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1060 (58%), Positives = 770/1060 (72%), Gaps = 58/1060 (5%)

Query: 16   HSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSCSPY 75
            HSIS+ ISVSLGLQN + P+     N        N   MS  +NYLGRSYVSGFLS SP 
Sbjct: 9    HSISDTISVSLGLQNQD-PQILQQPNGGPTVTLGN---MSDTSNYLGRSYVSGFLSASPA 64

Query: 76   GSNSLESDRLPIARMR-TKSIHAAKNLHRQTAKLCEDFN-EPNVEDN-NIQDYVSATEEP 132
             ++   ++ LPIA     KSIHA++NLHRQTA + EDFN +P  ED+ N+++Y+S  E+ 
Sbjct: 65   INHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYISNLEDD 124

Query: 133  RPMEISDAERMY--DQEDELRNPVHVNTEDRGDDIEDVY---------------ESLVTG 175
                       Y  D ED + N   + TE+  + + D Y               +SL+ G
Sbjct: 125  ATGNNGKRYTAYYIDNEDRIDN---ILTEE-AEPVTDFYPQDENSRLLLSPIPSDSLLAG 180

Query: 176  AH------------------GGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPAT 217
             +                    Y++I          SS    WR+++++ S+++ YLPA+
Sbjct: 181  ENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPT-WRKYIATPSEIIQYLPAS 239

Query: 218  IXXXXXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVG 277
            I              MIIFPITEPIFSHLGP+G+SMFY+STIISQ I+S G+S+FP G+G
Sbjct: 240  ILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFPCGIG 299

Query: 278  SEMIEVTPFFHSMALAIKDALP-GRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIV 336
            SEMIEVTPFFH+MA AIKDALP G +D+I+TTT+FCYVISS++TGLTFY LGK+ LGKIV
Sbjct: 300  SEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHLGKIV 359

Query: 337  GFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXX 396
            GFFPRHILIGCIGGVGYFL++TG+EV+TRVAK +YT PFI+H+FTDV             
Sbjct: 360  GFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLPTLLT 419

Query: 397  XXXXXXQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYD 456
                  Q+  QNSLVLP+FYI TL+ FHF+VAIIP++SL +LR+ GWIFP AA+  +WYD
Sbjct: 420  VILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDSKWYD 479

Query: 457  HYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGY 516
            HYKLF  H+VHW LI KQ PTMLAL+FFGILHVPINVPALA+SLQMD+YDVDKELIAHG 
Sbjct: 480  HYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELIAHGV 539

Query: 517  SNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIV 576
            SN +SG  GSIQNYLVYTNS+LFIRAGADSA+AG++L  LT I+M+IGPVIIS+IPICIV
Sbjct: 540  SNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIPICIV 599

Query: 577  GSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLV 636
            GSLIFLLGYELL EAL++  GK++ FEYITI IIV TMGIFDFVLGVIVGILIACFSFL+
Sbjct: 600  GSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACFSFLI 659

Query: 637  DSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKIN 696
            DSTKLQTINGE+DG +AKSTVYRD +Q++FL+GIGEQIYVLKLQ+LLFFGTIISIEEKI+
Sbjct: 660  DSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKID 719

Query: 697  KLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISE 756
            KLLEIS D  +SK RIK LILD KNINADNIDYSAAEGFNRIKRFTQ+K I+LIISSI E
Sbjct: 720  KLLEIS-DMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSIRE 778

Query: 757  TDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAA 816
             DHIY AF+ V LL+ VELF DLN ALEWCENE LFKYK LR K R + +NK+ + NLA 
Sbjct: 779  RDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTLREKTRQKRKNKIDI-NLAI 837

Query: 817  NNDTKAIDGVPKSHHMQ---NLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEX 873
             N     +   ++ H++   N+MSLP NTPRN+QMLSVAQ VF+NE++   +LK  +K  
Sbjct: 838  TNGNPTEE---RNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNE 894

Query: 874  XXXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFV 933
                         YRP I+S D +++  E++ WS+LCPY + R L +QS L HN++ FF+
Sbjct: 895  PSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFI 954

Query: 934  METGILKIVYDLPQGIVYESLSNRTCYGIVL--NPGTRPCSESKVTIKTETEVVLWVIDS 991
            +E+GILK  + LP G +YE++SNRTCYG +L  N  T   +E  +TIKTET+  LWVID 
Sbjct: 955  VESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWVIDM 1014

Query: 992  SILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
              L R++ ENL LY EL+LLI ++++ R++++LGYTLVSA
Sbjct: 1015 DALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1013 (55%), Positives = 722/1013 (71%), Gaps = 45/1013 (4%)

Query: 58   NNYLGRSYVSGFLSCS-PYGSNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEP 115
            N +LGRSYVSG L  S P G    E + LP++ +  +++IH    LHRQTA + E+F++ 
Sbjct: 64   NTFLGRSYVSGILGSSLPQGG---ERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDG 120

Query: 116  NVEDN--NIQDYVSATEEPRPMEISDAERMYDQEDEL----RNPVHVNTEDRGD-DIEDV 168
             + ++  ++++Y++  +E +  E+ D     D +++L    + PV +N +   D ++E  
Sbjct: 121  TIGESPSSLKEYLNLLDEAQEEEL-DLRNRRDLDNDLITDNKTPVSINLKRATDPELEQQ 179

Query: 169  YESLVTGAHGG-------------------------YRAIPTSPGGGLRTSSRSALWRQF 203
              +L+T +                            Y++I   P  G R    S   + +
Sbjct: 180  TVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAW 239

Query: 204  MSSSSKLVHYLPATIXXXXXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQV 263
            M+   ++ +Y+PA I              MIIFPITEPIF+ LGP+G+SMFY+STIISQ 
Sbjct: 240  MTLK-RVTNYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGISMFYISTIISQF 298

Query: 264  IYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLT 323
            IYSSG+S+FP+G+GSEMIE+TPF+H+MALAI  ALPGRDDEI+TTTIFCYVISS++TGLT
Sbjct: 299  IYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLT 358

Query: 324  FYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDV 383
            FY+LGK++LGKIVGFFPRHILIGCIGGVGYFL++TGLEVTTR+AK EY+ PF++ +F D 
Sbjct: 359  FYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDS 418

Query: 384  SXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGW 443
            S                  Q+ F+NSLVLP+FYI TL+ FHFVVAI PN+SL +LR  GW
Sbjct: 419  SMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGW 478

Query: 444  IFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMD 503
            IFP      +WYDHY+ F   + HW L+ KQ PTMLAL+FFGILHVPINVPALA+SLQMD
Sbjct: 479  IFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMD 538

Query: 504  KYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVI 563
            KYDVDKELIAHGYSN  SG  GS+QNYLVYTNS+LFIRAGADSA+AGY+L  LT ++MVI
Sbjct: 539  KYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYVLIVLTIMVMVI 598

Query: 564  GPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGV 623
            GPVIIS+IPICIVGSLIFLLGYELL EA+I+  GKVT FEY TI IIVLTMGIFDFVLG+
Sbjct: 599  GPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGI 658

Query: 624  IVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLL 683
            +VGILIACFSFLVDSTKLQT+NGE+DG +AKSTVYRD+ Q+RFL  IGEQIYVLKLQ++L
Sbjct: 659  VVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNIL 718

Query: 684  FFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQ 743
            FFGTIISIEEKI +LLEISD+   SK RIK LILD KNINADNIDYSAAEGFNRIKR+T+
Sbjct: 719  FFGTIISIEEKIERLLEISDNDV-SKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTE 777

Query: 744  SKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARD 803
            +K I+LIIS+I E+D IY  F++V LL D+ELF DLN ALEWCENE L++YKELR KAR+
Sbjct: 778  AKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARN 837

Query: 804  RLQNKMQMANLAANNDTKAIDGV-----PKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKN 858
            +LQ + +  N A  N  +  D       P S  MQNLMSL  NTPRN Q++S AQ+ F N
Sbjct: 838  KLQRRSKNINAAIGNQLRRYDQTNKNQGPTSSLMQNLMSLSNNTPRNYQLVSAAQQAFSN 897

Query: 859  EQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRL 918
            EQ+    +    K               YRP I+S DT  +  E+E W +LCPYFTR+  
Sbjct: 898  EQQISTEIDTKLKIPDPLLKVLLFALKLYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVF 957

Query: 919  ASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTI 978
             + +  LHN++ FF+++ GILK++Y+LP G VYE+LSN TCYG +L+          + +
Sbjct: 958  TANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRV 1017

Query: 979  KTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
            + ET+ +LW+ID   +  +K +N+ LYTEL+LLI  +++ R++++LGYTLVSA
Sbjct: 1018 QVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1085 (54%), Positives = 741/1085 (68%), Gaps = 80/1085 (7%)

Query: 16   HSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSCSPY 75
             SISE+ISVSLGLQN     D    ++ NP      Q +   ++YLGRSYVSG  S +  
Sbjct: 15   QSISESISVSLGLQN----NDARQSDNENPL-----QVLPGESSYLGRSYVSGLWSPTQR 65

Query: 76   GSNSLESDRLPIARMR--TKSIHAAKNLHRQTAKLCEDFNEPN----VEDNNIQDYVSAT 129
             + S   D LP +  +  +K IH ++ LHRQT  + E+F++ N     E+ ++ +Y+   
Sbjct: 66   NNKS-GYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLV 124

Query: 130  E--EPRPMEISDAERM--------------------------YDQEDE----LRNPVH-- 155
            E  E +   I + +++                          Y   DE    L  PV   
Sbjct: 125  EHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSL 184

Query: 156  -VNTEDRG----DDIEDVYESLVTGAHGGYRA-IPT----SPGGGLRTSSRSALWRQFMS 205
             V   D      +D      S + G +  Y + IPT    S  G       ++ W    +
Sbjct: 185  SVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISA 244

Query: 206  SSSKLVHYLPATIXXXXXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIY 265
             S  +VHYLPA+I              MIIFPITEPIFS LGPSGLSMFY+ST+ISQ  Y
Sbjct: 245  LSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTY 304

Query: 266  SSGFSNFPTGVGSEMIEVTPFFHSMALAIKDAL-PGRDDEILTTTIFCYVISSLVTGLTF 324
            SSG+S+FP G+GSEMIEVTPFFH+MAL I   L   R +EI+TTTIFCYVISS+ TGLTF
Sbjct: 305  SSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFTGLTF 364

Query: 325  YVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVS 384
            + LGK+KLGK+VGFFPRHILIGCIGGVGYFL++TG+EV TR+AK EY+ PF+ ++FTD  
Sbjct: 365  FTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEK 424

Query: 385  XXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWI 444
                              Q  F+NSLVLP+FYI TL+ FHF+VAI+PN+SL KLRN GWI
Sbjct: 425  TLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWI 484

Query: 445  FPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDK 504
            FPVAAS   WYDHYK F    VHW L+ KQ PTM+AL+FFGILHVPINVPALA+SLQMDK
Sbjct: 485  FPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDK 544

Query: 505  YDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIG 564
            YDVD+ELIAHGYSN  SG  GSI+NYLVYTNS+LFIRAGADSA+AGY+L  LT I+M+IG
Sbjct: 545  YDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLIG 604

Query: 565  PVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVI 624
            PVIIS+IPICIVGSLIFLLGYELL EAL++T GK+  FEY+T+ II+LTMGIFDFVLG+I
Sbjct: 605  PVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGII 664

Query: 625  VGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLF 684
            VGILIACF FL+DST LQT+NGE+ G++AKSTVYRD +Q+ FLDG+GEQIYVLKLQ+LLF
Sbjct: 665  VGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLF 724

Query: 685  FGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQS 744
            FGTIISIEEKI+KLLEIS++  +SKRRIK LILD KNIN DNIDYSAAEGFNRI+RFTQ+
Sbjct: 725  FGTIISIEEKIDKLLEISNND-SSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQT 783

Query: 745  KHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDR 804
            K IQLIISSI E D IY AF+ V LL+DVELF DLN +LEWCENELL  Y ELR KA+ R
Sbjct: 784  KGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKAR 843

Query: 805  LQNKMQMANLAANN---------DTKAIDGVPKSHH--MQNLMSLPFNTPRNDQMLSVAQ 853
            L+     AN   +          D++AI    +S    + NLMSLP NTPRN QML+VAQ
Sbjct: 844  LRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQ 903

Query: 854  RVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYF 913
             VFKN+++TV SL+   K               YRP I S D   ++ E+ +WS+LCPYF
Sbjct: 904  DVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCPYF 963

Query: 914  TRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSE 973
             ++ + +Q+ L H + IFF+++TG+LK V+ LPQG VYE+++NRTCYG +++ GT     
Sbjct: 964  AKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDA 1023

Query: 974  -------SKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGY 1026
                   SK+ I TET+  LWVID++ + RL++E+  L+ +L LL+  +K++R++ +LG+
Sbjct: 1024 DTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGH 1083

Query: 1027 TLVSA 1031
             L+SA
Sbjct: 1084 ALISA 1088

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1051 (53%), Positives = 735/1051 (69%), Gaps = 49/1051 (4%)

Query: 17   SISEAISVSLGLQNTNTPRDHHDGNHS-NPYDSQNDQFMSPRNNY----LGRSYVSGFLS 71
            S SEA+SVSLGL            N + N Y   ND   S  +N     +GRSY     S
Sbjct: 20   SFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIGRSYAGSISS 79

Query: 72   CSP--YGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQDYVSAT 129
             SP  Y + S   + LPI +M +KSI     LHRQTA++  DFN+ ++++  I+ Y+   
Sbjct: 80   NSPSLYLNTSRTDELLPIRKMPSKSILGPDALHRQTAEISNDFNDTSMDEAKIKRYIELL 139

Query: 130  EEP---------------RPMEISDAERMYD-------QED--ELRNPVHVNTEDRGD-- 163
                              RP    + +           Q D  E R  +  ++   G+  
Sbjct: 140  NRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLDGLEQRALLTPSSSIVGNEF 199

Query: 164  DIEDVYESLVTGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXX 223
            D+E  Y+ +    +  Y +I       LR  SR      F +   +L++YLPA I     
Sbjct: 200  DLESTYDEI----NNDYNSI-------LRIQSRELTSSSFATKGLELLNYLPAAILGLLL 248

Query: 224  XXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEV 283
                     MIIFPITEP+FS LGP+G+SMFY+STI+ Q++ S GFS+FP G+GSEMIE+
Sbjct: 249  NILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSFPCGIGSEMIEI 308

Query: 284  TPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHI 343
            TPF+H+MA AIKDALP +D+E++TTTIFCYVISS+VTGL F++LGK+K+GKIVGFFPRHI
Sbjct: 309  TPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKMGKIVGFFPRHI 368

Query: 344  LIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQ 403
            LIGCIGGVGYFL++TG+EV+TR+ K EY W F+  + T++                   Q
Sbjct: 369  LIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLPTLLTLSLILIQ 428

Query: 404  RHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQP 463
            R  QNSLVLP+FYI T++ FHF+VAI+PN+SL  LR  GWIFPV  SK+ WYDHYK F  
Sbjct: 429  RQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSKNSWYDHYKYFNL 488

Query: 464  HRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGA 523
            H +HWGL+ KQ PTMLAL+FFGILHVPINVPALA+SL MDKYDVD+ELIAHGYSNL+SG 
Sbjct: 489  HDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDRELIAHGYSNLISGL 548

Query: 524  LGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLL 583
            LGS+QNYLVYTNS+LFIRAGADS+ AG+LL  LT ++MV G VI+S+IP+CIVGSLIFLL
Sbjct: 549  LGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIPVCIVGSLIFLL 608

Query: 584  GYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQT 643
            GYEL+ EAL++T G VT+FEYITI IIV  MGI+DFVLG+IVGILIAC SF+VD TKL+T
Sbjct: 609  GYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIACLSFMVDGTKLET 668

Query: 644  INGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISD 703
            INGEYDG++AKSTVYRDY+Q++FL+GI +QIY+LKLQ++LFFGTIISIEEKI+KLLEIS 
Sbjct: 669  INGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIEEKIDKLLEIS- 727

Query: 704  DQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTA 763
            D+  SKRRIK LILD KNINADNIDYSAAEGFNRIKRFTQ K IQLIISSI E D IY+ 
Sbjct: 728  DKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIISSIKEKDKIYSV 787

Query: 764  FSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAAN---NDT 820
            F+ V+LL+DVELF DLN ALEWCENE L++Y +L  KA+DR+  ++ ++  + +   +  
Sbjct: 788  FNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISISKDSGSTYFSRN 847

Query: 821  KAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXX 880
            ++  G+  +   Q LMSLP NTPRN+Q+LSVA++VFKNE +T    K + +         
Sbjct: 848  RSDSGLSAADQ-QMLMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHNETDKPVLSLL 906

Query: 881  XXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILK 940
                  +RP + SED +++  E+  W +L PYF R    + S L+++S+ FFV+E+G+++
Sbjct: 907  LYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVR 966

Query: 941  IVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQE 1000
            + +DLPQGIV E++SNRTCYG V+       +  K+  KTETE ++W+ID   ++R+K+E
Sbjct: 967  VTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMIDDDTMSRIKKE 1026

Query: 1001 NLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
            NL+LYTEL+LL+ T++E RY+ ++GYTLVSA
Sbjct: 1027 NLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1043 (54%), Positives = 734/1043 (70%), Gaps = 67/1043 (6%)

Query: 17   SISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFL-SCSPY 75
            S+S++IS SLGLQ+  +     D   SN            ++NYL RSY+ G L S +P 
Sbjct: 17   SLSDSISRSLGLQDQESNIAGTDNELSNS-----------KSNYLSRSYMYGLLPSATPV 65

Query: 76   GSNSLESDRLPIAR-MRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQDYVSATEEPRP 134
                LE++ LP++  +R KSIH ++ LH+QTA +CEDFNE   ++ +++DY+   E    
Sbjct: 66   --EELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNES--DEGSMKDYLDFIEN--- 118

Query: 135  MEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYES----------------LVTGAHG 178
               +D + + + ++ L  PV V      D++E+  ES                +  G   
Sbjct: 119  ---TDRDNINEHKESL--PVTVVLSTPADEVEEQDESSRLLLTPSSSNAEVSSIAEGLRH 173

Query: 179  GYRAIPTSPGGGLRTSSR--SALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMIIF 236
             Y +I ++    +    +  + +  +  +     + Y PA++              MIIF
Sbjct: 174  HYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIF 233

Query: 237  PITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKD 296
            PI+EPIFSHLGP+G+SMFY+STII Q IYSSG+S+FP+ +GSEMIE+TPFFH+MA AI  
Sbjct: 234  PISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMR 293

Query: 297  ALPGRD--DEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYF 354
            +LPG +  D I+TTTIFCYVISS+ TGLTF  LGK++LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 294  SLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYF 353

Query: 355  LVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPT 414
            L++TG+EVTTR+AK EY+ P I  +FTD S                  Q+ F+ SLVLP+
Sbjct: 354  LLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPS 413

Query: 415  FYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQ 474
            FYIATL+ FHF+VAIIP +SL +LR  GWIF   A    WYDHYKLF  H+VHW L+ KQ
Sbjct: 414  FYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQ 473

Query: 475  APTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYT 534
             PTMLAL+FFGILHVPINVPALA+S+QMDKYDVDKELIAHG SNL+SG  GSIQNYLVYT
Sbjct: 474  IPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYT 533

Query: 535  NSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIE 594
            NS+LFIRAGADS  AGYLL FLT ++M+IGPVIIS+IPICIVGSLIFLLGYELL EAL++
Sbjct: 534  NSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLD 593

Query: 595  TRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAK 654
            T  K+T FEY+T+ +IVLTMGI DFVLG+IVGILIACF FL+DS+KLQTINGE+ GK+AK
Sbjct: 594  TWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAK 653

Query: 655  STVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKC 714
            STV RD +QS+FL+GIG+QIYVLKLQ+LLFFGTIISIEEKI+KLLE+S D+ +SKR+IK 
Sbjct: 654  STVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMS-DRNSSKRQIKY 712

Query: 715  LILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
            LILD +NINADNIDYSAAEGFNRIKR T+SK+IQLIISSI   D IY +F+KV LL  VE
Sbjct: 713  LILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772

Query: 775  LFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQN 834
            LF DLNGALEWCENE L++YK +R   R +++N     + +  N +K            +
Sbjct: 773  LFNDLNGALEWCENEFLYQYKMIR--ERIKIKNVKTATHSSDGNLSKP-----------S 819

Query: 835  LMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSE 894
             M+L  NTPRN Q+ SVAQ +FKNE++TVD LK  +++              YRP I+S 
Sbjct: 820  AMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSV 879

Query: 895  DTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESL 954
            D   K  E+E WS+L PYF+++R+ASQSIL H ++IFF++E G+LK+ +DLPQG VYE++
Sbjct: 880  DKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETM 939

Query: 955  SNRTCYGIVLNPGTRPCSES------KVTIKTETEVVLWVIDSSILARLKQENLSLYTEL 1008
            S R CYG ++  G  P SE+       + IKTE + V+W+IDSS L ++K EN+ LY EL
Sbjct: 940  SKRACYGKIM--GKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLEL 997

Query: 1009 ILLIATVKEQRYRQILGYTLVSA 1031
            +LL+ T+K+ R++ +LG+ LVS 
Sbjct: 998  VLLVMTIKDIRFKSLLGHALVST 1020

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/825 (60%), Positives = 638/825 (77%), Gaps = 21/825 (2%)

Query: 207  SSKLVHYLPATIXXXXXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYS 266
            S K ++Y+PA I              MIIFPITEP+FSHLGP+GLSMFYVSTI+SQ++YS
Sbjct: 247  SIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYS 306

Query: 267  SGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYV 326
             GFS F  G+GSEMIE+TPFFH+MAL+I ++LPG DDEI++TTI CY +SS+ TGL F++
Sbjct: 307  CGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFL 366

Query: 327  LGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXX 386
            LGK++LGKIVGFFPRHILIGC+GGVGYFL++TG+EV TRV+K EY+WPF+  +F +    
Sbjct: 367  LGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVL 426

Query: 387  XXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFP 446
                            Q +F NSLVLP+FYI TL  FHFVVAI+PN+SL  LR  GWIFP
Sbjct: 427  GKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFP 486

Query: 447  VAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYD 506
            +A S + WYD YKL+    VHW L+ KQ PTMLAL+FFGILHVPINVPALA+S+ MDK+D
Sbjct: 487  MAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFD 546

Query: 507  VDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPV 566
            VDKELIAHGYSNLLSG  GSIQNYLVYTNS LFIRAG+DS+ AG+LLA  TF++M+IGPV
Sbjct: 547  VDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPV 606

Query: 567  IISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVG 626
            IIS+IPICIVGSLIFLLGYEL+ EAL +T GK+  FEYITI IIV TMG+FDFVLG+IVG
Sbjct: 607  IISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVG 666

Query: 627  ILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFG 686
            ILIACFSFLVDSTKLQTINGE++G++A+STVYRDY+Q++FL+ +GEQI+VLKLQ+LLFFG
Sbjct: 667  ILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFG 726

Query: 687  TIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKH 746
            TIISIEEKI+ LLEIS D+ +S++RIK LILD KNINADNIDYSAAEGFNRIKRFT++K 
Sbjct: 727  TIISIEEKIDGLLEIS-DKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKR 785

Query: 747  IQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQ 806
            IQLIISSI+E D IY AF+KV LL DVELF DLN ALEWCENE L +YK++R + + +LQ
Sbjct: 786  IQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTKAKLQ 845

Query: 807  NKMQMANLAANNDTKAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSL 866
             + +                 +  H+   + LP NTPRN+Q+++VAQ++F +EQ  V  L
Sbjct: 846  AQKK-----------------QEKHLSKSL-LPINTPRNNQIVTVAQKIFPDEQN-VTHL 886

Query: 867  KVNYKEXXXXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLH 926
            +  Y++              +RP I+S D +VK +E + WSKLCPYF R+R A  S+LLH
Sbjct: 887  RTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLH 946

Query: 927  NSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVL 986
            N+++FF++E+G+LKI YDL QG  YE++S++TCYG + +      +   V IKTET+  +
Sbjct: 947  NNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRI-SGNAEFTTNLYVNIKTETDCAV 1005

Query: 987  WVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
            W+ID++ LA LK++NL+LY EL+L++ ++ + R +++LGY+LVS+
Sbjct: 1006 WIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 64/120 (53%), Gaps = 15/120 (12%)

Query: 17  SISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNN---YLGRSYVSGFLSCS 73
           SISEAI++SLGL         H  N   P  +     M+P N+   YLGRSYV  F S S
Sbjct: 9   SISEAITISLGL---------HSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPS 59

Query: 74  --PYGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQDYVSATEE 131
                S++     L + +  +KSIH +  LHRQTA L  +F++ +   ++  D V+A++E
Sbjct: 60  FLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEID-VAASQE 118

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1054 (52%), Positives = 717/1054 (68%), Gaps = 56/1054 (5%)

Query: 17   SISEAISVSLGLQNTNTPRDHHDGNHSN-------PYDSQND----QFMSPRNNYLGRSY 65
            S SEA+SVSLGLQ     R     N          P +S N       MS +NN +    
Sbjct: 13   SFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMSMKNNTVN--- 69

Query: 66   VSGFLSCSPYGSNSLESDRL--PIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQ 123
            ++  L      + +  +D +  P  +   KSI  A  LHRQTA+L + F + N  D +++
Sbjct: 70   INDKLVPDNSKNRTFYNDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTDKDVK 129

Query: 124  DYVS------ATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGAH 177
            DY+       AT        +    + D+ D+ R  + + T+   +  +D    L+T   
Sbjct: 130  DYIDIIDNDVATSNESDSNSTPEPYLGDEYDQHR--LAIRTQKSPNIADDEQSRLLT--- 184

Query: 178  GGYRAIPTSP--GGGLRTSSR-----------SALWRQFMSS---SSKLVHYLPATIXXX 221
                  P+S   G  L   +            S++ RQ  S     S+++HY PA +   
Sbjct: 185  ------PSSSIIGAELDLEAHYDEFEPVRMDASSINRQNESKLIDFSQILHYFPAAVLGL 238

Query: 222  XXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMI 281
                       MIIFPITEPIF+++G +G+SMFY+S+II Q I S GFS+FPTG+GSEMI
Sbjct: 239  LLNILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMI 298

Query: 282  EVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPR 341
            E+TPF+H+MALAIK++L  ++ EI++TTIFCYVISSLVTGL FY LGK+KLGKIV FFPR
Sbjct: 299  EITPFYHTMALAIKNSLDVQE-EIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPR 357

Query: 342  HILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXX 401
            HILIGCIGGVGYFLVVTGLEVTTRVAK+EY+W F+S++ +D +                 
Sbjct: 358  HILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIF 417

Query: 402  XQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLF 461
             Q HFQNSLVLP+FYI T++ FHF+VA++P +SL KLR+ GWIFP+  S D+W+DHYK F
Sbjct: 418  TQHHFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYF 477

Query: 462  QPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLS 521
              + V W LI KQ PTMLAL+FFGILHVPINVPALA+SL +DK+DVD+E IAHGYSN LS
Sbjct: 478  NVYNVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLS 537

Query: 522  GALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIF 581
            G  GS+QNYLVYTNS+LFIRAGADS +AGYLL  LT I+M+IGPVIIS+IPICIVGSLIF
Sbjct: 538  GLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIF 597

Query: 582  LLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKL 641
            LLGYELL EAL++T GKVT FEY TI IIV TMGI+DFVLG+IVGIL+AC  F+VD TKL
Sbjct: 598  LLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKL 657

Query: 642  QTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEI 701
            QTIN EYDG IAKSTVYRD++QS+FLDGIGEQIY++KLQ++LFFGTIISIEEKI+ LL++
Sbjct: 658  QTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQL 717

Query: 702  SDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIY 761
            SD   +SK RI+ LILD KNIN DNIDYSAAEGFNRIKRFT  +HI+LIISSI+ TD IY
Sbjct: 718  SDSD-SSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIY 776

Query: 762  TAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKM---QMANLAANN 818
             AF+K+ LL D+ELF DLN  LEWCEN+ L KY+EL  KA+ RL ++M   Q  N+++  
Sbjct: 777  KAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQ 836

Query: 819  -DTKAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXX 877
             ++ + DG  +    Q LMSLP NTPRN Q+LSVA+ VFKNE + V   K          
Sbjct: 837  INSTSSDG-NEYQSSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFT 895

Query: 878  XXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETG 937
                     +RP + SE  +++  E++ W++L PYF +  + + S  L+ ++ FF++++G
Sbjct: 896  QLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSG 955

Query: 938  ILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARL 997
            ++K+ +DL  G + E++ +RT YGI+ +   R     KVT   ET+ V+W+IDS  L ++
Sbjct: 956  VIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKM 1015

Query: 998  KQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031
            ++ENL LY+EL LLI ++ + R++ +LGYTLV+A
Sbjct: 1016 EKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1037 (52%), Positives = 705/1037 (67%), Gaps = 57/1037 (5%)

Query: 16   HSISEAISVSLGLQNT-NTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLSCSP 74
            HS+SEAISVSLGLQ+   +  D       NP+ +  D   SP + YLGRSYV+  LS  P
Sbjct: 10   HSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADG--SP-HYYLGRSYVAN-LSPPP 65

Query: 75   YG-SNSLESDRLPIAR-MRTKSIHAAKNLHRQTAKLCEDFN---------EPNVEDNNI- 122
                     D    +R  +++SIH + +L RQTA L  +F+         E   E+ N  
Sbjct: 66   LAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAENGNTA 125

Query: 123  --QDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTE---DRG--DDIEDVYESLVTG 175
               + V A     P        + D  D     +  NT+   + G  D+ +  Y SL + 
Sbjct: 126  VPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSLQSQ 185

Query: 176  AHGG-YRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMI 234
              G   RAI   P   +R  +        + +  +L +Y+PA I              MI
Sbjct: 186  RAGSNSRAI--DPNASMRDKT--------LFTFRRLGNYVPAVILGLLLNILDALSYGMI 235

Query: 235  IFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAI 294
            IFPITEP+FSHLGPSGLSMFY+S+++SQ++YS GFS F   VGSEMIE+TPF+HSMA +I
Sbjct: 236  IFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASI 295

Query: 295  KDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYF 354
              ++PG  D +LTTTI CY +SS++TGL F++LG++KLGKIVGFFPRHILIGCIGGVGYF
Sbjct: 296  MASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYF 355

Query: 355  LVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPT 414
            LV+TG EVTTR +K EY++ F+S + TD                    QR  +NSLVLPT
Sbjct: 356  LVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPT 415

Query: 415  FYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQ 474
            FYIA L+ FHF+VA+IP++SL  LR+ GW+FP   + + W+D YKL+    V W L+ KQ
Sbjct: 416  FYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQ 475

Query: 475  APTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYT 534
             PTMLAL+FFGILHVPINVPALA+S+ +DK DVDKELIAHGYSN LSG +GS+QNYLVYT
Sbjct: 476  VPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYT 535

Query: 535  NSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIE 594
            NSLLFI+AGAD ++AG +LA  TF +MVIGPVI++YIP+CIVGSLIFLLGYELL EAL++
Sbjct: 536  NSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVD 595

Query: 595  TRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAK 654
            T GK+ NFEY T+  IV TMG FDFVLG+IVGILIACFSFLVDSTKLQTINGE+DG++A+
Sbjct: 596  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVAR 655

Query: 655  STVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKC 714
            STV RDY+Q++FL+ IGEQI+VLKLQ+LLFFGTIISIEEKI+KLLE+S D+  SK+RIK 
Sbjct: 656  STVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELS-DKDASKKRIKY 714

Query: 715  LILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
            LILD KNINADNIDYSAAEGFNRIKRFT SK I LIISSI  TD IY AF+KV  LD VE
Sbjct: 715  LILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVE 774

Query: 775  LFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQN 834
            LF DLN ALEWCENE L ++++LR K +                    +  V K     +
Sbjct: 775  LFDDLNSALEWCENEFLRQFRDLRNKTK--------------------LKAVRKQERQLS 814

Query: 835  LMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSE 894
              +LPFNTPRN+  +SVAQ++F +EQ ++  LK +YKE              YRP I+S 
Sbjct: 815  KGALPFNTPRNNHFVSVAQKLFTDEQ-SMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSP 873

Query: 895  DTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESL 954
            +  VK +E ++WS+L  +F +RRLA+QS+L H ++IF V+E+G++K+ Y+L QG +YE L
Sbjct: 874  EKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEIL 933

Query: 955  SNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIAT 1014
            S +TCYG +  P +     S V IK ET+  LW++D + LA+LK+ENL+LYTEL+L+   
Sbjct: 934  SGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLVTLC 993

Query: 1015 VKEQRYRQILGYTLVSA 1031
            + + R +++LG+ LVS+
Sbjct: 994  MNQDRLKELLGHCLVSS 1010

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/862 (58%), Positives = 645/862 (74%), Gaps = 27/862 (3%)

Query: 182  AIPTSPGGGLRTSSRSALWRQFMSSSS-KLVHYLPATIXXXXXXXXXXXXXXMIIFPITE 240
            +IPT+      T S S  ++  ++  S +++H +PA I              MI+FPIT+
Sbjct: 304  SIPTTTD---VTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITD 360

Query: 241  PIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG 300
             +F HLGP+GLSMFY+STIISQ++YS GFS FP+G+G EMIE+ PFFH+MAL +K+++P 
Sbjct: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420

Query: 301  RD-DEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTG 359
            +D +EI+TTTIFCYVIS + TG+ F+ LGK KLGK+VGFFPRHILIGCIGGVGYFL+VTG
Sbjct: 421  KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG 480

Query: 360  LEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIAT 419
            +EVTTRV KLEY+  F+  + T++S                  Q+ + +SL+LP+FYI T
Sbjct: 481  IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT 540

Query: 420  LVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTML 479
             +AFHF+VA++PN+SL  LR  GWIFPVA S D WY HYK F     HW L+ KQ PTM 
Sbjct: 541  FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF 600

Query: 480  ALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLF 539
            AL+FFGILHVPINVPALA+S+QMDKYDVDKELIAHGYSNL+SG  GS+QNYLVYTNS+LF
Sbjct: 601  ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF 660

Query: 540  IRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKV 599
            IRAG ++A AG +LA  T I++ IGPVIIS+IP+CIVGSLIFLLG+EL+ EAL++T GKV
Sbjct: 661  IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV 720

Query: 600  TNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYR 659
            T FEYITI IIV TMGI+DFVLG++VGILIACFSFLVDSTKLQT+NGE++G +AKSTVYR
Sbjct: 721  TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR 780

Query: 660  DYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDL 719
            DYVQS+FL GI EQIYVLKLQ++LFFGTIISIEEKI+ LLEISD+   SKRRIK LILDL
Sbjct: 781  DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDS-SKRRIKYLILDL 839

Query: 720  KNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDL 779
            KN+N+DNIDYSAAEGFNRIKRFTQSK IQLIISSI +TD IY  F+ V LL++VELF DL
Sbjct: 840  KNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDL 899

Query: 780  NGALEWCENELLFKYKELR----------AKARDRLQNKMQMANLAANNDTKAIDGVPKS 829
            NGALEWCENE L++Y++++          A +RD ++      +++   + +   G    
Sbjct: 900  NGALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSG---- 955

Query: 830  HHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRP 889
                   +LP NTPRN QM+SVA+ +F+N ++ V S   N  +              YR 
Sbjct: 956  -------NLPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRS 1008

Query: 890  GILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGI 949
             I S+D  V++ E+E WS+LCPYFT++ LA+++ LLHN+++FF++E+G+LK+ ++LPQG 
Sbjct: 1009 DIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGS 1068

Query: 950  VYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELI 1009
            VYE++SNRTCYG +L  G    S S + IK ET+ ++W+I+S  L ++K ENL LYTEL 
Sbjct: 1069 VYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELT 1128

Query: 1010 LLIATVKEQRYRQILGYTLVSA 1031
            LL+ +VK+ R+  +LGY L+SA
Sbjct: 1129 LLVMSVKDDRFNNLLGYALISA 1150

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 10/78 (12%)

Query: 75  YGSNSLESDRLPIARMRTKS-IHAAKNLHRQTAKLCEDFNEP--NVEDNNIQDYVSATEE 131
           +G NS  +D LP+     KS IH + NLH++TA++  +FN    + ED+N     + TE 
Sbjct: 113 HGLNS-NNDHLPVINPFPKSSIHGSDNLHKRTAEISNEFNNSPTDTEDDN-----ANTET 166

Query: 132 PR-PMEISDAERMYDQED 148
           P  P     +  + D  D
Sbjct: 167 PNIPSTAQSSNNLNDSND 184

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1037 (52%), Positives = 709/1037 (68%), Gaps = 58/1037 (5%)

Query: 17   SISEAISVSLGLQNTNT--------PRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSG 68
            SISEAISVSLGLQ+ +         PR       +NP+    D   SP + YLGRSYV+ 
Sbjct: 11   SISEAISVSLGLQSQSNSDQDSSYIPR-------ANPFSHTGDG--SP-HYYLGRSYVAN 60

Query: 69   FLSCSPYGS--NSLESDRLPIARM--RTKSIHAAKNLHRQTAKLCEDFNEP-NVEDN--- 120
             LS  P       L  + LP++    +++SIH + +L RQTA L  +F +    ED    
Sbjct: 61   -LSPPPLARLPGGLPGE-LPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAG 118

Query: 121  -NIQDYVSATEEPRPME---ISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESLVTGA 176
             +  D  S T E   M    IS    + D   ++  P +       +   D+    + G 
Sbjct: 119  VSEDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPNAE--HDLEYGSIDGY 176

Query: 177  HGGYRAIPTSPGGG--LRTSSRSALWRQFMSSSSKLVHYLPATIXXXXXXXXXXXXXXMI 234
               Y ++ +   G         ++L  + M ++ ++V+Y+PA I              MI
Sbjct: 177  EHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVILGLLLNILDALSYGMI 236

Query: 235  IFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAI 294
            IFPITEP+FSHLGP+G+SMFYVS+IISQ+IYS GFS F   VGSEMIE+TPF+H+MA +I
Sbjct: 237  IFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASI 296

Query: 295  KDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYF 354
               LPG  D +L+TTI CY +SS++TGL F++LG+++LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 297  VAGLPGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYF 356

Query: 355  LVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNSLVLPT 414
            L++TGLEVTTRVAK EY++ F+S +FT++                   Q  F NSLVLP 
Sbjct: 357  LLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPA 416

Query: 415  FYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQ 474
            FYIA L+ FHF+VA+IP++SL  LR+ GWIFP   S + W+D Y L+    V W +I KQ
Sbjct: 417  FYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQ 476

Query: 475  APTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYT 534
             PTMLAL+FFGILHVPINVPALA+S+ +DK DVDKELIAHGYSN LSG +GS+QNYLVYT
Sbjct: 477  IPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYT 536

Query: 535  NSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIE 594
            NS+LFIRAG D A+AG +LA  TF +M++GPVI++YIP+CIVGSLIFLLGYELL EAL +
Sbjct: 537  NSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYD 596

Query: 595  TRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAK 654
            T GK+ NFEY T+  IV TMG FDFVLG+IVGILIACFSFLVDSTKLQT+NGE+DG++A+
Sbjct: 597  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVAR 656

Query: 655  STVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKC 714
            STV RDY+Q++FL+ IGEQI+VLKLQ+LLFFGTI+SIEEKI+KLLE+S D+ +SK+RIK 
Sbjct: 657  STVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELS-DKDSSKKRIKY 715

Query: 715  LILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
            LILD KNINADNIDYSAAEGFNRIKRFT SK I LIISSI  +D IY AF+KV +L+ VE
Sbjct: 716  LILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775

Query: 775  LFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSHHMQN 834
            LF DLN ALEWCENE L ++K+LR K + +          A     + +  VP       
Sbjct: 776  LFDDLNSALEWCENEFLIQFKDLRNKTKLK----------AGKKQDRRMSKVP------- 818

Query: 835  LMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXYRPGILSE 894
               LPFNTPRN+Q +SVAQ++F +EQ ++  LK +Y+E              +RP I+S 
Sbjct: 819  ---LPFNTPRNNQFVSVAQKLFTDEQ-SMTHLKSSYRERPPVLPLLLSALQRFRPQIMSS 874

Query: 895  DTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESL 954
            D +VK  E  LWS LC YF ++RLA+ S+LLH  +IFFV+ETG++K+ Y+L QG +YE++
Sbjct: 875  DKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETM 934

Query: 955  SNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIAT 1014
            S +TCYG +  P       S V ++ ET+  LW+ID + LA+LK+ENL+LYTE++L+   
Sbjct: 935  SGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLC 994

Query: 1015 VKEQRYRQILGYTLVSA 1031
            + + R +++LG+ LVS+
Sbjct: 995  INQDRLKELLGHCLVSS 1011

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1066 (48%), Positives = 673/1066 (63%), Gaps = 122/1066 (11%)

Query: 54   MSPRNNYLGRSYVSGFLS---------------------CSPYGSNSLESDRLPIARMRT 92
            M   + YLGRSYV  F+S                       P+ S        P +   +
Sbjct: 27   MPTTSTYLGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKS--------PFSSEGS 78

Query: 93   KSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQDYVSATEEPRPMEISDAERMYDQEDELRN 152
            K IH + NLH+QTA L   F+     D      +   ++   +E +D + + +++  L+N
Sbjct: 79   KLIHESGNLHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQMLQN 138

Query: 153  PVH-------------------VNTED----RGDDIE---------------DVYES--- 171
                                  ++ ED    R DD+                DV +S   
Sbjct: 139  SQRRRGRMSVDAAADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTEN 198

Query: 172  ---LVTGAHG---------------GYRAIPTSPGGGLRTSSRSALWRQFMSSSSK---- 209
               L T +H                  + I   P G       S  +R  MS   K    
Sbjct: 199  LALLPTNSHNSMYVEYGTFDEENQPATQYISLLPDGASSGGFTSQGFRSSMSHYDKARDL 258

Query: 210  ---LVHYLPATIXXXXXXXXXXXXXXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYS 266
               +  Y PA                MIIFPITEP+FSHLGP+GLSMFYVST+I Q+ +S
Sbjct: 259  MLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFS 318

Query: 267  SGFSNFPTGVGSEMIEVTPFFHSMALAIKDALP-GRDDEILTTTIFCYVISSLVTGLTFY 325
             G S+FP+ +GSEMIE+TPFFH+MAL+I +++P G D+++++TTI CY +SS++TGLTF+
Sbjct: 319  LGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLTFF 378

Query: 326  VLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSX 385
            +LGKM+LGKIVGFFPRHILIGCIGGVGYFL++TGLEV TRV + +Y+W F+S +FTD   
Sbjct: 379  LLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDI 438

Query: 386  XXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIF 445
                             Q    NSLVLP+FYI TL+ FHFVVA++P++SL KLR+ GWIF
Sbjct: 439  LLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIF 498

Query: 446  PVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKY 505
                +K+ WYD YKL+    V W LI KQ PTMLAL+FFGILHVPINVPALA+SL +DKY
Sbjct: 499  AKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKY 558

Query: 506  DVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGP 565
            DVDKELIAHGYSNL+SG LGSIQNYLVYTNS+LFIRAGADS +AG +L   TFI+MVIGP
Sbjct: 559  DVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGP 618

Query: 566  VIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIV 625
            VIIS+IPICIVGSLIFLLGYEL+ EA+I+T GK+  FEY+TI IIV+TMG+ DFV+G+IV
Sbjct: 619  VIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIV 678

Query: 626  GILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFF 685
            GIL+ACFSFLV+ST+LQTINGEYDGK+AKSTVYRDY+QS+FL  IGEQIYVLKLQ++LFF
Sbjct: 679  GILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFF 738

Query: 686  GTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSK 745
            GTIISIEEK+N LLEI +   +SK+RIK LILD KNI A +IDYSAAEGFNRIKRF + +
Sbjct: 739  GTIISIEEKVNSLLEICESD-SSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKE 797

Query: 746  HIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRL 805
             I LIISSI + D IY AF KV+L ++VELF DLNGALEWCENE L +YK +R K R R 
Sbjct: 798  RIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRAR- 856

Query: 806  QNKMQMANLAANNDTKAIDGVPKSHHMQNLMS-LPFNTPRNDQMLSVAQRVFKNEQKTVD 864
                ++A L  +               QN MS LP NTPRN Q +S  + ++  E+  + 
Sbjct: 857  ----KLAQLKKS---------------QNRMSKLPVNTPRNHQFVSEVRNIY-TEEMEIQ 896

Query: 865  SLKVNYKEXXXXXXXXXXXXXXYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSIL 924
             L    KE              +R  I S +   + +EL+LW +L  YF +++    + +
Sbjct: 897  KLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEI 956

Query: 925  LHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEV 984
             H +++F V+E+G+L + + L QG  YE++S +T YG++ N  + P +   V+I T+TE 
Sbjct: 957  RHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVISNVNSDPLA---VSITTDTEC 1013

Query: 985  VLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVS 1030
            VL  ID+  LA LK  +  L+TEL++L+  +   R+R++LGY+L+S
Sbjct: 1014 VLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1044 (48%), Positives = 669/1044 (64%), Gaps = 72/1044 (6%)

Query: 17   SISEAISVSLGLQNTNTPRDHHDG-NHSNPYDSQNDQFMSPRNNYLGRSYV-----SGFL 70
            SISEA+++ L     N P     G N   P   +    M P   YLGRSYV     SG L
Sbjct: 15   SISEALNIQL-----NIPDSPSGGANAGGPVSERIPTLMRPEA-YLGRSYVGSFSNSGSL 68

Query: 71   SCSPYGSNSLESDRLPIARMRTKS-IHAAKNLHRQTAKLCEDFNE----PNVEDNNIQDY 125
                 G+   +S  LP  R +  S +H   +LHRQTA LC+D       P  E+  + + 
Sbjct: 69   MSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEG 128

Query: 126  VSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYES--------LVTGAH 177
                +E  P           + D   + V +N ++  DD +   E+        + T   
Sbjct: 129  NMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYI 188

Query: 178  GGYRAIPTSPGGGLRTSSRSA-------LWRQFMSSSSKLVHYLPATIXXXXXXXXXXXX 230
              Y AI         T+SR+        LW       ++ V Y+PA I            
Sbjct: 189  HSYGAINEEQSAS-ETASRAETGPSPLRLW------GTRTVRYIPAVILGLLLNILDALS 241

Query: 231  XXMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSM 290
              MIIFPI EPIFSHLGP GLSMFYVSTIISQ++YS GFS+F  G GSEMIEVTPFFH+M
Sbjct: 242  YGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTM 301

Query: 291  ALAIKDALPG-RDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIG 349
            AL+IK++L   + D+I+TTTI CY +S+++TG  F  LGK++LGK+V FFP HILIGCIG
Sbjct: 302  ALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIG 361

Query: 350  GVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNS 409
            GV YFL++TG+EV+TRV K EY+  F+ ++F D                    QR   NS
Sbjct: 362  GVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNS 421

Query: 410  LVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWG 469
            ++LP FY++    FHF+VA+IP++SL  LR+ GWIFP+  S  +WYD+ +L+ P R+HW 
Sbjct: 422  MLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWE 481

Query: 470  LIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQN 529
            L+  + PTMLAL+FFGILHVPINVPALAIS  +DK DVDKELIAHGYSN+ SG  GSIQN
Sbjct: 482  LVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQN 541

Query: 530  YLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLY 589
            YLVYTNS+LFIRAGADS  AG+LLA  TF+ M  GP IIS IP+CIV SLIFLLGYELL 
Sbjct: 542  YLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLK 601

Query: 590  EALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYD 649
            E L ++  +++NFEYIT+ II+LTMGIFDFVLG+IVG+L+ACFSFLV+ST+ +TI+ E+D
Sbjct: 602  EVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFD 661

Query: 650  GKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSK 709
            GK+AKS  +RDY+QS FL+ + EQIYVLKLQ+ LFFGTIISIEEKI  LLE +  +   K
Sbjct: 662  GKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEY--K 719

Query: 710  RRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKL 769
            + IK LILD K+IN DNIDYSAAEGFNRIKR  + K I+LI+SSISE D IYT FSK+ L
Sbjct: 720  KIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGL 779

Query: 770  LDDVELFGDLNGALEWCENELLFKYKELRAKA-RDRLQNKMQMANLAANNDTKAIDGVPK 828
            L DVELF DLN ALEWCENELL +Y+ L ++A R +++ + +             D VPK
Sbjct: 780  LQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSK-------------DIVPK 826

Query: 829  SHHMQNLMSLPF-NTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKEXXXXXXXXXXXXXXY 887
            +        +P  NTPRN Q+++ AQ V+  EQ+   +L   YK               Y
Sbjct: 827  AQ-------IPLENTPRNAQIMTAAQAVYSGEQQLNKTLS-KYKASHPALALLLVALKTY 878

Query: 888  RPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQ 947
            R G   ++T     E+ LW  LCPYF R+  + Q+ +    D+FFV+E+G+LKI Y LPQ
Sbjct: 879  RSGHAYKETK----EIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQ 934

Query: 948  GIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTE 1007
            G + E+++++TCYG +  PG+   S     ++TETE VLW+ID+  L +L++ENL LYTE
Sbjct: 935  GSLQEAIASKTCYGNISGPGSLSYSS---VVRTETECVLWMIDAPGLQKLQEENLPLYTE 991

Query: 1008 LILLIATVKEQRYRQILGYTLVSA 1031
            L+++  +V + R++++LG++L++ 
Sbjct: 992  LLVVYISVIQHRFKELLGHSLING 1015

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 129/287 (44%), Gaps = 26/287 (9%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  NL +  LG++  +  Y  S +   +GA + M+G  +  +  + +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEY---ITICIIVLTMGIFDFVLGVI 624
           I YIP+CI+  +  ++G  LL EA  + R    +  Y   +   + VLT   +   +GV 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 625 VGILIACFSFLVDSTK--LQTI-----NGEY---DGKIAKSTVYRDYVQSRFLDGIGEQI 674
           +G   +  S +  S K  +Q +      G++   D  ++ +T   D      L+G     
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG----C 560

Query: 675 YVLKLQSLLFFGTIISIEEKINKLLE-----ISDDQKNSKRR--IKCLILDLKNINADNI 727
            V+K+   L F  +  ++E++ +L       +    K S+ R  IK L+ DL  +    +
Sbjct: 561 LVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF--M 618

Query: 728 DYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
           D SAA+    I +    + +++ ++ +   + + +      +L+ VE
Sbjct: 619 DSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 138/291 (47%), Gaps = 32/291 (10%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G+ N++    G++ ++  Y  S +   +GA S M+G  +  +T I M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGI 627
           + YIP C++  +  ++G  LL E   + +  +    Y  + +  +T G+   +  +  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 628 LIACFSFLVD------STKLQTINGEYDGKIAKSTVYR---DYVQSRFLDGIG------- 671
            I C   +++       +++Q +      ++A ++ +    DY+++   + +G       
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQIL-----ARVAGTSNFTNLDDYLRTMKKNPLGGENRLEE 571

Query: 672 -EQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN-------SKRRIKCLILDLKNIN 723
            E   ++++   L F     ++++++++      + +       SK  IK +I DL  + 
Sbjct: 572 VEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMT 631

Query: 724 ADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
           +  ID SAA+  + I    + +++ + ++++S  D I T   K  ++ ++E
Sbjct: 632 S--IDSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 117/598 (19%), Positives = 223/598 (37%), Gaps = 103/598 (17%)

Query: 265 YSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG-----------------RDDEILT 307
           Y++  ++     G   +  TPFF+++  ++   + G                 R D  L+
Sbjct: 132 YATSIAHVEPLCGLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLS 191

Query: 308 TTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVA 367
           +   C +I+  ++G+  +  G  + G +     R  L G I  VG  +V+  L V  ++ 
Sbjct: 192 SLDLCVIIT-FISGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLK 250

Query: 368 KL------EYTWPFIS------------HMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNS 409
           K+       Y  PF              H+ T +                    + F++ 
Sbjct: 251 KVFDDAPSHYHSPFEKVLFLIKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSL 310

Query: 410 LVLPTFYIATLVAFHF-------------VVAIIPNVSLGKLRNMGWIFPVAASKDQWYD 456
           +  P   +  +    F             VV  I      KLRN     P++ +K  +Y 
Sbjct: 311 VFFPEILLVVVTVIFFSYNFDLKHRYNIEVVGDIEASVFDKLRN-----PLSKNKRPFYG 365

Query: 457 HYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGY 516
              LF             A  M+A+   G         +L  +  +     ++EL+A G 
Sbjct: 366 --DLFS------------AGFMVAM--LGFFESTTASKSLGTAYDL-AVSSNRELVALGS 408

Query: 517 SNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIV 576
            NL+    G++ ++  Y  S +   +GA + ++G  +  +T   +      I YIP+C++
Sbjct: 409 LNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVL 468

Query: 577 GSLIFLLGYELLYEALIETRGKVTNFEY---ITICIIVLTMGIFDFVLGVIVGILIACFS 633
             +  ++G  LL EA  + R  +    Y   I+  I VLT   +    G+ VG   +   
Sbjct: 469 SVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIR 528

Query: 634 FLVDSTK-----LQTING--------EYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQ 680
            +  STK     L  + G        EY+GK + S   R   Q   ++G      ++++ 
Sbjct: 529 VIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSE-RRVNPQLEEIEG----CLIVRIP 583

Query: 681 SLLFFGTIISIEEKINKL-------LEISDDQKNSKRRIKCLILDLKNINADNIDYSAAE 733
             L F     ++ ++N+L          +  +   +   K +I DL  +    ID SA +
Sbjct: 584 EPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDSSAIQ 641

Query: 734 GFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELL 791
               I    + +H+ + +  +     +   F    +L+ VE   D++ +L     ++L
Sbjct: 642 ILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSLLPSAQQML 697

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 122/279 (43%), Gaps = 31/279 (11%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  NL+    G++ ++  Y  S +   +GA + M+G  +  +T   +     +
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEY---ITICIIVLTMGIFDFVLGVI 624
           I Y P+CI+  +  ++G  LL EA  + R  +    Y   I   +I +T  I     G+ 
Sbjct: 444 IHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGIS 503

Query: 625 VGIL--------------IACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGI 670
           VG +              I   + ++ + +   ++G Y G     T+  D  +S  L+ +
Sbjct: 504 VGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG---LKTI--DLRESSALEEL 558

Query: 671 GEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRR-------IKCLILDLKNIN 723
            +   ++K+   L F     ++E++N+L      + +  RR       IK +I +L  + 
Sbjct: 559 DDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGMT 618

Query: 724 ADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYT 762
           +  +D SAA+    I +  + + + +    +S    I T
Sbjct: 619 S--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRT 655

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 127/283 (44%), Gaps = 31/283 (10%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  N+++   G++ ++  Y  S +   +G+ + M+G  +  +T I +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIET----RGKVTNFEYITICIIVLTMGIFDFVLGV 623
           I YIP+CI+  +  ++G  LL EA  E     R K  + E     I VL   ++   +G+
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYD-ELFVFAITVLATLLYSVEMGI 510

Query: 624 IVGILIACFSFLVDSTKLQ-TINGEYDGKIAKSTVYRDYVQSRFLDGIG----------- 671
            +G   +  S +  S K +  I G   G    + +  +Y+ S   D IG           
Sbjct: 511 CIGCGYSIISIVKHSAKSRIQILGRVQGTREFANI-DEYLDS---DPIGDIETNKFVLEE 566

Query: 672 -EQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN-------SKRRIKCLILDLKNIN 723
            E   ++K+   L F     ++E++N+L      + +       SK   KC+I DL  + 
Sbjct: 567 IEGCLIVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMT 626

Query: 724 ADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSK 766
           +  ID SA + F  I    + + +++ ++ + ++  I     K
Sbjct: 627 S--IDSSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEK 667

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 136/287 (47%), Gaps = 25/287 (8%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G+ N++    G++ ++  Y  S +   +GA S ++G  +  +T I M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGI---FDFVLGVI 624
           + YIP C++  +  ++G  LL E   + +  +    Y  + +  +T G+   +    G+ 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 625 VGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYR---DYVQSRFLDGIG-------EQI 674
           +G + +  + +  S K +    +   ++A ++ +    DY+ +   + +        E  
Sbjct: 518 IGCVYSILNIIKHSAKSRI---QILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGC 574

Query: 675 YVLKLQSLLFFGTIISIEEKINKLLEISDDQKN-------SKRRIKCLILDLKNINADNI 727
            ++++   L F     ++++++++      + +       SK  IK +I DL  + +  +
Sbjct: 575 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--L 632

Query: 728 DYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
           D SAA+  + I    + +++ + ++++S  D I T  SK  ++ +VE
Sbjct: 633 DSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/347 (19%), Positives = 159/347 (45%), Gaps = 41/347 (11%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  N+     G++ ++  Y  S +   +GA S M+G  +  +T I M +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGI---FDFVLGVI 624
           + YIP C++  +  ++G  LL E   + +  +    Y  + +  +T G+   +    G+ 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 625 VGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYR---DYVQSR-----FLDGIGEQI-- 674
           +G + +  + +  S K +    +   +IA ++ +    DY+++       ++G  E+I  
Sbjct: 518 IGCVYSILNIIKHSAKSRI---QILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEG 574

Query: 675 -YVLKLQSLLFFGTIISIEEKINKLLEISDDQKN-------SKRRIKCLILDLKNINADN 726
             ++++   L F     ++++++++      + +       SK  IK +I DL  + +  
Sbjct: 575 CMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS-- 632

Query: 727 IDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELF------GDLN 780
           ID SAA+  + I    + +++ + ++++S  D I T   K  +  +VE        G+ +
Sbjct: 633 IDSSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVERVQTSINEGNTS 692

Query: 781 GALEWCE-------NELLFKYKELRAKARDRLQNKMQ--MANLAANN 818
           GA +          +  L++ ++++ K  +   N  +  M+N   N+
Sbjct: 693 GACDGSSSPYFDSIDAALYEVEKMKTKGNNTQNNDSESFMSNTLFNS 739

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 159/415 (38%), Gaps = 72/415 (17%)

Query: 265 YSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG-----------------RDDEILT 307
           YS+  ++ P   G   +  TPF +++  ++   + G                 + D+ L 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 308 TTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVA 367
               C +++  ++G   +  G M+ G +     R +L G I  VG  +V+  L    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 368 KL------EYTWPFIS------------HMFTDVSXXXXXXXXXXXXXXXXXXQRHFQNS 409
           K+       Y  PF              H+ T +                    R ++  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 410 LVLPTFYIA----TLVAFHFV------VAIIPNVSLG---KLRNMGWIFPVAASKDQWYD 456
           + +P   I     TL ++HF       + I+ ++ +G   K RN     P+  SK     
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRN-----PL--SKKNLSL 336

Query: 457 HYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGY 516
             +LF     H G        M+AL   G         +L  S ++     ++EL+A G 
Sbjct: 337 FSELF-----HAGF-------MVAL--LGFFESTTASKSLGSSYELS-VSSNRELVALGS 381

Query: 517 SNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIV 576
            NL+    G++ ++  Y  S +   +GA + M+G  +  +T +  +     I +IP+C++
Sbjct: 382 LNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVL 441

Query: 577 GSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIAC 631
             +  ++G  L  EA  + R       Y  + I  LT+ +  F   V  GI + C
Sbjct: 442 SVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGITLGC 495

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 1/124 (0%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  NL S  LGS+  +  Y  S +   +GA + M+G  +  L  + +     +
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGI 627
           I YIPIC++  +  ++G  LL EA  +       F Y  + +  LT+ +      V VGI
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTV-LTTMFYSVEVGI 511

Query: 628 LIAC 631
            I C
Sbjct: 512 CIGC 515

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 134/330 (40%), Gaps = 40/330 (12%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  NL+    G++ ++  Y  S +   +GA + M+G  +  +T I        
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIET----RGKVTNFEYITICIIVLTMGIFDFVLGV 623
           I +IPIC++  +  ++G  L  EA  +     R +  N E +T  I VLT     F   V
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYN-ELLTFAITVLTT----FFYSV 502

Query: 624 IVGILIACFSFLVDSTKLQTING-EYDGKIAKSTVYRD----YVQSRFLDGIG------E 672
             GI + C   ++ + K  T +G +  G+I+ +  + +    Y  S      G      E
Sbjct: 503 EAGITLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHME 562

Query: 673 QIYVLKLQSLLFFGTIISIEEKINKL-------LEISDDQKNSKRRIKCLILDLKNINAD 725
              V ++   L F     ++ ++N+L          +  +   K   + +I DL+ +   
Sbjct: 563 GCLVARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT-- 620

Query: 726 NIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGAL-- 783
            ID SA++    I +    + +++ ++ +    H+        +   VE    LN A   
Sbjct: 621 QIDSSASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMG 680

Query: 784 ----EWCENELLFKYKELRAKARDRLQNKM 809
                WC     FK  +   K  D L   M
Sbjct: 681 QPGDSWC-----FKSIQEALKMCDELAPNM 705

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/391 (20%), Positives = 150/391 (38%), Gaps = 38/391 (9%)

Query: 281 IEVTPFFHSMALAIKDALPGRDD----------EILTT------TIFCYVISSLVTGLTF 324
           + VTPF +++  ++   + G +           E LT+      T+    + S ++GLT 
Sbjct: 123 LAVTPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTL 182

Query: 325 YVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHM-FTDV 383
              G  +LG +     + +L G I  +G+ ++V  L    ++ KL  T P   H  F  +
Sbjct: 183 LFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKI 242

Query: 384 SXXXXXXXXXXXXXXXXXXQRHFQNSLVLPTFYIATLVAFHFVV-------AIIPNVSLG 436
                                 F   + +  F    +    ++V        +I ++ L 
Sbjct: 243 LFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMMRRIKWIVFIPEILSVVIFSIVLS 302

Query: 437 KLRNMGWIFPVAASKDQWYDHYKLFQP--HRVHWGLIAKQAPTMLALSFFGILHVPINVP 494
            + ++   + ++   D   D +  F+    + + GLI       L  +  G L       
Sbjct: 303 YMCDLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLIPALRDVSLVSALLGFLE------ 356

Query: 495 ALAISLQMDKY-----DVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMA 549
           ++  S  +  Y       ++EL+A G  N +  A G I  +  Y  S +   +GA + MA
Sbjct: 357 SITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMA 416

Query: 550 GYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICI 609
           G  +  +T   +     +I YIP C++  +   +G  LL EA  + +  +    Y  + +
Sbjct: 417 GVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIM 476

Query: 610 IVLTMGIFDFVLGVIVGILIACFSFLVDSTK 640
            VLT     F   +  GIL  C   L+   K
Sbjct: 477 FVLTFLCTCFY-SIEFGILAGCTYSLISIVK 506

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 98/203 (48%), Gaps = 11/203 (5%)

Query: 505 YDVD----KELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIM 560
           +D+D    +EL++ G  N++     S+  +  Y  S L I  GA + MAG  ++      
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 561 MVIGPVIISYIPICIVGSLIFLLGYELLYEALIET--RGKVTNF-EYITICIIVLTMGIF 617
           M     +  Y+P+CI+  +I  + Y LL E   +      V+ + E IT   +VL+  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 618 DFVLGVIVGILIACFSFLVDST--KLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIY 675
               G+++G+ +     L  +T  ++Q +  +   K  ++ +Y ++ +   L+ I E+  
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRN-IYSEHNEEIPLEEI-EKTM 520

Query: 676 VLKLQSLLFFGTIISIEEKINKL 698
           V+K+   L F  +  + +K+ +L
Sbjct: 521 VIKVPEPLVFWNVPDLMKKVKRL 543

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 118/269 (43%), Gaps = 18/269 (6%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++ELIA G  N++      +  +  Y  S +   +GA + M+G+ +  +T   +     I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 568 ISYIPICIVGSLIFLLGYELLYEAL--IETRGKVTNFEYITICIIVLTMGIF-DFVLGVI 624
           I YIP+CI+  +  ++G  LL EA   ++   +   +  +T+  + L   +F     G+ 
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIY 496

Query: 625 VGILIACFSFLVDSTKLQ-TINGEYDG--KIAKSTVYRDYVQSRFLDGIGEQI---YVLK 678
           +G   +  + +  S K +  I G   G      +  Y+      F++   E+I    ++K
Sbjct: 497 IGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEIEGFLIVK 556

Query: 679 LQSLLFFGTIISIEEKINKL-------LEISDDQKNSKRRIKCLILDLKNINADNIDYSA 731
           +   L F     ++ ++++L          +  +   K   + +I D+K +   +ID SA
Sbjct: 557 IAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HIDSSA 614

Query: 732 AEGFNRIKRFTQSKHIQLIISSISETDHI 760
           A+    I      + + + ++++  T+ +
Sbjct: 615 AQTLEEILSAYNRRDVHVFLTNVPLTEKV 643

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 131/287 (45%), Gaps = 25/287 (8%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G+ N++    G++  +  Y  S +   +GA S M+G  +  +T I M +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 568 ISYIPICIVGSLIFLLGYELLYEAL--IETRGKVTNFEYITICIIVLTMGIF-DFVLGVI 624
           + YIP C++  +  ++G  LL E    I+   +   F  + +  +     IF     G+ 
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGIC 527

Query: 625 VGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYR---DY---VQSRFLDGIG----EQI 674
           +G + +  + +  S K +    +   ++A ++ +    DY   ++   LD  G    E  
Sbjct: 528 IGCVYSIINIIKHSAKSRI---QILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGC 584

Query: 675 YVLKLQSLLFFGTIISIEEKINKL-----LEISDDQKN--SKRRIKCLILDLKNINADNI 727
            ++++   L F     ++++++++      +I   +K+  SK  IK +I DL  + +  I
Sbjct: 585 MIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--I 642

Query: 728 DYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
           D SAA+    I    + +++ + + ++S  D +     K  +   VE
Sbjct: 643 DSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/288 (19%), Positives = 127/288 (44%), Gaps = 21/288 (7%)

Query: 505 YDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIG 564
           Y  ++ELIA G+ N++    G++ ++  Y  S + + +G  + M+G ++  +T +   + 
Sbjct: 374 YSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLL 433

Query: 565 PVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVI 624
             +I Y P C++  +  ++G  LL E   + +  +    Y  + +  LT  I      V 
Sbjct: 434 LPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVE 492

Query: 625 VGILIACFSFLVDSTKLQTING-EYDGKIAKSTVY---RDYVQS---RFLDGIG----EQ 673
           +G+ + C   L+   K   ++  +   K+  S  +    DY+++   R  + I     E 
Sbjct: 493 LGVTVGCIYSLILIVKHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENITLEQFEH 552

Query: 674 IYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN-------SKRRIKCLILDLKNINADN 726
            Y++K+   L F     +  ++++L        +       S+  ++ +I DL+ + +  
Sbjct: 553 CYIVKIPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS-- 610

Query: 727 IDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVE 774
           +D  +A+    I R    + +++ ++ +S    I        +LD VE
Sbjct: 611 MDSGSAQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G SN++   LG++ ++  Y  S +   +G  + ++G  +   T + ++    +
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLT 613
           I YIP+CI+  +  ++G+ LL E   E         Y  + +IVLT
Sbjct: 473 IHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNELFLIVLT 518

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 66/136 (48%), Gaps = 3/136 (2%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL++ G  NL+S    ++  +  Y  S + I  GA +  +G  ++ L  I M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETR--GKVTNFEYITI-CIIVLTMGIFDFVLGVI 624
             ++PICI+  +I  + + LL EA  +      V  ++ + I  IIV+T  ++    GV 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 625 VGILIACFSFLVDSTK 640
           +G+ +     L  ST+
Sbjct: 392 MGMCLTMIRLLKHSTR 407

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 96/204 (47%), Gaps = 9/204 (4%)

Query: 503 DKYDVD----KELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTF 558
           +K+D+D    +EL++ G  N++S    ++  +  Y  S L I   A + MAG +++    
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 559 IMMVIGPVIISYIPICIVGSLIFLLGYELLYE--ALIETRGKVTNF-EYITICIIVLTMG 615
             M        Y+P+C++  +I  + Y LL E  + +     V  + E +T   +V+T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 616 IFDFVLGVIVGILIACFSFLVDSTKLQT-INGEYDGKIAKSTVYRDYVQSRFLDGIGEQI 674
           ++    GV +G+ +     L  +T+ +  I G          +Y +  +   L+ I E+ 
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-EKT 519

Query: 675 YVLKLQSLLFFGTIISIEEKINKL 698
            V+K+   L F  +  +++++++L
Sbjct: 520 MVIKIPEPLIFSNVSDLKKRLSRL 543

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 5/126 (3%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  NL +  LG + ++  Y  S +   +GA + M+G ++  +T + +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETR--GKVTNFEYITICIIVLTMGIFDFVLGVIV 625
           I +IP C++  +  ++G  L+ EA  E +   +   +  + I  +     IF     V V
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYNELIIFFMTACGTIF---FSVEV 544

Query: 626 GILIAC 631
           GI+I C
Sbjct: 545 GIIIGC 550

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 106/253 (41%), Gaps = 34/253 (13%)

Query: 508 DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567
           ++EL+A G  N++    G++  +  Y  S +   +G  + M+G  L  +T   +     +
Sbjct: 363 NRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPV 422

Query: 568 ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGI 627
           +   P C++  +  ++G  LL EA  + +    +  Y  + ++ LT  I      V VGI
Sbjct: 423 VHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF-ITTIFYSVEVGI 481

Query: 628 LIACFSFLVD------STKLQTIN--------------GEYDGKIAKSTVYRDYVQSRFL 667
            + C   ++        +++Q +               G +DG+   +  + +      L
Sbjct: 482 CVGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PLL 537

Query: 668 DGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRR-------IKCLILDLK 720
           + + E   V+K+   L F     ++E++++L      + +  RR        K +I DL 
Sbjct: 538 EDLDEDRLVVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLH 597

Query: 721 NINADNIDYSAAE 733
            +    ID SAA+
Sbjct: 598 GMTY--IDASAAQ 608

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 18/91 (19%)

Query: 694 KINKLLEISDDQKNS----------KRRIKCLILDLKNINADNIDYSAAEGFN------- 736
           K+ KL +I  D ++S          K RIK L   LK   A N+D++  E  +       
Sbjct: 130 KLTKLYQIDGDTRSSTAAEGGVVESKNRIKLLTKILKKYQAINVDFTQLESSDDLNNVQP 189

Query: 737 RIKRFTQSKHIQLIISSISETDHIYTA-FSK 766
           + +R  Q   + + IS+I + DHI +  FSK
Sbjct: 190 KFRRKQQVGTLNIAISAIRDVDHIQSPMFSK 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,321,642
Number of extensions: 4337891
Number of successful extensions: 14787
Number of sequences better than 10.0: 62
Number of HSP's gapped: 15092
Number of HSP's successfully gapped: 72
Length of query: 1031
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 911
Effective length of database: 39,721,479
Effective search space: 36186267369
Effective search space used: 36186267369
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)