Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D055203.483ON57357330220.0
Kpol_480.193.483ON57457126720.0
KNAG0A079203.483ON57857726350.0
SAKL0F02970g3.483ON57357326330.0
CAGL0I10648g3.483ON57457226270.0
KAFR0G036703.483ON57257226250.0
YPR145W (ASN1)3.483ON57257226130.0
Skud_16.4393.483ON57257226100.0
NCAS0F035103.483ON57557226070.0
NDAI0B058103.483ON57757526050.0
Suva_16.4743.483ON57257126010.0
Smik_16.3963.483ON57257125970.0
KLLA0B10868g3.483ON57457125900.0
Kwal_55.211873.483ON57357125820.0
Suva_7.4103.483ON57257125700.0
Smik_6.2203.483ON57257125700.0
KLTH0F14630g3.483ON57357125630.0
Skud_7.4353.483ON57257125540.0
YGR124W (ASN2)3.483ON57257125440.0
ZYRO0B04136g3.483ON57257325280.0
TPHA0D042003.483ON57457125160.0
AFR303W3.483ON57157325110.0
TBLA0C044303.483ON58057824940.0
Ecym_12443.483ON57357124130.0
KNAG0J002008.875ON5154221474e-09
ZYRO0A00528g8.875ON5121031421e-08
Kpol_455.78.875ON5181051322e-07
KLLA0D10285g8.875ON5151131295e-07
Skud_13.468.875ON5191081233e-06
Suva_13.528.875ON519861214e-06
TPHA0C049508.875ON525891206e-06
KAFR0L021108.875ON514951181e-05
ADL350C8.875ON508891171e-05
YML096W8.875ON525951171e-05
Smik_13.398.875ON521961162e-05
NCAS0C001908.875ON517931152e-05
TDEL0B004408.875ON516821134e-05
NDAI0K001808.875ON522821134e-05
SAKL0D00352g8.875ON515871117e-05
TBLA0C063008.875ON518821101e-04
Ecym_81558.875ON5131131092e-04
Kwal_27.97058.875ON515931082e-04
CAGL0H06963g8.875ON517931072e-04
Skud_7.311singletonON8189910.001
KLTH0E16412g8.875ON515951000.001
TPHA0J004906.40ON435166714.5
SAKL0A08910g2.512ON603114706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D05520
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1168   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1033   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1019   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1018   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1016   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1015   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1011   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1009   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1008   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...  1008   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1006   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1004   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1002   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   999   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   994   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   994   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   991   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   988   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   984   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   978   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   973   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   971   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   965   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   934   0.0  
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    61   4e-09
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   1e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    55   2e-07
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    54   5e-07
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    52   3e-06
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    51   4e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    51   6e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   1e-05
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   1e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    50   1e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    49   2e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   2e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   4e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    48   4e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    47   7e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    47   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    46   2e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    46   2e-04
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    40   0.001
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    43   0.001
TPHA0J00490 Chr10 (109600..110907) [1308 bp, 435 aa] {ON} Anc_6....    32   4.5  
SAKL0A08910g Chr1 (780195..782006) [1812 bp, 603 aa] {ON} highly...    32   6.0  

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/573 (97%), Positives = 561/573 (97%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573
           ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/571 (84%), Positives = 526/571 (92%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+ +A+K +ALQLSKRIRHRGPDWSGNV++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCG+Y LCVNGEIYNHI+LRE   DYK+ TLSDCEPIIPLY K+DID PKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAK+DRIIAARDP+GITTLYMGRNS SPKTVFFASELKCLTDDCD+I+AFPPGH+
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE RIP+ PV YKAIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETEKA  E+D   YDSEDKHL GIDD GNLH+AGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMIN  EGR+EKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISD++F+ PK  WG D+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A+TVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/577 (82%), Positives = 530/577 (91%), Gaps = 4/577 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFA  +HEDVQA+K +ALQLSKRIRHRGPDWSGN+++N+T++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCG+Y L VNGEIYNHI+LREE  +Y++ +LSDCEPIIP+Y KYD+D PK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAK+DRI+AARDP+GITTLYMGR+S+ PKTVFFASELKCLTDDCDNI+AFPPGH+
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDET+IPS PVD K IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYD----SEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPG 296
             IA+IAARETEKAN E+D +KYD    +E  HLAGIDD GNL SA WSRLHSFAIGLPG
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKI 356
           APDL AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILW 476
           LEARVPFLD+EFL LCMNIDPKDK+IN++EGR+EKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAE VISD++FAAPK+ WG DVPTTKEAFWYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573
           Q TAA+TVMRW+PKADWGCAEDPSGRFA+IH+QHV++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/573 (83%), Positives = 516/573 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFA +KHE VQ +K KALQLSKRIRHRGPDWSGNV++N T+L HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHIKLREE + Y F TLSDCEPIIPLY+KYDIDTPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAK+DRIIAARDP+GITTLYMGR+S SP TVFFASELKCL DDCD I AFPPGH+
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE RIP  P+DYK IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKAN ++D   YD EDKHLAG+DD GNLH+AGWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFI SIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP +KMIN+ EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ FA PK  WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573
           A TVMRW+PKADWGCAEDPSGR+A+IH+QH++N
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/572 (84%), Positives = 523/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA+KH+DV A+K KALQLSKRIRHRGPDWSGNV++N+T++VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHI+LRE+F DYKF TLSDCEPIIP Y ++DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAKQDRI+AARDPVGITTLYMGR S SPKTVFFASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTD+ITRYFTPDW+DE+RIP+ PV++K IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYD-SEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPD 299
             IASIAARETEKAN E DA   D S  K LAGID+ G+LH+AGWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L+AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDPKDKMI++  GR+EKYILRKAFDT+DEPDVKPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAERVISD +F+ PK  WG+D+PTTKEA+WYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           AA TVMRW+PKADWGCAEDPSGR+A+IH+QHV
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 524/572 (91%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA +HEDV ++K KALQLSKRIRHRGPDWSGNV++N+T++VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCGNYTLCVNGEIYNHI+LRE+F DYKF TLSDCEPIIPLY + DID PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYD+K+DRI+AARDP+G+TTLYMGR+S+SPKTVFFASELKCL DDCD+IVAFPPGHI
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+ PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETE AN E+DA +Y  E  HLAGIDD G+L ++GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGSIHHEHTFTLQEG+DALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP DK+IN++EGR+EKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAE+VISD++FA PKS WG D+PTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVK 572
           A+TVMRW+PKADWGCAEDPSGR+AQIH++H++
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 517/572 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA +HEDV  YK KALQLSKRIRHRGPDWSGN ++N+T+ VHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G Y LCVNGEIYNHI+LREE +DY+F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAKQDRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARET KA  +++   YDS+ +HLAGIDD G LH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMI  +EGR+EKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE VISD++FA+PK+ WG D+PTTKEAFWYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVK 572
           ADTVMRW+PKADWGCAEDPSGR+AQIH++H++
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/572 (82%), Positives = 516/572 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA+KHEDV  YKQKALQLSKRIRHRGPDWSGN  +N+T+ VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  DY+F TLSDCEPIIP+Y K+DI+ PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAKQDRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  +++   YDS+ +HLAG+DD GNLH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPK+KMI  +EGR+EKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE VISD++FA+PK+ WG D+PTTKEAFWYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVK 572
           ADTVMRWVPKADWGCAEDPSGR+AQIH++H++
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 522/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA +HEDV+AYK KALQL+KRIRHRGPDWSGNV++N T+L HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCGNYTLCVNGEIYNHI++REE +DY+F TLSDCEPIIPLY KYD+D PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAKQDRI+AARDP+GITTLYMGR S +P+TV+FASELKCLTDDCD+IVAFPPGH+
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPS PVD KAIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSED-KHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPD 299
             IASIAARETEKA  ++D +  + E  KHL G+DD G+LH+ GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L+AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDPKDKMI++  G++EKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAERVISD +F  PK  WG+DVPTTKEA+WYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           AADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/575 (82%), Positives = 520/575 (90%), Gaps = 4/575 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHEDV A+K +ALQLSKRIRHRGPDWSGNV++N T+L HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCGNYTLCVNGEIYNHI++RE+F DY F TLSDCEPIIPLY K+DIDTPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYD+KQDRIIAARDP+GITTLYMGRNS +P+TVFFASELKCLTDDCD+I+AFPPGH+
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE RIP N +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDK----HLAGIDDSGNLHSAGWSRLHSFAIGLPG 296
             IASIAARETEKANA+      ++ D+    HL G+DD G+LH+ GWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKI 356
           APDL+AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILW 476
           LEARVPFLDR+FLQLCMNIDPK+KMIN+ EGR+EKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAERVISD +F  PK  WG D+PTTKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           QKTAADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 575

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/571 (82%), Positives = 515/571 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHEDV  YK KALQLSKRIRHRGPDWSGN ++N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  DY+F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAKQDRIIAARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARET KA  +++   YD++ +HLAG+DD GNLH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMI  +EGR+EKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAE VISD++FA PK+ WG+D+PTTKEA+WYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           ADTVMRWVPKADWGCAEDPSGR+AQIH++H+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 514/571 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHEDV  YK KALQLSKRIRHRGPDWSGN ++N+T+ VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  +Y+F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAKQDRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  ++D   YDS+ +HLAG+DD G LH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP +KMI  +EGR+EKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE VISD++FA+PK+ WG D+P+TKEAFWYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           ADTVMRW+PKADWGCAEDPSGR+AQIH++H+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/571 (82%), Positives = 519/571 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFA+ ++ DVQAYK KALQLSKRIRHRGPDWSGN+++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G+YTL VNGEIYNHI LREE + Y F TLSDCEPIIPLYEKYDID PK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYD+K+DRIIAARDP+GITTLYMGR+S SPK+V+F+SELKCLTDDCD I+AFPPGH+
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE+RIP+ PVD+KA+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEK NAE+D   YDS+   LAG+D+ G+LH+AGWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVA FIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP DKMI   EG++EKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ FA PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A TVMRW+PKADWGCAEDPSGR+A+IH+QHV
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/571 (81%), Positives = 515/571 (90%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIF   +HEDV  +K  ALQL+KRIRHRGPDWSGNV+RN+TLL HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           P+ S   +Y L VNGEIYNHI+LREEFSDY F TLSDCEPIIPLYEKY ID PKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYD K+DR+IAARDP+GITTLYMGR+S SPKTV+FASELKCLTD+CD+I+AFPPGH+
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKAN E++  +YDSEDKHLAG+DDSG LHSAGWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DPK+KMIN+ EGR+EKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISD+ F  PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A TVMRW+PKADWGCAEDPSGR+A+IHDQH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/571 (81%), Positives = 520/571 (91%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHED++ +K KALQLSKRIRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G+Y L VNGEIYNHI+LRE+ SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           A+CLYD+K+DR+IAARDP+G+ TLYMGR S SPKTV+FASELKCLTD CD+I+AFPPGH+
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE R+P+ PVDY+AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN E + ++  +E   LAGIDD G+LH++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETETANVEAN-EEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDPKDKMIN +EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+DTAERVISD +FA PK++WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           ADTVMRWVPKADWGCAEDPSGR+AQIH++HV
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHV 570

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/571 (81%), Positives = 522/571 (91%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KH+D+ ++K KALQLSKRIRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G Y L VNGEIYNHI+LREE SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           A+C+YDAK+DRI+AARDP+G+ TLYMGR+S SPKTV+FASELKCLTD CD+I+AFPPGH+
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE RIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKANA+++ ++   ++K LAGIDD G+LH++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANADVN-EESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDPKDKMI  +EG++EKYILRKAFDTT+EPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAERVISD +FA PK+ WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A+TVMRWVPKADWGCAEDPSGR+A+IH++HV
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/571 (81%), Positives = 510/571 (89%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIF   +H+ V+ +K  AL+L KRIRHRGPDWSGN+++N+TL+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           P  S   NY L VNGE+YNHI+LREEFS Y F TLSDCEPIIPLYEKY ID PKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAK+DRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTD+CD+I+AFPPGH+
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETEKAN+++D  KYDSEDKHLAG+DD+GNL SAGWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDAL DVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DPK+KMIN  EGR+EKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ F  PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A TVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/571 (81%), Positives = 517/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHED+ ++K KALQLSKRIRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PI S  G Y L VNGEIYNHI+LRE+ S YKF T SDCEPIIPLY ++DID PK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           A+CLYDAK+DR++AARDP+G+ TLYMGR+S SPKTV+FASELKCLTD CD+I++FPPGH+
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+WLDE RIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKANA+ D       +K LAGIDD G+LH++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANADADGDA-SVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDPKDKMIN +EGR+EKYILRKAFDTTDEP+VKPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAERVISD +FA PK+ WG+D+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           ADTVMRWVPKADWGCAEDPSGR+A+IH++HV
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 517/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA KHED+  +K KALQLSK+IRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G Y L VNGEIYNHI+LRE  SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           A+CLYD+K+DRI+AARDP+G+ TLYMGR+S SP+TV+FASELKCLTD CD+I++FPPGH+
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE RIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKANA+ + +  + ++K LAGIDD G+LH++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANADAN-EDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDP +KMI  +EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAER ISD +FA PK+ WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           ADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/573 (79%), Positives = 505/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA +H DVQ Y+  ALQLSKRIRHRGPDWSGNV++N+T+LVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PI SPCGNYTLCVNGEIYNHI+LREE SDY F +LSDCEPIIPLY KY +D PK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYD+K+DRI+AARDP+GITTLYMG++S SPKT FFASELKCL DDCD IVAFPPGH+
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE+ +PS P+DYK +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+AN E+D   YDSE+KHLAGID  GNLH+ GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL LCM +DP +KMI  EEGR+EKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD++ A P+  WGDD PTTKEA+WYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573
           A+TVMRW+PKADWGC  DPSGRFA+IH+QH+ N
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/571 (79%), Positives = 508/571 (88%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIF  +KHE+ +A+K +ALQLSKRIRHRGPDWSGNV++N+T++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITS  G++ LCVNGEIYNHI++RE+F DY+F TLSDCEPIIPLY KY  + PK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AW LYDAKQDRIIAARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD+IVAFPPGH+
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETEKA     +    S    L GIDD+GNL S+GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP +KMIN++EGR+EKYILRKAFDTTDEP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAERVISD++F  P+  WG D+PTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A TVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/573 (79%), Positives = 509/573 (88%), Gaps = 2/573 (0%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D++++K  AL+LSKR+RHRGPDWSGNV++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PI SP GNY LCVNGEIYNHI LREE SDY+F++LSDCEPIIPLY KYD++TP++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYD ++DRI+AARDP+G+TTLYMG++S SP+T +FASELKCL D+CD I AFPPGH+
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DETRIPS PVDYKA+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+AN E  A    ++ KHLAG+DD G LH+ GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANRE--AGDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+  EFHTE VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP +KMI  ++GR+EKYILRKAFDT+DEP V PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AER ISD+ FA P  AWGDD+PTTKEAFWYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573
           A TVMRWVPKADWGCAEDPSGR+A+IHDQH+ +
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/578 (77%), Positives = 506/578 (87%), Gaps = 7/578 (1%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFAA+KH +V A+K +ALQL+KRIRHRGPDWSGNV++N TL  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PITSPCGNY L VNGEIYNHI+LREE +DYK+ TL DCEPIIP+Y KYD+D P +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           A+ LYD+++DR+IAARDPVGITTLYMGRNS +PKTV+FASELKCL DDCD+I+AFPPGH+
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKI RYF P+W+DE+ IP+ PVD K +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSED-------KHLAGIDDSGNLHSAGWSRLHSFAIG 293
             IASIAARETEK   E +   Y+ +        K L G+DDSGNL +  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPGAPDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLS 353
           LPGAPDLKAA KVA FIGSIHHEH FT+QEGLDALDDVI+HLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEE 473
           AWGLEARVPFLDR+FL LCMNIDP DKMI  +EG++EKY+LRKAFDT+DEPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKDTAERVISD++FA PK  WG D+PTTKEA+WYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           LFPQKTAADTVMRW+PKADWGCAEDPSGR+A+IH+QH+
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/571 (75%), Positives = 502/571 (87%)

Query: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60
           MCGIFA ++ + ++++K  ALQLSKRIRHRGPDWSGNV++N+T+ VHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120
           PI S  GNY LCVNGEIYNHI LR+  +DY FSTLSDCEPIIPL++KY ++TP YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180
           AWCLYDAK DRI+AARDP+G+TTLYMG+ S SP+T +FASELKCL ++CD I++FPPGH+
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P WL ++  P+ PVDYK +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300
             IA+IAARETEKAN E+D  KYDS+ ++L G+DD  +LH++GWS+LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGSIHHEHTFT+QEGLDALDDVI HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAP+A +FH E+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMNIDP++KMI  +EG++EKYILRKAFDT+DEPDV+PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISD+ FA PK  WGDD+P+TKEA+WYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571
           A TVMRWVPKA+WGC+EDPSGRFA+IH++H+
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 102/422 (24%), Positives = 163/422 (38%), Gaps = 65/422 (15%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIKLREEFSDYKF--STLSDCEPIIPLYEKYDIDTP 113
           QP T       G Y L  NGE+YN      EF+D ++    L+  E  IP       D  
Sbjct: 76  QPFTKQSLVVDGRYVLQFNGELYND---EIEFNDTQYIADMLARGEASIP-------DII 125

Query: 114 KYLDGMFAWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDC---D 170
             LDG FA+ +YD +  +    RD +G  +L    N+   K   + S +    +D    D
Sbjct: 126 ARLDGEFAYTIYDTEDQKYYFGRDAIGKRSLSYYVNT--SKDQLYVSSVTGRVEDIEFRD 183

Query: 171 NIVAFPPGHIYDSK------TDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRL 224
            I      +IYD+K      ++ I+  +T   L +          + +   L  AV KR+
Sbjct: 184 CIAGII--YIYDAKNQHLDDSNHISDPYTVSPLVDENFTERGEHIEKLHFQLNLAVEKRI 241

Query: 225 MAEVPYXXXXXXXXX--------XXXIASIAARETEKANAEIDAQKY------------D 264
            +  P                     +A I  + + KA   ++                D
Sbjct: 242 NSIHPNHIENSPISVLFSGGLDCSVIVALICNQLSGKARKTVELLNVGFENPRTGLVPSD 301

Query: 265 SEDKHLAGIDDSGNL-HSAGWSRLHSFAIGLPGAPDLKAASKVAKFIGSIHHEHTFTLQE 323
           S D+ LA I+    L H      +    I +P    L+A  KV   +        F  Q 
Sbjct: 302 SPDRKLA-IESYKTLQHLYPDIDIRLIEIDVPYEEYLRAKPKVIDLM--------FPKQT 352

Query: 324 GLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQGVKMVL-SGEGSDEIFGGYLYFAQ 382
            +D    + ++  +    +I   +       KI  Q   +VL SG G+DE++GGY  FA 
Sbjct: 353 EMDLSIAIAFYFASKGEGSITDKST----KGKIAYQRKGIVLFSGLGADELYGGYHKFAN 408

Query: 383 APNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVPFLDREFLQLCMNIDPKDKMI 442
             +  +   E  +++ N+H  +  R +K   + G+E R PFLD   ++      P +  I
Sbjct: 409 K-SFPDLQIELTRQINNIHDRNLNRDDKVIASNGVEIRYPFLDSSVVKFSTEDLPINYKI 467

Query: 443 NK 444
           NK
Sbjct: 468 NK 469

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  + +E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRK 456
           A G+E R PFLDR  ++  M   P +  IN       K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIPINWKIN-------KLILRK 471

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 25/168 (14%)

Query: 69  YTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDI---DTPKYLDGMFAWCLY 125
           Y L  NGE+YN     EE  D      +D   +  L E   +   +   +L+G FA+ +Y
Sbjct: 88  YILQFNGELYN-----EEILD------NDTSFVASLLENDKMSVFEVISFLEGEFAYTIY 136

Query: 126 DAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFAS---ELKCLTDDCDNIVAFPPGHIYD 182
           D  + ++   RD +G  +L   R   +   ++ AS   + +  TD    IV     +IYD
Sbjct: 137 DMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIYD 190

Query: 183 SKTDKITRYFTPDWLDE--TRIPSNPVDYKAIRHSLEKAVRKRLMAEV 228
            +   + +   P    E  + I  +  +++ I H+L + ++  ++  V
Sbjct: 191 VEDKSLNQQMLPILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLQLCMNIDPKDKMINKEEGR---MEKYILRKAFDTTDEP 464
           FLD E +Q  ++  P    +NK   R   +EK  LR   D   EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 94/217 (43%), Gaps = 34/217 (15%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPITSPC----GNYTLCVNGEIYNHIK 82
           I  RGP++S   LR N    H       + S  QP T         Y L  NGE+YN  +
Sbjct: 50  IVSRGPNYSS--LRVNR--EHGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREEFSDYKFSTLSDCEP-IIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGI 141
           +    + Y  S L  C+  ++ L  K        LDG FA+ +YD K+  I   RD +G 
Sbjct: 105 ISGNDTQYIVSLLKSCDGDVVSLVRK--------LDGGFAYTIYDLKEGNIYFGRDTIGK 156

Query: 142 TTLYMGRNSLSPKTVFFAS--ELKCLTDDCDNIVAFPPGHIYDSKT-----DKITR--YF 192
            +L    +  S + +F +S    +    DC   V +     YD+KT      K+ R  Y 
Sbjct: 157 RSLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVIYT----YDTKTHTLDDTKVIRDKYV 211

Query: 193 TPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVP 229
             D  DE    S  ++   +  +L ++V+KR+++  P
Sbjct: 212 VTDMTDELENESQYME--LLYGTLYESVKKRVLSIHP 246

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   N  E   E  K++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNKSNE-ELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGR-MEKYILRKAFDTTDEP 464
              G+E R PFLD   +Q  +++ P +  +NK   R M K ILR  F  ++EP
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416
           + QGV ++LSG G+DE++GGY  FA   + +E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANKAH-HELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEP 464
           +E R PFLD   + L     P +  +NK   R    +  K  +  +EP
Sbjct: 446 VEVRYPFLDEYVINLSTLEIPINYKVNKLILRKVASLFLKLDEIAEEP 493

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIK 82
           I  RGP++S   LR   +  H+      + S  +P T    N    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSS--LR--VIKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREEFSDYKFSTLSDCEPIIPLYEKYDI-DTPKYLDGMFAWCLYDAKQDRIIAARDPVGI 141
             +E SD+   +L     +  L +  ++ D  + L+G +A+ +YD K       RDP+G 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P  +E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPKDKMINK 444
            R PFLD   ++      P +  INK
Sbjct: 448 VRYPFLDEHVIKFSAVDIPINFKINK 473

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 57/127 (44%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPIT----SPCGNYTLCVNGEIYNHIK 82
           I  RGP++S   LR +    ++      + S  QP T    S    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSS--LRVSK--AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREEFSDYKFSTLSDCEPIIPLYEKYD-----IDTPKYLDGMFAWCLYDAKQDRIIAARD 137
             +E SD      +D + I  L +        ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 --KEISDDD----NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PVGITTL 144
           P+G  +L
Sbjct: 154 PIGRRSL 160

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   +  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLQLCMNIDPKDKMINKE 445
           +E R PFLD   +       P +  INK+
Sbjct: 446 IEVRYPFLDEYVVNFSTKEIPINYKINKK 474

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 69  YTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPII-----PLYEKYDIDTPKYLDGMFAWC 123
           Y L  NGE+YN+          +   +SD    +      L EK  I+  + L+G FA+ 
Sbjct: 89  YILQFNGELYNN----------EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYT 138

Query: 124 LYDAKQDRIIAARDPVGITTL 144
           ++D+K+  +   RD +G  +L
Sbjct: 139 IFDSKKKLVYFGRDTIGKRSL 159

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKA 457
           FLD   +Q      P +  +N       K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINYKVN-------KLILRKV 474

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 11/78 (14%)

Query: 69  YTLCVNGEIYNHIKLREEFSDYKF--STLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYD 126
           Y L  NGE+YN  +++++ +D +F  S LS    +I         T   LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 AKQDRIIAARDPVGITTL 144
            ++ +I   RD +G  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   +  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLQLCMNID---PKDKMINKEEGR 448
           FLD + ++  + +      DKMI ++  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P  +E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKA 457
           FLD   ++L     P +  +N       K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIPINFKVN-------KLILRKV 479

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 60  QPITSPCGN----YTLCVNGEIYN-HIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPK 114
           QP T    N    Y L  NGE+YN  I   +  S Y  S L + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 YLDGMFAWCLYDAKQDRIIAARDPVGITTL 144
            L+G +A+ +YD    ++   RDP+G  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP+  E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKA 457
           PFLD   ++      P +  +N       K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIPINYKVN-------KLILRKV 479

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYN-HI 81
           I  RGP++S   LR  T+  +       + S  +P T    N    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSS--LR--TVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  KLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGI 141
                 S Y  S L D E      +   ID  K L+G +A+ +YD K  +    RDP+G 
Sbjct: 103 SHWGNDSLYIASLLKDLED-----DGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   + ++   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDREFLQLCMNIDPKDKMINK 444
               G+E R PFLD E ++      P +  +NK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINYKVNK 470

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 108/274 (39%), Gaps = 74/274 (27%)

Query: 1   MCGIFAAHK-HEDVQAYKQKALQL------SKR--------------IRHRGPDWSGNVL 39
           MCGI   H   +D+   K++ L+       SKR              I  RGP++S    
Sbjct: 1   MCGILLHHAGDDDLYHLKEQFLEFPEGSLSSKRCSDGSPIFNSIIPYISARGPNYS---- 56

Query: 40  RNNTLLVHERLAIV---GLDSGAQPITSPC----GNYTLCVNGEIYNHIKLREEFSDYKF 92
              +L V ++        + S  QP T         Y L  NGE+YNH ++    + Y  
Sbjct: 57  ---SLRVSKKYKTAWYSSVLSLRQPFTCQSIEIEERYVLQFNGELYNH-EIVHNDTQYIV 112

Query: 93  STLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGITTLYMGRNSLS 152
             L +  P IP          K L+G FA+ +YD +       RD V       G+ SLS
Sbjct: 113 GLLKESAPSIPA-------IIKKLNGEFAYSIYDIQNGTFYFGRDTV-------GKRSLS 158

Query: 153 PKTVFFASE------LKCLTDDCDNIVAFPPGHI--YDSKTDKITR-------YFTPDWL 197
               +F  E      L  +T    N +    G I  Y +++ K+         Y     +
Sbjct: 159 ----YFLDENTGEFYLASVTGSQPNFIDCTAGIIYQYSTRSKKLNSDLSISSPYEIATTM 214

Query: 198 DE--TRIPSNPVDYKAIRHSLEKAVRKRLMAEVP 229
           D+  T++P N +D   +   L KAV +R+++  P
Sbjct: 215 DQQLTKLP-NCID--GLFEHLNKAVHRRIVSIHP 245

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   + +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLQLCMNIDPKDKMINK 444
           FLD + ++      P +  +NK
Sbjct: 449 FLDHDVIKFSTEEIPINYKVNK 470

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 97/220 (44%), Gaps = 37/220 (16%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPITS---PCGN-YTLCVNGEIYNH-I 81
           I+ RGPD+S   LR ++   H       + S  +P TS     GN + L  NGE+YN  I
Sbjct: 47  IKSRGPDYSS--LRVSS--EHSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQEI 102

Query: 82  KLREEFSDYKFSTLSD-----CEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAAR 136
              +  + +  S L +     C+ I            + L G FA+ LYD +Q +    R
Sbjct: 103 TAHDNDTQFIVSKLQEGYHDVCQII------------RQLSGEFAYTLYDLQQRKFYYGR 150

Query: 137 DPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHIYDSKTDKI-------T 189
           D VG  +L    ++++ + ++ +S    +    D I      ++YD+++  +       +
Sbjct: 151 DNVGKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLES 207

Query: 190 RYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVP 229
           +YF    LDE  +       + +   L  AVRKR+++  P
Sbjct: 208 QYFITKKLDE-ELTCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   +  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLQLCMNIDPKDKMINK 444
           FLD + ++      P +  INK
Sbjct: 455 FLDIDVIKFSTEELPINYKINK 476

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 27  IRHRGPDWSGNVLRNNTLLVHERLAIV---GLDSGAQPITSPC----GNYTLCVNGEIYN 79
           I  RGP++S       +  V ++ +I     + S  +P T  C      Y +  NGE+YN
Sbjct: 49  IAARGPNYS-------SFKVSKQYSITWFSSVLSLREPFTKQCVEIKDRYVVQFNGELYN 101

Query: 80  HIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPV 139
             +++   + Y    L + + II        D  + LDG FA+ +YD +       RDP+
Sbjct: 102 D-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPI 152

Query: 140 G 140
           G
Sbjct: 153 G 153

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   +A E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLQLCMNIDPKDKMINKE 445
            R PFLD + +Q    + P +  +NK+
Sbjct: 445 VRYPFLDEKVVQFSTEL-PINYKVNKK 470

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 23/126 (18%)

Query: 69  YTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKY---LDGMFAWCLY 125
           + L  NGE+YN      + +D  F        I  L E+Y  D PK    ++G FA+ ++
Sbjct: 91  FVLQYNGELYNS---SIQHNDTLF--------IASLIERYQDDIPKAIREMEGEFAYTIF 139

Query: 126 DAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLT---DDCDNIVAFPPGHIYD 182
           D + +++   RD +G  +L    +S + K   F S +   +   +DC+    +    IYD
Sbjct: 140 DKQCEKLYFGRDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYD 193

Query: 183 SKTDKI 188
           SKT  +
Sbjct: 194 SKTGNL 199

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F       E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDREFLQLCMNIDPKDKMINK 444
           FLD   ++   +  P +  INK
Sbjct: 451 FLDEHVIKYSTHDIPINYKINK 472

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 55/127 (43%), Gaps = 13/127 (10%)

Query: 22  QLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQPITSPC----GNYTLCVNGEI 77
            L K I  RGP+++   LR  TL  H       + S  +P           Y L  NGE+
Sbjct: 43  NLMKLISARGPNFAS--LR--TLKDHRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGEL 98

Query: 78  YNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARD 137
           YN   +  + + +    L + E       K  I   K LDG FA+ +YD K  R+   RD
Sbjct: 99  YNDEIIHND-TQFIVKLLLNTEQ----NSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRD 153

Query: 138 PVGITTL 144
           P+G  +L
Sbjct: 154 PIGKRSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 5/113 (4%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFA-QAPNANEFHTEAVKRVKNLHLADCLRANKS 411
           + I  Q   +VL SG G+DE++GGY  F  ++P       E  K++ N++  +  R +K 
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNKSPEL--LIKELTKQINNIYDRNLDRDDKC 433

Query: 412 TMAWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEP 464
               G+E R PFLD E + L  ++ P +   NK   R+      +  D  +EP
Sbjct: 434 MACNGIEIRYPFLDEEVINLSTSL-PINYKTNKNILRLLATNKLQLMDIGEEP 485

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 12/77 (15%)

Query: 69  YTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTP-KYLDGMFAWCLYDA 127
           Y L  NGE+YN     ++ S       +D + I  L EK  +D   + L G FA+ +Y+ 
Sbjct: 91  YILQYNGELYN-----DDISH------NDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KQDRIIAARDPVGITTL 144
           K   I   RD VG  +L
Sbjct: 140 KTKCIYFGRDSVGKRSL 156

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 3/93 (3%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+      E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRM 449
           +E R PFLD   ++    + P +  +NK   RM
Sbjct: 442 VEVRYPFLDDRVIEFSTQL-PINYKVNKMILRM 473

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKY 115
           +P+T  C      + L  NGEIYN   +    + Y  + LS  + +  +  K        
Sbjct: 78  EPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATELSIVQNVPTVIRK-------- 128

Query: 116 LDGMFAWCLYDAKQDRIIAARDPVGITTL 144
           L G FA+ +YD     I   RD VG  +L
Sbjct: 129 LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 6/93 (6%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y     + +E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLQLCMNIDP----KDKMI 442
           + G+E R PFL  E ++      P    +DKMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 78/186 (41%), Gaps = 43/186 (23%)

Query: 1   MCGI-------FAAHKHEDVQAYKQKALQLS---------KRIRHRGPDWSG--NVLRNN 42
           MCGI       F A     ++ Y+ +  +L          K +R RGP++     +   N
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TLLVHERLAIVGLDSGAQPITSP---CGN-YTLCVNGEIYNHIKLREEFSDYKFST--LS 96
           ++ +   L++       QP T      GN Y L  NGE+YN  ++ E  +D +F +  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTV 156
            C     + E    +    LDG FA+ + D + + I   RD +       G+ SLS    
Sbjct: 114 KC-----ISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTI-------GKRSLSYSLN 161

Query: 157 FFASEL 162
           +  SEL
Sbjct: 162 YNISEL 167

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 14/89 (15%)

Query: 102 IPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASE 161
           +P Y + DID PK+L+ MFA+     ++              ++ G + L  +T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDNIVAFPPGHIYDSK 184
             L C    LT  CDN  +F PG ++DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  N  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKA 457
           FLD + +     + P +  +N       K ILRK 
Sbjct: 448 FLDDQVVAFSTQL-PINYKVN-------KMILRKV 474

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKY 115
           +P T  C      + L  NGEIYN   +    + Y    L + + I  +         + 
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RT 128

Query: 116 LDGMFAWCLYDAKQDRIIAARDPVGITTL 144
           L G FA+ +YD     +   RDP+G  +L
Sbjct: 129 LSGEFAYTIYDKLTGEVFFGRDPIGRRSL 157

>TPHA0J00490 Chr10 (109600..110907) [1308 bp, 435 aa] {ON} Anc_6.40
           YMR005W
          Length = 435

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 182 DSKTDKITRYFTPDWLDETRIP-SNPVDYKAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           +SK  +++    P   +   IP SN  +  ++R     AV   L   +P           
Sbjct: 111 NSKETQVSMKTEPAEAEPDSIPNSNNKNISSVRKPAIGAVGSGLA--LPQLNQDSKKNAK 168

Query: 241 XXIASIAARETEKANAEIDAQKYDSEDKHLAGID---DSGNLHSA---GWSRLHSFAIGL 294
              AS +  E  KAN   DA K  S+    AG+D   +   L+S+     ++ H+  + +
Sbjct: 169 KSNASNSKAEGSKANQPADANKM-SDVLFSAGVDIREEEALLNSSVNTSKNQTHATIVNM 227

Query: 295 PGAPDLKAASKVAKFIGSIHHEHTFT--LQEGLDALDDVIWHLETY 338
           P  P     S+V+KF+  I  E TF     +  D L  +    ETY
Sbjct: 228 PEHPPFLHPSQVSKFMKKIAREQTFNQDFTKNNDILAMISTACETY 273

>SAKL0A08910g Chr1 (780195..782006) [1812 bp, 603 aa] {ON} highly
           similar to uniprot|P29468 Saccharomyces cerevisiae
           YKR002W PAP1 Poly(A) polymerase one of three factors
           required for mRNA 3'-end polyadenylation forms
           multiprotein complex with polyadenylation factor I (PF
           I) also required for mRNA nuclear export may also
           polyadenylate rRNAs
          Length = 603

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 46/114 (40%), Gaps = 24/114 (21%)

Query: 34  WSGNVLRNNTLLVHERLAIVGLDSGAQPITSPCGNYTLCVNGEIYNHIKLREEFSDYKFS 93
           WSG V     LLV +  A+ G++  A P T P                      + Y +S
Sbjct: 378 WSGLVESKLRLLVQKLEALNGINL-AHPFTKPFE--------------------TTYAYS 416

Query: 94  TLSDCEPIIPLYEKYDIDTPKYLDGMFAWCLYDAKQDRIIAARDPVGITTLYMG 147
           T  +C+ I+  Y  Y   T   L   +A    D K D  +  +  V ITT+Y+G
Sbjct: 417 TEDECKEIVDNYGTYK--TEGVLKN-YAEVTSDNKDDESLKDKKKVHITTMYIG 467

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,066,651
Number of extensions: 2710020
Number of successful extensions: 5964
Number of sequences better than 10.0: 48
Number of HSP's gapped: 6057
Number of HSP's successfully gapped: 67
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)