Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D046303.159ON96896844100.0
YDL031W (DBP10)3.159ON99590331560.0
Smik_4.2043.159ON99887731470.0
KAFR0C010603.159ON97387531450.0
CAGL0K01551g3.159ON96990031430.0
NCAS0C035303.159ON97789831400.0
Suva_4.2183.159ON100787831150.0
KLLA0F24684g3.159ON97389831100.0
Skud_4.2203.159ON100190331050.0
SAKL0C08778g3.159ON100391630950.0
Kpol_1032.113.159ON97787530890.0
KNAG0K011103.159ON100190930890.0
TPHA0M003303.159ON98187830860.0
KLTH0C08866g3.159ON97287530830.0
Kwal_56.228043.159ON97390030720.0
ZYRO0B04972g3.159ON97987830700.0
NDAI0G028703.159ON99191430650.0
AEL086W3.159ON96090130170.0
TBLA0B015903.159ON92989723600.0
ZYRO0B10318g5.208ON7504205845e-63
Smik_12.555.208ON7354185837e-63
Skud_12.595.208ON7584155793e-62
TBLA0C061605.208ON7574145784e-62
SAKL0G12760g5.208ON7374095741e-61
TPHA0N007005.208ON7554095643e-60
KLTH0B03278g5.208ON7394215615e-60
Kwal_33.151655.208ON7314215553e-59
NDAI0F020106.148ON8884075463e-57
ZYRO0B09856g2.164ON5404035223e-56
CAGL0L03846g2.164ON5444025214e-56
Suva_7.1926.204ON5184025195e-56
TBLA0C055802.164ON5404025198e-56
KLLA0F01034g8.614ON6274155231e-55
Smik_6.3188.614ON6134145212e-55
Suva_16.1918.614ON6184155202e-55
TDEL0F011902.164ON5494025162e-55
Smik_7.2056.204ON5224025142e-55
YGL078C (DBP3)6.204ON5234025143e-55
Skud_7.2046.204ON5164025133e-55
NCAS0C017208.614ON6404105195e-55
YNL112W (DBP2)2.164ON5464025135e-55
NCAS0G025602.164ON5564025137e-55
NDAI0F027402.164ON5614025129e-55
TPHA0B028508.614ON6284155169e-55
Skud_16.1618.614ON6194155151e-54
YPL119C (DBP1)8.614ON6174155142e-54
KNAG0H015208.614ON6214175142e-54
Ecym_54222.164ON5604025092e-54
Suva_8.2578.614ON6184155123e-54
TDEL0B040606.148ON8474085204e-54
AFL027C6.148ON8164095195e-54
Smik_14.2152.164ON5474025065e-54
Smik_15.3908.614ON6094155095e-54
KAFR0B045602.164ON5434025048e-54
Skud_15.3708.614ON6094155089e-54
NDAI0E024308.614ON6614105101e-53
Suva_14.2262.164ON5434025012e-53
YOR204W (DED1)8.614ON6044155043e-53
KLTH0D09746g8.614ON6214155053e-53
KLLA0F23716g2.164ON5544025004e-53
CAGL0L02915g8.614ON6174155034e-53
Kwal_14.16536.148ON6884075074e-53
ADL273C8.614ON6234145019e-53
KAFR0G020308.614ON6064105001e-52
NCAS0B017308.614ON6184175001e-52
NDAI0E015908.614ON6084144982e-52
SAKL0H08162g8.614ON6244154992e-52
SAKL0E10670g2.164ON5744024943e-52
TBLA0B042008.614ON6314154973e-52
TBLA0D035206.148ON8894095064e-52
KLTH0D09328g2.164ON5514024898e-52
ZYRO0F10934g8.614ON6034154921e-51
Ecym_22696.148ON8773895021e-51
YHR169W (DBP8)5.69ON4314104801e-51
TDEL0A055908.614ON5974084902e-51
Kpol_1072.508.614ON6504154922e-51
Smik_8.2535.69ON4374114774e-51
Ecym_82988.614ON6384184861e-50
KLTH0H00638g5.69ON4334104721e-50
ZYRO0G14960g6.148ON8314014922e-50
KLTH0H05852g6.148ON8114084893e-50
KLLA0C15433g8.469ON5394074756e-50
YBR237W (PRP5)6.148ON8494084877e-50
KLLA0A05203g5.69ON4354104678e-50
KLLA0F10505g6.148ON8124054851e-49
Smik_2.3806.148ON8504054861e-49
Skud_2.3696.148ON8484084823e-49
Suva_4.4946.148ON8504054814e-49
Kpol_1062.55.69ON4314104597e-49
Kwal_27.117348.469ON5713974688e-49
NCAS0B025708.469ON5904084698e-49
KNAG0A032808.614ON6074114682e-48
KAFR0G034806.148ON8524084753e-48
TBLA0B079505.69ON3934074523e-48
AER301C5.69ON4354294544e-48
KNAG0M006606.148ON8843884728e-48
KLTH0E10890g8.469ON5893944601e-47
Kwal_56.247605.69ON4334114501e-47
Ecym_13958.469ON5654004563e-47
KAFR0B015205.40ON4964054481e-46
KAFR0C064205.208ON7392574572e-46
YLL008W (DRS1)5.208ON7522494572e-46
Suva_10.675.208ON7442494545e-46
Ecym_47755.40ON5004044425e-46
Smik_4.4908.469ON5874054432e-45
NCAS0A015505.208ON7482454492e-45
CAGL0D03124g5.208ON7252494482e-45
KNAG0H025205.208ON7542554457e-45
TDEL0E042105.208ON7402604457e-45
SAKL0A06204g6.148ON8432464461e-44
KLTH0B08998g5.40ON4924074311e-44
Kpol_513.155.40ON5014054312e-44
Kpol_534.535.208ON7522434422e-44
CAGL0K07029g6.148ON8163834432e-44
NDAI0C024905.208ON7712574422e-44
Skud_14.2192.164ON4353744226e-44
KLLA0F15752g5.208ON7482374368e-44
KNAG0I020502.164ON4233624191e-43
Kwal_23.42885.40ON4924074203e-43
Kpol_165.12.164ON4413614112e-42
Kwal_26.84702.164ON4253614051e-41
AAL164C5.208ON7342374191e-41
YJL033W (HCA4)5.241ON7704114191e-41
CAGL0F05577g8.402ON6664114152e-41
ZYRO0E02530g8.124ON5564114102e-41
SAKL0H13574g8.402ON6684104142e-41
TBLA0H032408.402ON7674234173e-41
Kpol_534.316.148ON8722284122e-40
Kpol_340.28.402ON6704444044e-40
ZYRO0B05852g3.122ON7514414057e-40
KLTH0A02244g8.87ON5984183999e-40
TPHA0D019905.337ON4982413949e-40
AGL112C8.402ON6584074001e-39
KLTH0F08382g8.402ON6574023992e-39
TPHA0N011306.148ON8772094023e-39
ZYRO0C14234g5.337ON4942633877e-39
KAFR0D046305.337ON4872393877e-39
Kwal_23.51258.87ON5984123911e-38
Kwal_23.32358.402ON6763983921e-38
Kpol_1058.438.87ON6074073902e-38
NDAI0C042505.337ON5042413852e-38
KNAG0B046605.337ON4942223842e-38
Smik_6.818.87ON6064183882e-38
Skud_8.1225.337ON5032573832e-38
KLLA0C14608g5.337ON4872223823e-38
Skud_6.728.87ON6064183883e-38
NCAS0F027905.337ON5022413824e-38
Kpol_1005.115.337ON5062413815e-38
TDEL0E028905.337ON5012413815e-38
NCAS0H012806.148ON8872253916e-38
CAGL0L08976g8.87ON6174133857e-38
SAKL0G09328g5.337ON5052413807e-38
YHR065C (RRP3)5.337ON5012493807e-38
KAFR0B061708.402ON6234203857e-38
TDEL0F052608.402ON6554103851e-37
TBLA0C035005.337ON5062443781e-37
Ecym_32175.337ON4862223762e-37
YFL002C (SPB4)8.87ON6064183812e-37
CAGL0J10912g5.337ON4932413762e-37
YJL138C (TIF2)1.211ON3953893702e-37
YKR059W (TIF1)1.211ON3953893702e-37
Smik_8.1365.337ON5012413753e-37
ZYRO0C04378g8.402ON6814123814e-37
NCAS0J005808.87ON6114083784e-37
Suva_15.2545.337ON5032413727e-37
KAFR0G006501.211ON3953983658e-37
Kpol_2001.677.336ON4842113718e-37
NCAS0A140607.336ON5102113701e-36
KAFR0E016405.241ON7602013781e-36
TBLA0C006908.87ON6044183742e-36
SAKL0C10296g3.122ON8124443782e-36
Smik_10.941.211ON3953893622e-36
Smik_11.3211.211ON3953893622e-36
KNAG0C038207.336ON5132133682e-36
TPHA0B029302.164ON4272083633e-36
ZYRO0G08580g6.204ON5392173684e-36
SAKL0F11088g7.336ON4972113655e-36
Ecym_82615.241ON7752213745e-36
Kwal_33.143255.337ON5002433655e-36
KLTH0F07106g5.337ON5252413631e-35
CAGL0J06908g8.614ON6042683661e-35
KAFR0B009107.336ON5122113622e-35
TPHA0N009405.241ON7712013692e-35
AAL041C5.337ON4872423602e-35
SAKL0G11748g5.241ON7632083692e-35
KLLA0A09669g5.40ON4972363602e-35
KAFR0H028208.614ON6112513652e-35
Smik_4.4428.402ON6654193662e-35
CAGL0M13519g5.40ON4942433602e-35
CAGL0I03476g7.336ON5072113603e-35
Ecym_46467.336ON4902113593e-35
AFL221C2.164ON5572083623e-35
TDEL0C021007.336ON4792113584e-35
ACR197W7.336ON4842113584e-35
Smik_4.777.336ON5062113584e-35
YDR194C (MSS116)8.402ON6644193644e-35
NDAI0A019607.336ON5342113595e-35
KNAG0C012201.211ON3973993525e-35
Kwal_56.240056.204ON5332163595e-35
CAGL0H03377g6.204ON5402163596e-35
Ecym_41658.402ON6584093636e-35
TPHA0D045207.336ON5022113577e-35
TBLA0D057501.211ON4013903508e-35
ADL024C8.124ON5692523589e-35
NCAS0B030308.402ON6844223621e-34
ZYRO0F11440g7.336ON5232113561e-34
TBLA0F023607.336ON5852113581e-34
TPHA0L021605.40ON4982433542e-34
YDL160C (DHH1)7.336ON5062113542e-34
TPHA0L009608.402ON6764143602e-34
Skud_4.967.336ON5072113542e-34
Suva_4.867.336ON5082113542e-34
Skud_4.4588.402ON6644193592e-34
NCAS0A014005.241ON7622083612e-34
Kwal_23.28835.241ON7642203603e-34
KLLA0D09504g5.241ON7702223594e-34
KNAG0A046608.402ON7134133574e-34
KLLA0C16599g7.336ON5142113505e-34
NDAI0C023205.241ON7642013575e-34
KAFR0C022206.204ON5112173497e-34
NCAS0E039205.69ON4371983457e-34
KLTH0H04466g6.204ON5532163517e-34
KLTH0G07766g5.241ON7642013567e-34
Suva_2.3628.402ON6644203547e-34
TDEL0E038505.241ON7612013567e-34
Kpol_1004.135.241ON7682023551e-33
Skud_7.1008.124ON5582533491e-33
ZYRO0A10802g5.241ON7712183541e-33
KNAG0F026105.241ON7622243542e-33
NDAI0C036005.40ON5192433462e-33
TDEL0F010908.124ON5514073482e-33
TBLA0C006408.124ON5792553482e-33
SAKL0H01430g5.40ON5002343452e-33
KLLA0D18667g8.402ON6854013512e-33
TDEL0G014206.204ON5122163453e-33
KLTH0H01562g7.336ON4912083433e-33
AFL080W6.204ON5352193453e-33
TDEL0G006505.40ON4852423433e-33
TBLA0E041008.614ON8662623524e-33
Ecym_22136.204ON5542183454e-33
KNAG0F020506.204ON5331973444e-33
NDAI0B009005.69ON4361983395e-33
AGR333C5.40ON5042433425e-33
ZYRO0D07546g5.40ON4942343417e-33
CAGL0J01045g5.241ON7652083487e-33
SAKL0A04752g6.204ON5492183421e-32
Kwal_56.245887.336ON5132113401e-32
YGL171W (ROK1)8.124ON5642553421e-32
NCAS0F022005.40ON5082423391e-32
TBLA0D034005.241ON7752013461e-32
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04630
         (968 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1703   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1220   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1216   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1216   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1215   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1214   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1204   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1202   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1200   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1196   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1194   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1194   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1193   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1192   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1187   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1187   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1185   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1166   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   913   0.0  
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   229   5e-63
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   229   7e-63
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   227   3e-62
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   227   4e-62
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   225   1e-61
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   221   3e-60
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   220   5e-60
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   218   3e-59
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    214   3e-57
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   205   3e-56
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   205   4e-56
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   204   5e-56
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   204   8e-56
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   206   1e-55
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   205   2e-55
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   204   2e-55
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   203   2e-55
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   202   2e-55
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   202   3e-55
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   202   3e-55
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   204   5e-55
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   202   5e-55
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   202   7e-55
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   201   9e-55
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   203   9e-55
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   202   1e-54
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   202   2e-54
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   202   2e-54
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   200   2e-54
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   201   3e-54
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   204   4e-54
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   204   5e-54
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   199   5e-54
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   200   5e-54
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   198   8e-54
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   200   9e-54
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   201   1e-53
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   197   2e-53
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   198   3e-53
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   199   3e-53
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   197   4e-53
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   198   4e-53
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   199   4e-53
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   197   9e-53
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   197   1e-52
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   197   1e-52
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   196   2e-52
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   196   2e-52
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   194   3e-52
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   196   3e-52
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   199   4e-52
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   192   8e-52
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   194   1e-51
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   197   1e-51
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   189   1e-51
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   193   2e-51
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   194   2e-51
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   188   4e-51
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   191   1e-50
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   186   1e-50
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   194   2e-50
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   192   3e-50
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   187   6e-50
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   192   7e-50
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   184   8e-50
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   191   1e-49
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   191   1e-49
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   190   3e-49
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   189   4e-49
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   181   7e-49
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   184   8e-49
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    185   8e-49
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   184   2e-48
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   187   3e-48
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   178   3e-48
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   179   4e-48
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   186   8e-48
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   181   1e-47
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   177   1e-47
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   180   3e-47
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   177   1e-46
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   180   2e-46
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   180   2e-46
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   179   5e-46
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   174   5e-46
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   175   2e-45
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   177   2e-45
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   177   2e-45
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   176   7e-45
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   176   7e-45
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   176   1e-44
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   170   1e-44
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   170   2e-44
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   174   2e-44
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   175   2e-44
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   174   2e-44
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   167   6e-44
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   172   8e-44
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   166   1e-43
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   166   3e-43
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   162   2e-42
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   160   1e-41
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   166   1e-41
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   166   1e-41
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   164   2e-41
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   162   2e-41
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   164   2e-41
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   165   3e-41
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   163   2e-40
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   160   4e-40
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   160   7e-40
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   158   9e-40
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   156   9e-40
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   158   1e-39
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   158   2e-39
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   159   3e-39
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   153   7e-39
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   153   7e-39
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   155   1e-38
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   155   1e-38
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   154   2e-38
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    152   2e-38
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   152   2e-38
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   154   2e-38
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   152   2e-38
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   151   3e-38
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   154   3e-38
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    151   4e-38
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   151   5e-38
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   151   5e-38
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   155   6e-38
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   152   7e-38
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   150   7e-38
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   150   7e-38
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   152   7e-38
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   152   1e-37
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   150   1e-37
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   149   2e-37
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   151   2e-37
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   149   2e-37
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   147   2e-37
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   147   2e-37
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   149   3e-37
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   151   4e-37
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      150   4e-37
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   147   7e-37
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   145   8e-37
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   147   8e-37
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   147   1e-36
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   150   1e-36
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   148   2e-36
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   150   2e-36
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   144   2e-36
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   144   2e-36
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   146   2e-36
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   144   3e-36
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   146   4e-36
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   145   5e-36
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   148   5e-36
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   145   5e-36
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   144   1e-35
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   145   1e-35
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   144   2e-35
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   146   2e-35
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   143   2e-35
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   146   2e-35
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   143   2e-35
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   145   2e-35
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   145   2e-35
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   143   2e-35
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   143   3e-35
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   142   3e-35
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   144   3e-35
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   142   4e-35
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   142   4e-35
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   142   4e-35
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   144   4e-35
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   142   5e-35
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   140   5e-35
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   142   5e-35
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   142   6e-35
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   144   6e-35
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   142   7e-35
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   139   8e-35
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   142   9e-35
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    144   1e-34
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   141   1e-34
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   142   1e-34
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   140   2e-34
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   140   2e-34
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   143   2e-34
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   140   2e-34
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   140   2e-34
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   142   2e-34
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    143   2e-34
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   143   3e-34
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   142   4e-34
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   142   4e-34
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   139   5e-34
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    142   5e-34
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   139   7e-34
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   137   7e-34
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   139   7e-34
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   141   7e-34
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   140   7e-34
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   141   7e-34
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   141   1e-33
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   139   1e-33
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   140   1e-33
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   140   2e-33
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   137   2e-33
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   138   2e-33
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   138   2e-33
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   137   2e-33
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   139   2e-33
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   137   3e-33
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   136   3e-33
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   137   3e-33
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   136   3e-33
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   140   4e-33
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   137   4e-33
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   137   4e-33
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   135   5e-33
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   136   5e-33
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   135   7e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   138   7e-33
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   136   1e-32
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   135   1e-32
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   136   1e-32
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     135   1e-32
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   137   1e-32
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   135   2e-32
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   135   2e-32
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   135   2e-32
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   135   3e-32
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   135   3e-32
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   134   3e-32
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   134   3e-32
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   132   4e-32
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   132   4e-32
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   132   5e-32
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   135   5e-32
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   134   6e-32
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   135   6e-32
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    133   7e-32
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   132   7e-32
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   133   7e-32
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   132   8e-32
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   132   9e-32
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   135   1e-31
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   130   1e-31
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   131   2e-31
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   131   2e-31
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   134   2e-31
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   131   2e-31
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   132   2e-31
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   131   3e-31
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   131   4e-31
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   129   4e-31
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   130   4e-31
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   129   6e-31
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   128   6e-31
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   130   1e-30
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   129   2e-30
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    129   3e-30
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   128   4e-30
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   128   6e-30
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   127   6e-30
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   127   7e-30
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   124   7e-30
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   127   7e-30
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   127   1e-29
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   127   1e-29
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   124   1e-29
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   126   2e-29
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   125   4e-29
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              124   7e-29
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   121   7e-29
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   122   8e-29
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   121   1e-28
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   124   1e-28
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   121   1e-28
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   124   1e-28
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   123   2e-28
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   120   2e-28
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   120   2e-28
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   122   7e-28
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   119   7e-28
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   118   1e-27
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   117   2e-27
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   120   2e-27
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   120   3e-27
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   117   3e-27
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   117   3e-27
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   119   3e-27
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   120   4e-27
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   119   4e-27
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   117   4e-27
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   116   5e-27
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   115   8e-27
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   115   8e-27
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   118   8e-27
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   115   8e-27
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   118   9e-27
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   118   1e-26
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   115   1e-26
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   118   1e-26
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   115   1e-26
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   117   1e-26
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   117   1e-26
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   117   2e-26
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   114   2e-26
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   117   3e-26
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   116   3e-26
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   116   3e-26
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   116   3e-26
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   116   4e-26
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   113   5e-26
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   112   1e-25
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   114   2e-25
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   111   2e-25
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   114   2e-25
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   114   3e-25
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   112   3e-25
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   110   4e-25
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   113   4e-25
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   110   4e-25
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   110   5e-25
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   112   5e-25
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   110   5e-25
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   110   6e-25
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   112   8e-25
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   109   8e-25
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   112   9e-25
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   112   9e-25
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   110   1e-24
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   112   1e-24
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   109   1e-24
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   108   2e-24
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   108   2e-24
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   109   2e-24
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...   110   2e-24
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     110   2e-24
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   110   3e-24
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...   110   3e-24
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   108   3e-24
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   110   3e-24
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   108   3e-24
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   110   4e-24
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   108   4e-24
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   108   4e-24
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   108   4e-24
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   110   4e-24
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   107   4e-24
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   108   5e-24
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   107   6e-24
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   107   6e-24
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   110   7e-24
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   110   7e-24
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   109   8e-24
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   106   8e-24
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   106   8e-24
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   107   1e-23
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   107   1e-23
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   108   1e-23
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            109   1e-23
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              106   1e-23
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   108   1e-23
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   107   2e-23
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   107   2e-23
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   106   2e-23
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   108   2e-23
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   105   2e-23
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   106   2e-23
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   108   2e-23
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   108   2e-23
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   106   3e-23
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   108   3e-23
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   105   3e-23
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   105   4e-23
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   107   4e-23
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   105   4e-23
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   107   5e-23
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    105   5e-23
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   105   5e-23
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   105   5e-23
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   105   6e-23
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643    105   7e-23
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   107   7e-23
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   106   9e-23
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   104   1e-22
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...   105   1e-22
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   104   2e-22
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...   105   2e-22
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   105   2e-22
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   105   2e-22
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   103   3e-22
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   104   4e-22
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   103   5e-22
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   103   5e-22
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   103   9e-22
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...   103   1e-21
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    96   1e-21
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...   102   1e-21
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...   102   2e-21
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   102   2e-21
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   102   2e-21
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...   100   2e-21
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   102   2e-21
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   101   3e-21
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}            100   3e-21
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...   101   4e-21
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...   101   4e-21
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...   100   4e-21
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...    99   5e-21
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...   100   8e-21
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   100   8e-21
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...    98   1e-20
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...    99   1e-20
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...    98   2e-20
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...    97   2e-20
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...    99   3e-20
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...    97   3e-20
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...    98   4e-20
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...    96   5e-20
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    96   5e-20
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    97   7e-20
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    97   7e-20
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...    96   9e-20
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643     94   1e-19
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...    93   5e-19
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...    94   5e-19
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    89   6e-18
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    89   2e-17
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    87   1e-16
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    87   1e-16
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    86   2e-16
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    86   3e-16
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    85   3e-16
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    84   9e-16
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...    83   1e-15
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    82   2e-15
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    82   3e-15
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    82   4e-15
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    82   4e-15
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    81   5e-15
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    77   1e-14
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    77   1e-14
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     78   5e-14
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    77   1e-13
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    77   1e-13
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    77   1e-13
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    76   2e-13
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    75   3e-13
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    74   9e-13
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...    71   2e-12
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    70   2e-11
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    69   3e-11
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    65   3e-11
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    68   5e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    68   5e-11
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    67   1e-10
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    62   3e-10
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    66   3e-10
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    65   4e-10
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    65   5e-10
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    65   6e-10
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    64   1e-09
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    64   2e-09
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    62   3e-09
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    62   4e-09
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    62   4e-09
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    62   4e-09
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    58   9e-08
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    57   1e-07
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    54   2e-06
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    46   3e-04
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    45   4e-04
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    46   5e-04
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    45   6e-04
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    45   8e-04
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    44   0.002
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    44   0.002
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    44   0.003
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    43   0.003
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    40   0.005
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    42   0.008
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    42   0.011
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    41   0.016
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    41   0.016
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    41   0.018
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    41   0.019
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    40   0.022
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    40   0.032
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    40   0.036
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    40   0.037
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    40   0.038
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    40   0.039
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    40   0.040
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    40   0.041
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    40   0.042
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    39   0.051
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    39   0.051
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    39   0.055
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    39   0.056
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    39   0.061
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    39   0.062
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    39   0.084
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    39   0.085
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    38   0.13 
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    38   0.13 
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    38   0.17 
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    38   0.19 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    37   0.20 
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    37   0.21 
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    37   0.22 
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    37   0.23 
NDAI0I00750 Chr9 (164874..169178) [4305 bp, 1434 aa] {ON} Anc_6....    37   0.26 
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    37   0.27 
Kwal_14.2508 s14 complement(790049..793354) [3306 bp, 1101 aa] {...    37   0.30 
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    37   0.32 
KLTH0H10406g Chr8 complement(894542..897769) [3228 bp, 1075 aa] ...    37   0.32 
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    37   0.38 
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    37   0.42 
ZYRO0B09306g Chr2 (730191..733388) [3198 bp, 1065 aa] {ON} highl...    37   0.42 
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    36   0.47 
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    36   0.50 
KNAG0E02660 Chr5 (526419..529583) [3165 bp, 1054 aa] {ON} Anc_1....    36   0.50 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    36   0.52 
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    36   0.56 
Skud_10.145 Chr10 complement(273285..276482) [3198 bp, 1065 aa] ...    36   0.57 
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    36   0.60 
KLLA0B03179g Chr2 (289199..292204) [3006 bp, 1001 aa] {ON} simil...    36   0.63 
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    36   0.67 
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    36   0.76 
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    35   0.78 
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    35   0.79 
Kpol_1035.20 s1035 complement(45238..48471) [3234 bp, 1077 aa] {...    35   0.80 
YJL050W Chr10 (342522..345743) [3222 bp, 1073 aa] {ON}  MTR4ATP-...    35   0.85 
TPHA0O01420 Chr15 complement(281318..284545) [3228 bp, 1075 aa] ...    35   0.86 
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    35   0.88 
AEL181C Chr5 complement(296782..299997) [3216 bp, 1071 aa] {ON} ...    35   0.93 
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    35   0.95 
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     35   0.95 
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    35   1.00 
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    35   1.0  
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    35   1.1  
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    35   1.1  
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    35   1.1  
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    35   1.1  
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    35   1.1  
KAFR0A00860 Chr1 (156234..159437) [3204 bp, 1067 aa] {ON} Anc_1....    35   1.1  
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    35   1.1  
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   1.2  
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    35   1.2  
SAKL0D06622g Chr4 complement(544709..547954) [3246 bp, 1081 aa] ...    35   1.3  
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    35   1.3  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    35   1.3  
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    35   1.3  
YGL251C Chr7 complement(27921..31426,31579..31636) [3564 bp, 118...    35   1.3  
NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6....    35   1.3  
Suva_6.125 Chr6 complement(206404..209610) [3207 bp, 1068 aa] {O...    35   1.4  
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    35   1.4  
Smik_10.191 Chr10 (333972..337175) [3204 bp, 1067 aa] {ON} YJL05...    35   1.6  
NCAS0A09110 Chr1 complement(1801017..1804211) [3195 bp, 1064 aa]...    35   1.7  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    34   1.7  
TDEL0D01990 Chr4 complement(384739..387966) [3228 bp, 1075 aa] {...    35   1.7  
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    34   1.9  
CAGL0J04928g Chr10 complement(468765..471962) [3198 bp, 1065 aa]...    34   2.0  
TBLA0F01280 Chr6 complement(316339..319554) [3216 bp, 1071 aa] {...    34   2.0  
KLTH0G14278g Chr7 (1236981..1243502) [6522 bp, 2173 aa] {ON} sim...    34   2.0  
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    34   2.0  
Ecym_6004 Chr6 complement(9579..12797) [3219 bp, 1072 aa] {ON} s...    34   2.1  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    34   2.2  
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    34   2.6  
Ecym_6303 Chr6 (570968..574195) [3228 bp, 1075 aa] {ON} similar ...    34   2.7  
NDAI0G05850 Chr7 (1450221..1453484) [3264 bp, 1087 aa] {ON} Anc_...    34   2.8  
KLLA0F01364g Chr6 complement(126312..129533) [3222 bp, 1073 aa] ...    34   2.8  
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    33   3.5  
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    33   3.7  
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    33   4.4  
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    33   5.2  
NDAI0I03300 Chr9 (771772..771820,771929..775467) [3588 bp, 1195 ...    33   6.2  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    32   7.6  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    32   8.7  

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1703 bits (4410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 847/968 (87%), Positives = 847/968 (87%)

Query: 1   MKVSGKRKLXXXXXXXXXXXXXXXXXXXIVNDIALNXXXXXXXXXXXXXXGGXXXXXXXX 60
           MKVSGKRKL                   IVNDIALN              GG        
Sbjct: 1   MKVSGKRKLGDDASLSDGSESGSEEDYDIVNDIALNSSDSDEDDSSEDSEGGEQDIIEYS 60

Query: 61  XXXXXXXXXXXXXAPKDKSFPKLEASGXXXXXXXXXVNEYFSTTAQTNKKHKKGSFPSFG 120
                        APKDKSFPKLEASG         VNEYFSTTAQTNKKHKKGSFPSFG
Sbjct: 61  DEEEEHQHEKKKSAPKDKSFPKLEASGDEAEDDADDVNEYFSTTAQTNKKHKKGSFPSFG 120

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHS 180
           LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHS
Sbjct: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHS 180

Query: 181 SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVA 240
           SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVA
Sbjct: 181 SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVA 240

Query: 241 TPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLP 300
           TPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLP
Sbjct: 241 TPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLP 300

Query: 301 NSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATE 360
           NSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATE
Sbjct: 301 NSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATE 360

Query: 361 EQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHH 420
           EQIKLI              NG              VRMPAANQLPSEKSTILFVPTRHH
Sbjct: 361 EQIKLIKDKSPDSDEESDDDNGKRSHNKHKKEKFKKVRMPAANQLPSEKSTILFVPTRHH 420

Query: 421 VEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 480
           VEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANV
Sbjct: 421 VEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 480

Query: 481 INFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAA 540
           INFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS              GKKILTTPMYEAA
Sbjct: 481 INFSFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMYEAA 540

Query: 541 TDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLMSSFELETLRG 600
           TDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLMSSFELETLRG
Sbjct: 541 TDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLMSSFELETLRG 600

Query: 601 VAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNK 660
           VAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNK
Sbjct: 601 VAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNK 660

Query: 661 ETVFEFARNADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELLNDNE 720
           ETVFEFARNADDETSMLMKKRRFQVAPIT                GFSHAMEDELLNDNE
Sbjct: 661 ETVFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAMEDELLNDNE 720

Query: 721 LIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTS 780
           LIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTS
Sbjct: 721 LIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTS 780

Query: 781 GFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPAS 840
           GFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPAS
Sbjct: 781 GFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPAS 840

Query: 841 FRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPK 900
           FRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPK
Sbjct: 841 FRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPK 900

Query: 901 LPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNA 960
           LPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNA
Sbjct: 901 LPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNA 960

Query: 961 RPSKKRKY 968
           RPSKKRKY
Sbjct: 961 RPSKKRKY 968

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1220 bits (3156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/903 (66%), Positives = 713/903 (78%), Gaps = 14/903 (1%)

Query: 79  SFPKLE-------ASGXXXX-XXXXXVNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNIS 130
           +FP LE       ASG          VNEYFST      KHKKGSFPSFGLSK++LNNI 
Sbjct: 94  AFPMLEMSDDENNASGKTQTGDDEDDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIK 153

Query: 131 RKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVIL 190
           RKGF QPTPIQRKTIPLILQSRDIVG+ARTGSGKTAAFILPM+EKLKSHS K+GARAVIL
Sbjct: 154 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 213

Query: 191 SPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKV 250
           SPSRELAMQT  VFKDF+RGT LRSVLLTGGDSLEEQFGMMM+NPDVI+ATPGRFLHLKV
Sbjct: 214 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKV 273

Query: 251 EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAG 310
           EMNLDLKS+EY VFDE+DRLFEMGF+EQLNELLA+LP+ RQTLLFSATLPNSLVDF KAG
Sbjct: 274 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 333

Query: 311 LTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXX 370
           L NPVLVRLD E+K+SENLEMLFLS+K+ +REA LLY++QE+I+IPLAT EQ++ +    
Sbjct: 334 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSN 393

Query: 371 XXXXXXXXXXNGXXXXXXX-XXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLK 429
                     N                 +MPAAN+LPSEK+TILFVPTRHHVEYI+ LL+
Sbjct: 394 NEADSDSDDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLR 453

Query: 430 NCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSS 489
           +CGYL+SYIYG+LDQ AR RQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN++ P SS
Sbjct: 454 DCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSS 513

Query: 490 KIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWV 549
           KIFVHRVGRTARAGN+GWAYSI++              GKKIL TPMY++  D+++KRW+
Sbjct: 514 KIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWI 573

Query: 550 EEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLMSS-FELETLRGVAKKAEKL 608
           +EGK +  F+ PK SYT RLVLGSCPRLD++ +GDLYKNLMSS F+L+  +  A KAEKL
Sbjct: 574 DEGKPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKL 633

Query: 609 YLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFAR 668
           Y RTRT+AS ES+KRS+E+++SGWD QN  FGKN EKEKLDFLAKLQ+R NKETVFEF R
Sbjct: 634 YYRTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTR 693

Query: 669 NADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL-NDNELIKESVP 727
           N DDE ++ MK+RR Q+API                 G SH++EDE+L  D+     +V 
Sbjct: 694 NPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVS 753

Query: 728 EEVLQEFEDADKLLEDQ--EKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTD 785
           E+ L+EFEDAD+LLE Q  E   +KK KSF+DP FFLSHYAP G + + +L +T+GF  D
Sbjct: 754 EDALKEFEDADQLLEAQENENKKKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFAND 813

Query: 786 AAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGK 845
           AAQAA D+N DDKVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+GESGQKI ASFRSG+
Sbjct: 814 AAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGR 873

Query: 846 YAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKH 905
           + +WSKARNL+P+KVG+RE+   +N+L +P+Q    +G RTV GKFKHKQ+KAPK+PDKH
Sbjct: 874 FDDWSKARNLKPLKVGSRETSIPSNLLEDPSQGPAANG-RTVRGKFKHKQMKAPKMPDKH 932

Query: 906 RDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKK 965
           RD+Y+ QKKKV++AL  GI+VKGYN     ++EL+S  QIRK R  +EKK AKNARPSKK
Sbjct: 933 RDNYYSQKKKVEKALQSGISVKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARPSKK 992

Query: 966 RKY 968
           RK+
Sbjct: 993 RKF 995

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/877 (68%), Positives = 701/877 (79%), Gaps = 6/877 (0%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           VNEYFST     +KHKKGSFPSFGLSK++LNNI RKGF QPTPIQRKTIPLILQSRDIVG
Sbjct: 123 VNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVG 182

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
           +ARTGSGKTAAFILPM+EKLKSHS K+GARAVILSPSRELAMQT  VFKDF+RGT LRSV
Sbjct: 183 MARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSV 242

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
           LLTGGDSLEEQF MMMSNPDVI+ATPGRFLHLKVEMNLDLKS+EY VFDE+DRLFEMGF+
Sbjct: 243 LLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQ 302

Query: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
           EQLNELLA+LP+ RQTLLFSATLPNSLVDF KAGL NPVLVRLD E+K+SENLEMLFLS+
Sbjct: 303 EQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS 362

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQ-IKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXX 395
           K+ +REA LLY++QEVI+IPLAT EQ +KL               +              
Sbjct: 363 KNADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINFKKEKFR 422

Query: 396 XVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455
             +MPAAN+LPSEK+TILFVPTRHHVEYI+ LL++CGYL+SYIYG+LDQ AR  QLYNFR
Sbjct: 423 KQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFR 482

Query: 456 AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXX 515
           AGLTSILVVTDVAARGVDIPMLANVIN++ P SSKIFVHRVGRTARAGN+GWAYSI++  
Sbjct: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAEN 542

Query: 516 XXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCP 575
                       GKKIL TPMY++  D+++KRWVEEG     F+ PK SYT RLVLGSCP
Sbjct: 543 ELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCP 602

Query: 576 RLDIDSMGDLYKNLMSS-FELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDE 634
           RLD++ +GDLYKNLM+S F+L+  +  A KAEKLY RTRT+AS ES+KRS+E++ SGWD 
Sbjct: 603 RLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDA 662

Query: 635 QNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXXXX 694
           QN  FGKN EKEKLDFLAKLQ+R NKETVFEF RN DDE ++ MK+RR Q+API      
Sbjct: 663 QNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATE 722

Query: 695 XXXXXXXXXXXGFSHAMEDELL-NDNELIKESVPEEVLQEFEDADKLLEDQEK--LGRKK 751
                      G SH++EDE+L  D+     +V E+ L+ FEDAD+LLE QE     +KK
Sbjct: 723 RRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESKKKKK 782

Query: 752 SKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWD 811
            K+F+DP FFLSHYAP G + + +L +T+GF  DAAQAA D+N DDKVQVHKQ ATVKWD
Sbjct: 783 PKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWD 842

Query: 812 SKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANM 871
            K+KKY+N+QG DNKKYI+GESGQKI ASFRSG++ +WSKARNL+P+KVG+RES   +N+
Sbjct: 843 KKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNL 902

Query: 872 LRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNT 931
           L++P+Q   ++G RTV GKFKHKQ+KAPK+PDKHRD+Y+ QKKKV +AL  GI+VKGYN 
Sbjct: 903 LQDPSQGTGSNG-RTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNN 961

Query: 932 RGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
               +NEL+S  QIRK R  +EKK AKNARPSKKRK+
Sbjct: 962 APGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/875 (68%), Positives = 698/875 (79%), Gaps = 7/875 (0%)

Query: 97  VNEYFSTT-AQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIV 155
           VN YFST    T  KHKKGSF SFGLSKLIL NIS++GF QPTPIQRKTIPLILQSRDIV
Sbjct: 103 VNSYFSTNNLNTKTKHKKGSFASFGLSKLILTNISKRGFRQPTPIQRKTIPLILQSRDIV 162

Query: 156 GLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRS 215
           G+ARTGSGKTAAF+LPMIEKLK+HSSK+GARA+ILSPSRELAMQTH VFK+FS+G+ LRS
Sbjct: 163 GMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHNVFKEFSKGSDLRS 222

Query: 216 VLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGF 275
           VLLTGGDSLE+QFGM+M+NPDVI+ATPGRFLHLKVEMNLDLKS+EY  FDE+DRLFEMGF
Sbjct: 223 VLLTGGDSLEDQFGMIMANPDVIIATPGRFLHLKVEMNLDLKSVEYICFDEADRLFEMGF 282

Query: 276 EEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLS 335
           +EQLNEL+ +LPSNRQTLLFSATLP+SLVDFAKAGLTNPVLVRLD E+KISENLEMLFLS
Sbjct: 283 QEQLNELIYSLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKISENLEMLFLS 342

Query: 336 TKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXX 395
            K++EREA LLYL+QE I IPLATEEQIK +              +              
Sbjct: 343 IKNEEREANLLYLLQEEICIPLATEEQIKKLNNESKIDDDSDSEDDEATRRQKRKSKNFK 402

Query: 396 XVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455
             R+P ANQLPSEK+TI+FVPTRHHVEYI+ LLK+CGYLVSYIYG+LDQRARNRQLYNFR
Sbjct: 403 KQRLPPANQLPSEKATIIFVPTRHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFR 462

Query: 456 AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXX 515
            GLTSILVVTDVAARGVDIPMLANVINFS P SSK+FVHRVGRTARAGNRGWAYSI+S  
Sbjct: 463 LGLTSILVVTDVAARGVDIPMLANVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSEN 522

Query: 516 XXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCP 575
                       GKKIL T MY+A  D+++K+WV EGK ++ F+ PKPSYTNR+VLGS P
Sbjct: 523 ELPYLLDLELFLGKKILLTSMYDATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAP 582

Query: 576 RLDIDSMGDLYKNLMS-SFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDE 634
           RL ++ + DLY  ++S SF+L+ ++  A KAEKLY RTRT+AS ES+KRS+E++ SGWDE
Sbjct: 583 RLQVEDLNDLYTGVLSGSFDLKMMKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDE 642

Query: 635 QNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXXXX 694
           QN+ FGKN+EKEK  FLAKLQ+R NKETVFEFARN DDE S+LMK+RR Q+API      
Sbjct: 643 QNIRFGKNVEKEKFQFLAKLQNRHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEE 702

Query: 695 XXXXXXXXXXXGFSHAMEDELLNDNEL-IKESVPEEVLQEFEDADKLLEDQEKLGRKKSK 753
                      G +H +ED++L  ++     +VPE+ L+EFEDADK+LE   K  + + K
Sbjct: 703 RRELMEKERLAGLTHRIEDQILKGDDFEAGYTVPEDALKEFEDADKVLEASNK--KSEQK 760

Query: 754 SFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSK 813
           +FRD NFFLSHYAP   + + +  L++GFT  AA+AA D+N DDKVQVHKQ ATVKWD K
Sbjct: 761 TFRDENFFLSHYAPTSAIQDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQTATVKWDKK 820

Query: 814 KKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLR 873
           +KKY+N QG DNKKYIVGESGQKI ASFRSGK+ EWSKAR L+P+KVGARES    N+L 
Sbjct: 821 RKKYVNMQGIDNKKYIVGESGQKIAASFRSGKFEEWSKARKLKPLKVGARESTMQTNLLS 880

Query: 874 NPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRG 933
           NP +N+ ++GQ+TV GKFKHKQ+K+PKLPDK RDDY KQKKKV  AL +G +VKGY+  G
Sbjct: 881 NPTENN-SNGQKTVRGKFKHKQMKSPKLPDKFRDDYEKQKKKVASALARGAHVKGYSGPG 939

Query: 934 APKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
             KNEL+S  QIRK+R   E + AKNARPSKKRK+
Sbjct: 940 M-KNELKSTEQIRKERMAKENRRAKNARPSKKRKF 973

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1215 bits (3143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/900 (66%), Positives = 703/900 (78%), Gaps = 9/900 (1%)

Query: 76  KDKSFPKLEASGXXXXXXXXXVNE-----YFSTTAQTNKKHKKGSFPSFGLSKLILNNIS 130
           +DKSFP LE S           ++     YFS       KHKKGSF SFGLSKLIL NIS
Sbjct: 72  EDKSFPSLELSDDEDEKKKVDNDDDDVNAYFSVNTDAKSKHKKGSFASFGLSKLILVNIS 131

Query: 131 RKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVIL 190
           ++GF QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAF+LPMIEKLK+HSSK+GARA+IL
Sbjct: 132 KRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIIL 191

Query: 191 SPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKV 250
           SPSRELAMQTH VFK+FSRGTHLRSVLLTGGDSLE+QFGMMM+NPDVI+ATPGRFLHLKV
Sbjct: 192 SPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGRFLHLKV 251

Query: 251 EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAG 310
           EMNLDLKS+EYAVFDE+DRLFEMGF+EQLNELLAALPS+RQTLLFSATLP SLVDFAKAG
Sbjct: 252 EMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLVDFAKAG 311

Query: 311 LTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXX 370
           L NPVLVRLD ESKIS+NLEMLFLSTK+DEREA LLY++QEVI++PLAT EQIK +    
Sbjct: 312 LVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIKQLNDNK 371

Query: 371 XXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKN 430
                     +                 MP AN+LPSEK+T++FVPTRHHVEY++NLLK+
Sbjct: 372 ADDSDESAEEDEDKKRRKRKSFNRKA--MPKANELPSEKATVVFVPTRHHVEYLSNLLKD 429

Query: 431 CGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSK 490
           CGYLVSYIYG+LDQ AR  QLYNFR GLTSILVVTDVAARGVDIPMLANV+N+S P+SSK
Sbjct: 430 CGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPMLANVVNYSLPASSK 489

Query: 491 IFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVE 550
           IF+HRVGRTARAGNRGWAYSI+S              G+KIL TPMYEA   L +++WV 
Sbjct: 490 IFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMYEALERLSKEKWVA 549

Query: 551 EGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLY 609
           EG ++ LF++PK SYT+R+VLGSCPRLDI+++ +LY NLM S+F+L+  +  A KAEKLY
Sbjct: 550 EGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLDMAKKTALKAEKLY 609

Query: 610 LRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARN 669
            RTRT+AS ES+KRS+E+++SGWDEQNV+FGKNLEKEK  FL KLQ+R NKETVFEF RN
Sbjct: 610 FRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTRN 669

Query: 670 ADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL-NDNELIKESVPE 728
            +DE + LM +RR  +API                 G +HA+EDE+L  D+  +  +V E
Sbjct: 670 PEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEILKGDDAEVGYTVTE 729

Query: 729 EVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQ 788
           + L+ FEDAD +L +QE   +KK K+FRDPNFFLSHYAP   + + +L L+ GF  +AAQ
Sbjct: 730 DTLKAFEDADTILAEQENASKKKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQ 789

Query: 789 AACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAE 848
           +A D+N DDKVQVHKQ ATVKWD K+KKY+N  G DNKKYI+GESGQKI ASFRSGK+ E
Sbjct: 790 SAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDE 849

Query: 849 WSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDD 908
           WSKAR L P+K GA ES   +N+L +P +     G +   GKFKHK  KAP+LPDK RDD
Sbjct: 850 WSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDD 909

Query: 909 YHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
           YHKQKKKV+ AL++GI VKGYN   A K+EL+S+AQIRK R+T E +HAKNARPSKKRK+
Sbjct: 910 YHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF 969

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/898 (67%), Positives = 707/898 (78%), Gaps = 13/898 (1%)

Query: 79  SFPKLEASGXXX-----XXXXXXVNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKG 133
           SFP LE S               VN YFSTT     KHKKGSFPSFGLSK I++NI+RKG
Sbjct: 85  SFPSLELSDDEADRRNNEDEDDDVNAYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKG 144

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPS 193
           F QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAFILPMIEKLK+HS K+GARAVILSPS
Sbjct: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPS 204

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMN 253
           RELAMQTH VFKDFS+GT LRSVLLTGGDSLE+QFGMMM+NPDVI+ATPGRFLHLKVEMN
Sbjct: 205 RELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMN 264

Query: 254 LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           LDLKSIEYAVFDE+DRLFEMGF+EQLNELLA+LPS+RQTLLFSATLP+SLVDFAKAGLTN
Sbjct: 265 LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTN 324

Query: 314 PVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXX 373
           PVLVRLD E+KISENLEMLFLSTK+DEREA LLYL+QEVI+IPLA+ +Q+          
Sbjct: 325 PVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIKD 384

Query: 374 XXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGY 433
                  +G               R+P ANQLPSEKSTILFVPTRHHVEYI+NLL+  GY
Sbjct: 385 NASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGY 444

Query: 434 LVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFV 493
           L+SYIYG+LDQ AR RQLYNFR GLTSILVVTDVAARGVDIPMLANVINFS P+SSKIFV
Sbjct: 445 LISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFV 504

Query: 494 HRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGK 553
           HRVGRTARAGNRGWAYSI+S              GKKIL TPMY++ +D++ K+W+ EG 
Sbjct: 505 HRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGH 564

Query: 554 EKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRT 612
           ++I FK PK SYTNR++LGS PRL+++ +GDLY+N+M S+FE++ L+GVA KAEKLY RT
Sbjct: 565 DEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRT 624

Query: 613 RTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADD 672
           R AAS ES+KRS+E++ SGWDEQN+MFGKN EKEKLDFLAKLQ+R NKETVFEFA N DD
Sbjct: 625 RPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDD 684

Query: 673 ETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL-NDN-ELIKESVPEEV 730
           E S+ MK+RR Q+API                 G +H MEDE+L  DN E    ++ E+ 
Sbjct: 685 EMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDT 744

Query: 731 LQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAA 790
           L++FED D+LL  QE   +KK K+F+DP FFLSHYAP   + + +L + +GF  +AAQAA
Sbjct: 745 LKQFEDGDELLAGQE--NKKKKKTFKDPTFFLSHYAPASDIQDKQLQVANGFANEAAQAA 802

Query: 791 CDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWS 850
            D+N DDKVQVHKQ ATVKWD K+KKY+N QG DNKKYI+GESGQKI ASFRSGK+ EW+
Sbjct: 803 YDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWT 862

Query: 851 KARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYH 910
           KAR L+P+KVGARES   +N+L +P Q      Q +V GKFKHKQ+KAPKLPDKHRDDY 
Sbjct: 863 KARKLKPLKVGARESSIPSNLLSDPTQG--PGAQNSVRGKFKHKQLKAPKLPDKHRDDYQ 920

Query: 911 KQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
            QKKKV +AL+ G+ V+G+   G  K+EL+S  +IRKQR   EKK AKNARP+K+RKY
Sbjct: 921 TQKKKVAKALENGVQVRGFRGPGM-KSELKSTEEIRKQRAFMEKKRAKNARPAKRRKY 977

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/878 (67%), Positives = 699/878 (79%), Gaps = 8/878 (0%)

Query: 97   VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
            VNEYFSTT     KHKKGSFPSFGLSK++LNNI RKGF QPTPIQRKTIPLILQSRDIVG
Sbjct: 132  VNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVG 191

Query: 157  LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
            +ARTGSGKTAAFILPM+EKLKSHS K+GARAVILSPSRELAMQT  VFK+F+RGT LRSV
Sbjct: 192  MARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKEFARGTALRSV 251

Query: 217  LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
            LLTGGDSLEEQF MMMSNPDVI+ATPGRFLHLKVEMNLDLKS+EY VFDE+DRLFEMGF+
Sbjct: 252  LLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQ 311

Query: 277  EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
            EQLNELLA+LP+ RQTLLFSATLPNSLVDF KAGL NPVLVRLD E+K+SENLEMLF+ST
Sbjct: 312  EQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSENLEMLFVST 371

Query: 337  KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXX-X 395
            K+D+REA LLY++QEVI+IPLAT EQ++ +              N               
Sbjct: 372  KNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDNDRQKKRKNFKKEKFR 431

Query: 396  XVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455
              RMP  N+LPSEK+TILFVPTRHHVEYI+ LL++CG+L+SYIYG+LDQ AR RQLYNFR
Sbjct: 432  KQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYGTLDQHARKRQLYNFR 491

Query: 456  AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXX 515
            AGLTSILVVTDVAARGVDIPMLANVIN++ P SSKIFVHRVGRTARAGN+GWAYSI++  
Sbjct: 492  AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAEN 551

Query: 516  XXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCP 575
                        GKKIL  PMY++   L++KRWV+EGK +  F+ P  SYT RLVLGSCP
Sbjct: 552  ELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQPPTLSYTKRLVLGSCP 611

Query: 576  RLDIDSMGDLYKNLMSS-FELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDE 634
            RLD++ +GDLYKNLM+S F+L+  +  A KAE+LY RTRTAAS ES+KRS+E++ SGWD 
Sbjct: 612  RLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPESLKRSKEIIASGWDA 671

Query: 635  QNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXXXX 694
            QN  FGKN EKEKLDFLAKLQ+R NKETVFEF RN DDE S+LMK+RR Q+API      
Sbjct: 672  QNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMKRRRKQLAPIQRKSRE 731

Query: 695  XXXXXXXXXXXGFSHAMEDELL--NDNELIKESVPEEVLQEFEDADKLLEDQEK--LGRK 750
                       G SH++EDE+L  ND E    ++ E+ L+EFEDAD+LLE QE     +K
Sbjct: 732  RRELLEKERMAGLSHSIEDEILKGNDGE-TGYTISEDALKEFEDADQLLEAQENDSKKKK 790

Query: 751  KSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKW 810
            K K+F+DP+FFLSHYAP G + + +L +T GF  DAA AA D+NGDDKVQVHKQ ATVKW
Sbjct: 791  KPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHKQTATVKW 850

Query: 811  DSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAAN 870
            D K+KKY+N+QG DNKKYI+GESGQKI ASFRSG++ +WSKARNL+P+KVG+RES   +N
Sbjct: 851  DKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSN 910

Query: 871  MLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYN 930
            +L +P+Q     G   V GKFKHKQ+KAPK+PDKHRD+Y+ QKKKV++AL  G+NV+GYN
Sbjct: 911  LLADPSQGPGARGG-AVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGVNVRGYN 969

Query: 931  TRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
                 ++EL+S  QIRK R  ++KK AKNARP+KKRK+
Sbjct: 970  NAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRKF 1007

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/898 (65%), Positives = 701/898 (78%), Gaps = 16/898 (1%)

Query: 77  DKSFPKLEASGXXXXXXXXX---VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKG 133
           D  FP LE S             +N+YF+TTA    KHKKGSF SFGLSKL+L NIS+KG
Sbjct: 86  DSKFPSLELSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKG 145

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPS 193
           F QPTPIQRKTIPLILQ RDIVG+ARTGSGKTAAF+LPMIEKLK+HS+K+G RAVILSPS
Sbjct: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPS 205

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMN 253
           RELA+QTH+VFK+FS+G+ LRS+LLTGGDSLE+QFGMMM NPDV++ATPGRFLHLKVEMN
Sbjct: 206 RELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMN 265

Query: 254 LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           LDLKS+EY VFDE+DRLFEMGF+EQLNELL A P+NRQTLLFSATLP+SLVDFAKAGL+N
Sbjct: 266 LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSN 325

Query: 314 PVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXX 373
           PVLVRLD E+KISENLEMLF+S K DEREA LLYL+QE I++P+ATE QIK +       
Sbjct: 326 PVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNDAD 385

Query: 374 XXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGY 433
                  +                R+P AN++PSEK+TI+FVPTRHHVEY+  LLKNCGY
Sbjct: 386 SDSDDSEDEKKKKAKKAKKSKR--RLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGY 443

Query: 434 LVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFV 493
           LVSYIYG+L+Q AR +QLYNFRAGLTSILVVTDVAARGVDIP+LANVIN+S P SSKIF+
Sbjct: 444 LVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFI 503

Query: 494 HRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGK 553
           HRVGRTARAGNRGWA+SI+S              GKKIL TPMYE++  +L K+   EG 
Sbjct: 504 HRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILLTPMYESSCQILRKKAESEGN 563

Query: 554 EKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRT 612
               F  PK SYT R+VLG+CPR +ID MGDLY N++ S FEL T++GVA KAEKLY RT
Sbjct: 564 NN--FTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRT 621

Query: 613 RTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADD 672
           RT AS ES+KRS+E++ SGWDEQN+ FGKN EKEKLDFLAKLQ R NKETVFEFARN DD
Sbjct: 622 RTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDD 681

Query: 673 ETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL--NDNELIKESVPEEV 730
           E S+LMK+RR Q+API                 G  H++EDE+L   DNE +  SVP+EV
Sbjct: 682 EMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDNE-VGYSVPDEV 740

Query: 731 LQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAA 790
           L+EFEDAD LLE+QE + +K+ K+FRDP F+LSH+AP   + + +L ++SGFT DA+ AA
Sbjct: 741 LKEFEDADVLLEEQENIKKKQKKTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAA 800

Query: 791 CDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWS 850
            D+  DDKVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+GESGQKIPASFRSGK+ +WS
Sbjct: 801 FDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWS 860

Query: 851 KARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYH 910
           KAR + P+KVGARES   +N+L +P     +  +RTVGGKFKHK  KAPKLPDKHRDDY 
Sbjct: 861 KARKIAPLKVGARESTIPSNLLADPT----SPSERTVGGKFKHKTQKAPKLPDKHRDDYA 916

Query: 911 KQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
            QKKKV+ AL++G+ VKGYN  G  K E++S+ +IRK R+  EKK +KNARP+K+RK+
Sbjct: 917 FQKKKVEAALERGVRVKGYNGPGM-KQEIKSVDEIRKLREIKEKKRSKNARPTKRRKH 973

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 1200 bits (3105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/903 (66%), Positives = 704/903 (77%), Gaps = 14/903 (1%)

Query: 79   SFPKLE-------ASGXXXXXXXXX-VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNIS 130
            +FP LE       ASG          VNEYFSTT     KHKKGSFPSFGLSK++LNNI 
Sbjct: 100  AFPTLELSDDENDASGKTQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIK 159

Query: 131  RKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVIL 190
            RKGF QPTPIQRKTIPLILQSRDIVG+ARTGSGKTAAFILPM+EKLKSHS K+GARAVIL
Sbjct: 160  RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 219

Query: 191  SPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKV 250
            SPSRELAMQT  VFKDF++GT LRSVLLTGGDSLEEQF MMMSNPDVI+ATPGRFLHLKV
Sbjct: 220  SPSRELAMQTFNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 279

Query: 251  EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAG 310
            EMNLDLKS+EY VFDE+DRLFEMGF+EQLNELLA+LP+ RQTLLFSATLPNSLVDF KAG
Sbjct: 280  EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAG 339

Query: 311  LTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXX 370
            L NPVLVRLD E+K+SENLEMLFLS+K+ +REA LLY++QEVI+IPLAT EQ++ +    
Sbjct: 340  LVNPVLVRLDTETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSN 399

Query: 371  XXXXXXXXXXNGXXXXXXXXXXXX-XXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLK 429
                      N                 +MPAAN+LPSE++TILFVPTRHHVEYI+ LL+
Sbjct: 400  NEADSDSDDENDRHKKKRNFKKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLLR 459

Query: 430  NCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSS 489
            +CGYL+SYIYG+LDQ AR RQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN++ P SS
Sbjct: 460  DCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSS 519

Query: 490  KIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWV 549
            KIFVHRVGRTARAGN+GWAYSI+S              GKKIL  PMY+   D ++KRW+
Sbjct: 520  KIFVHRVGRTARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWI 579

Query: 550  EEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLMSS-FELETLRGVAKKAEKL 608
            +EG  +  F+ PK SYT RLVLGSCPRLD++ +GDLYKNLM+S F+L+     + KAEKL
Sbjct: 580  DEGNLEFQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKL 639

Query: 609  YLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFAR 668
            Y RTRT+AS ES+KRS+E++ SGWD QN  FGKN EKEKLDFLAKLQ+R NKETVFEF R
Sbjct: 640  YYRTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTR 699

Query: 669  NADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL-NDNELIKESVP 727
            N DDE ++LMK+RR Q+API                 G SH++E+E+L  D+     +V 
Sbjct: 700  NPDDEMAVLMKRRRKQLAPIQRKASERRKLLEKERMAGLSHSIENEILKGDDGETGYTVS 759

Query: 728  EEVLQEFEDADKLLEDQEK--LGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTD 785
            EE L+EFEDAD+LLE QE     +KK K+F+DP FFLSHYAP G + + +L + SGF  D
Sbjct: 760  EEALKEFEDADQLLEAQENDSKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFAND 819

Query: 786  AAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGK 845
            AA AA D+N DDKVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+GESGQKI ASFRSG+
Sbjct: 820  AAHAAYDLNTDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGR 879

Query: 846  YAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKH 905
            + +WSKARNL+P+K G+RES   +N+L +P+Q   ++G RT  GKFKHKQ+KAPK+PDKH
Sbjct: 880  FDDWSKARNLKPLKAGSRESSIPSNLLADPSQGPGSNG-RTARGKFKHKQMKAPKMPDKH 938

Query: 906  RDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKK 965
            RD+Y+ QKKKV++AL  G+NVKG+N      +EL+S  QIRK R  +EKK AKNARPSKK
Sbjct: 939  RDNYYSQKKKVEKALQSGVNVKGHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKK 998

Query: 966  RKY 968
            RK+
Sbjct: 999  RKF 1001

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1196 bits (3095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/916 (66%), Positives = 710/916 (77%), Gaps = 33/916 (3%)

Query: 79   SFPKLE---ASGXXXXXXXXXVNEYFSTTAQTNK-KHKKGSFPSFGLSKLILNNISRKGF 134
            SFP LE   A           VN+YFSTTA     KHKKGSFPSFG SK ILNNISRKGF
Sbjct: 95   SFPTLELSDAEDEAPDADKDAVNDYFSTTAAAAAGKHKKGSFPSFGFSKFILNNISRKGF 154

Query: 135  HQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSR 194
             QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAF LPMIEKLK HS+K+G RAVILSPSR
Sbjct: 155  RQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSR 214

Query: 195  ELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNL 254
            ELAMQT+KVFK+FSRG+ LRSVLLTGGDSLEEQFGMMM NPDV++ATPGRFLHLKVEMNL
Sbjct: 215  ELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNL 274

Query: 255  DLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNP 314
            DLK++EY VFDE+DRLFEMGF+EQLNELLAALP  RQTLLFSATLP+SLVDFAKAGLTNP
Sbjct: 275  DLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNP 334

Query: 315  VLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXX 374
            VLVRLD ESK+SENLEMLFL+TK+ EREA LLYL+QEVI+IP+AT EQ+K +        
Sbjct: 335  VLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALNDRSD 394

Query: 375  XXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYL 434
                                   +MP+AN+LPSEK+TILFVPTRHHVEY++ LLK+ GYL
Sbjct: 395  SDADSDA-NDKNDRKKRKKQARRKMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYL 453

Query: 435  VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
            VSYIYG+LDQ AR +QL+NFR+GLTSILVVTDVAARGVDIPMLANVINFS PSSSKIF+H
Sbjct: 454  VSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIH 513

Query: 495  RVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKE 554
            RVGRTARAGN GWAYSI+S              GKKIL  PMY+A  +L+ K+WV EGK+
Sbjct: 514  RVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMYDATCELMRKQWVAEGKQ 573

Query: 555  KILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTR 613
            +  F AP+ SYTNR+VLGSCPRL+++SMGDLYKNL+ SSF+L+ L+ VA KAEKLY RTR
Sbjct: 574  ESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTR 633

Query: 614  TAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDE 673
              AS E++KRS+E++ SGWDEQN+ FGKNLEKEKLDFLAKLQ+R +KETVFEFARN +DE
Sbjct: 634  APASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDE 693

Query: 674  TSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL--NDNELIKESVPEEVL 731
             ++LM++RR Q+API                 G  H +EDE+L   D E    SVPEEVL
Sbjct: 694  MAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTLEDEVLKGGDGEF-GYSVPEEVL 752

Query: 732  -QEFEDADKLLEDQE------------------KLGRKKSKSFRDPNFFLSHYAPQGGLH 772
             QEFEDADK+L++QE                     + K K+++DPNFFLSHYAP G + 
Sbjct: 753  AQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPKPKPKTYKDPNFFLSHYAPAGDIQ 812

Query: 773  ENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGE 832
            + +L LTSGFT DAA A  D++ D+KVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+GE
Sbjct: 813  DKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGE 872

Query: 833  SGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFK 892
            SGQKIPASFRSGK+AEWSKAR L P+KVGARE+   +N+L +PA    + G+R  GG+FK
Sbjct: 873  SGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPA----SGGRRVAGGRFK 928

Query: 893  HKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTS 952
            HK  KAPKLPD+HRDDY  Q+KKV  AL++GI+VKG+   GA K+E++S  QIR QR   
Sbjct: 929  HKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGA-KSEMKSTEQIRSQRVAK 987

Query: 953  EKKHAKNARPSKKRKY 968
            +K+ AKNARPSKKRK+
Sbjct: 988  DKRLAKNARPSKKRKF 1003

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/875 (66%), Positives = 698/875 (79%), Gaps = 10/875 (1%)

Query: 100 YFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLAR 159
           YFS       KHKKGSFPSFG SKLIL+N+ +KGF QPTPIQRKTIPLILQ RDIVG+AR
Sbjct: 107 YFSINNSEKSKHKKGSFPSFGFSKLILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMAR 166

Query: 160 TGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLT 219
           TGSGKTAAF+LPMIEKLKSHSSK+GARAVILSPSRELA+QTH+VFK+FS+GTHLRSVLLT
Sbjct: 167 TGSGKTAAFVLPMIEKLKSHSSKIGARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLT 226

Query: 220 GGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           GGDSLE+QF MMMSNPDVIVATPGRFLHLKVEM+LDLK++EY VFDE+DRLFEMGF+EQL
Sbjct: 227 GGDSLEDQFSMMMSNPDVIVATPGRFLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQL 286

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
           NELLAALP NRQTLLFSATLP+SLVDFAKAGLTNPVLVRLD E+KISENLE+LFLSTK++
Sbjct: 287 NELLAALPMNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEILFLSTKNE 346

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIX---XXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
           ERE  LLYL+Q+VI+IPL T++QIK +                  G              
Sbjct: 347 ERENNLLYLLQDVIKIPLGTDDQIKKLSDFNKSLSDSDSEDEDNKGKQNSRKSKKGKFQK 406

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRA 456
           +++ A+N+LP+EKSTI+F PTRHHVEYI  LLK+ G+LVSY+YG+LDQ AR RQL NFRA
Sbjct: 407 LKVSASNELPTEKSTIVFAPTRHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRA 466

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXX 516
           GLTSILVVTDVAARGVDIPMLANVIN+S P+SSKIF+HRVGRTARAGNRGWAYSI+S   
Sbjct: 467 GLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETE 526

Query: 517 XXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPR 576
                      GKKIL T MYEA+  L++ +W+ +G  +  F+ PK SYTNRLVLGS PR
Sbjct: 527 LPYMLDLELFLGKKILLTSMYEASCKLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPR 586

Query: 577 LDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQ 635
            DI+S+GDLYKN++ S+F+L+  + V+ KAEKLY RTRTAAS ES+KRS+E++ SGWDEQ
Sbjct: 587 YDIESVGDLYKNIIESNFDLQMAKKVSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQ 646

Query: 636 NVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXXXXX 695
           N+ FG+NLEKEKL+FLAK Q+R NKETVFEF +N +D+T++LM+KRR Q+API       
Sbjct: 647 NIRFGRNLEKEKLNFLAKFQNRRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKR 706

Query: 696 XXXXXXXXXXGFSHAMEDELL-NDNELIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKS 754
                     G +H +EDE+L  ++     SVPEE L+ FEDADK+LE+QE   +KKSK+
Sbjct: 707 QELLDKERVAGLTHKIEDEILKGEDHEAGYSVPEEALKSFEDADKILEEQESSRKKKSKT 766

Query: 755 FRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKK 814
           FRDPNFF+SHYAP G + + +L +TSGFT DAAQAA D+N DDKVQVHKQ ATVKWD K+
Sbjct: 767 FRDPNFFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKR 826

Query: 815 KKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLRN 874
           KKY+N QG DNKKYI+GESGQKIPASF+SGK+AEWSK+RN++ IK GARE+    N+L +
Sbjct: 827 KKYVNMQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKGIKTGARETSIPTNLLSD 886

Query: 875 PAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGA 934
           P  +  +  QR  GG+FKHKQ KAP+LPDK RDDY  QKKKV+ A+++G++VKG+   G+
Sbjct: 887 PTTD--SGSQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVSVKGFG--GS 942

Query: 935 PKN-ELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
             N EL++ AQIRK+R   EKK  KNARP+KKRK+
Sbjct: 943 SGNTELKTTAQIRKERMAKEKKRQKNARPTKKRKF 977

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3.159
            YDL031W
          Length = 1001

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/909 (64%), Positives = 709/909 (77%), Gaps = 19/909 (2%)

Query: 77   DKSFPKLE-----ASGXXXXXXXXXVNEYFSTTAQTNK-KHKKGSFPSFGLSKLILNNIS 130
            + +FP LE     +S          VN YFST  Q  K K KKGSF SFGLSK IL+N++
Sbjct: 95   ENAFPSLELSDDESSKAAGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLSKAILSNVT 154

Query: 131  RKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVIL 190
            RKGF QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAF+LPMIEKLK+HSSK+G RA+IL
Sbjct: 155  RKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGVRAIIL 214

Query: 191  SPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKV 250
            SPSRELA+QTH VFKDFS+GTHLRSVLLTGGDSLEEQFGMMMSNPDV++ATPGRFLHLKV
Sbjct: 215  SPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGRFLHLKV 274

Query: 251  EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAG 310
            EMNL LK++EYAVFDE+DRLFEMGF+EQLNELLAALPS+RQTLLFSATLP+SLV+FAKAG
Sbjct: 275  EMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLVEFAKAG 334

Query: 311  LTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXX 370
            LTNPVLVRLD ESKISENL+MLFLS K+DEREA LLYL+Q VI+IPLAT EQ+K +    
Sbjct: 335  LTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLKKLRDSD 394

Query: 371  XX------XXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYI 424
                             G               R+PAAN+LPSE +T++FVPTRHHVEYI
Sbjct: 395  AKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVPTRHHVEYI 454

Query: 425  ANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFS 484
            + +LK+CGYLVSYIYGSLDQ AR  QLYNFR GLTSILVVTDVAARGVDIPMLANVIN+S
Sbjct: 455  SQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPMLANVINYS 514

Query: 485  FPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLL 544
             PSSSKIF+HRVGRTARAGN+GWAY+I+S               KK+L TPM EA   +L
Sbjct: 515  LPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPMLEAKNAIL 574

Query: 545  EKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAK 603
            +++W+++G +++ FK P  SYT+R+VLGSCPRLD++SMGDL+KN++ ++F+L  ++  + 
Sbjct: 575  KQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDLSLMKATSL 634

Query: 604  KAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETV 663
            KAEKLY RTRT AS+ES+KRS+E++ SGWDEQN++FG N+EKEK++FLAKLQ+R NKETV
Sbjct: 635  KAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQNRRNKETV 694

Query: 664  FEFARNADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELLNDNELIK 723
            FEF+RN DDE S+ MK+RR Q+AP+                 G SH++EDE+ N N   +
Sbjct: 695  FEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSIEDEIFNQNNNTE 754

Query: 724  ----ESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLT 779
                 +V EE L++FEDAD+LL+ Q +  + K K+++DPNFFLSHYAP   + + +L +T
Sbjct: 755  METGYTVSEEALKQFEDADELLQKQSE-KKTKPKNYKDPNFFLSHYAPAADIQDKQLQVT 813

Query: 780  SGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPA 839
            SGFT DAAQAA D+N DDKVQVHKQ ATVKWD K+KKY+N QG DNKKYI+GESGQKI A
Sbjct: 814  SGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIAA 873

Query: 840  SFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAP 899
            SFRSGK+ EWSKAR+++P+KVGA+E     ++LR+P       G RT  GK+KHKQ KAP
Sbjct: 874  SFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNISGNRTASGKYKHKQDKAP 933

Query: 900  KLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKN 959
            KLPDKHRD+YH QKKK+  A+++G  VKG+N  G  ++EL+S AQIRK R  +EKK AKN
Sbjct: 934  KLPDKHRDNYHSQKKKIASAMERGTYVKGFNGPGT-QSELKSTAQIRKGRLQAEKKKAKN 992

Query: 960  ARPSKKRKY 968
            ARP+KKRK+
Sbjct: 993  ARPNKKRKF 1001

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/878 (66%), Positives = 690/878 (78%), Gaps = 9/878 (1%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           VN+YFST  Q   KHKKGSFPSFGLSKLIL+NI++KGF QPTPIQRKTIPLILQ RDIVG
Sbjct: 107 VNDYFSTNMQDKSKHKKGSFPSFGLSKLILSNINKKGFRQPTPIQRKTIPLILQRRDIVG 166

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
           +ARTGSGKTAAFILPMIEKLK+HS K+GARAVILSPSRELAMQTHKVFKDFSRG+ LRSV
Sbjct: 167 MARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHKVFKDFSRGSQLRSV 226

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
           LLTGGDSLEEQF MMMSNPDVIVATPGRF+HLKVEM LDLK++EY VFDE+DRLFEMGF+
Sbjct: 227 LLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQ 286

Query: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
           EQLNELLA+LP NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD ESKISENL++ F ST
Sbjct: 287 EQLNELLASLPMNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDAESKISENLQLAFFST 346

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXN----GXXXXXXXXXX 392
           K++EREA LLY++Q+VI + + TEE+IK +                              
Sbjct: 347 KNEEREATLLYILQDVIDLQIGTEEEIKKLTASNKRSDEIDSDNEREQADRKLNKKKKFE 406

Query: 393 XXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLY 452
                ++P+AN+LPSEK+TI+FVPTRHHVEYI+NLLK+CGYLVSY+YG+LDQ AR  QL+
Sbjct: 407 KFIKPKLPSANELPSEKATIVFVPTRHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQLF 466

Query: 453 NFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           NFRAGLTSILVVTDVAARGVDIPMLANVIN+S P+SSKIFVHRVGRTARAGN+GWAYSI 
Sbjct: 467 NFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFVHRVGRTARAGNKGWAYSIA 526

Query: 513 SXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLG 572
           S              GKKIL T MYEA   L + +W+  G E+  F+ PKPSYT+R++LG
Sbjct: 527 SETELPYLLDLELFLGKKILLTQMYEATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILG 586

Query: 573 SCPRLDIDSMGDLYKNLMS-SFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSG 631
           SCPRL+++++GDLYKN+MS SF+L+  +  + KAEKLY RTRTAAS ES+KR +EL+ SG
Sbjct: 587 SCPRLELENIGDLYKNIMSASFDLQMAKKTSLKAEKLYFRTRTAASPESIKRGKELIASG 646

Query: 632 WDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXX 691
           WDEQ++MFGKN+EKEKLDFL+K Q+R NKETVFEF RN  D T++LM +RR Q+API   
Sbjct: 647 WDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQRK 706

Query: 692 XXXXXXXXXXXXXXGFSHAMEDELL-NDNELIKESVPEEVLQEFEDADKLLEDQEKLGRK 750
                         G SHA+EDE+L  ++     ++ +E L  FEDADKLL++QEK  RK
Sbjct: 707 AVERRKLLEKERLAGLSHALEDEILKGEDHESGYTISKEALAAFEDADKLLQEQEKKKRK 766

Query: 751 KSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKW 810
                +DP FFLSHYAP   + + +LNLTSGFT DAAQAA D+N DDKVQVHKQ A +KW
Sbjct: 767 PKTY-KDPQFFLSHYAPAKDIQDKQLNLTSGFTNDAAQAAYDLNNDDKVQVHKQTANIKW 825

Query: 811 DSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAAN 870
           D  +KKY+N  G DNKKYI+GE GQKIPASF+SG++ EWSKAR+++P+K G RE     N
Sbjct: 826 DKGRKKYVNINGLDNKKYIIGEGGQKIPASFKSGRFDEWSKARHIKPLKAGVREDSIPTN 885

Query: 871 MLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYN 930
           +L +     P+DG RT GG+FKHKQ KAP+LPDKHRDDY  QKKKV+ AL++G+ VKGYN
Sbjct: 886 LLADVT--GPSDGSRTFGGRFKHKQNKAPRLPDKHRDDYESQKKKVQNALERGVQVKGYN 943

Query: 931 TRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
            R + K+EL+++AQIRK+R  +E K  KNARPSKKRKY
Sbjct: 944 NRNSVKSELKTVAQIRKERMVNENKQKKNARPSKKRKY 981

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/875 (66%), Positives = 696/875 (79%), Gaps = 10/875 (1%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           V EYFST      KHKKGSF SFGLSK I++NI++KGF QPTPIQRKTIPLILQ RDIVG
Sbjct: 105 VTEYFSTNNPEAAKHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKRDIVG 164

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
           +ARTGSGKTAAF+LPMIEKLK HS+K+GARAVILSPSRELAMQTHKVF++FSRG+ LRSV
Sbjct: 165 MARTGSGKTAAFVLPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRGSDLRSV 224

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
           LLTGG+SLEEQFG+MMSNPDV++ATPGRFLHLKVEMNLDLKS+EY VFDE+DRLFEMGFE
Sbjct: 225 LLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEADRLFEMGFE 284

Query: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
           EQL+ELLAALP  RQTLLFSATLP+SLV+FAKAGLTNPVLVRLD E+K+SENLEMLFLS+
Sbjct: 285 EQLSELLAALPVARQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVSENLEMLFLSS 344

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
           K++EREA LLYL+QE ++IP+ATEEQ+                                 
Sbjct: 345 KNEEREANLLYLLQEAMKIPVATEEQLLEYKAKVKNSYDSDDSDEDAKAKAKKQRKSAIR 404

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRA 456
            ++P+AN+LPSE +TI+FVPTRHHVEYI+ LLK+CGYLVSY+YG+LDQ AR +QL+NFRA
Sbjct: 405 KKLPSANELPSEHATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRA 464

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXX 516
           GLT+ILVVTDVAARGVDIP+LANV+N+S P+SSKIFVHRVGRTARAGN+G+AYSI+S   
Sbjct: 465 GLTTILVVTDVAARGVDIPLLANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVSENE 524

Query: 517 XXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPR 576
                      GKKIL TPM+EA T+LL+ +W+ EG  ++ F  PK SYTNR+VLG+CPR
Sbjct: 525 LPYLLDLELFLGKKILLTPMFEATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPR 584

Query: 577 LDIDSMGDLYKNL-MSSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQ 635
           LD+++ GDL+KNL  SSF+L+ L+GVA KAEKLY RTR  AS +S+KRS+E++ SGWDEQ
Sbjct: 585 LDLETCGDLFKNLTQSSFDLQQLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQ 644

Query: 636 NVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXXXXX 695
           N+ FGKN+EKEKLDFLAKLQ+R NKETVFEFARN DDE S+LMKKRR Q+API       
Sbjct: 645 NLRFGKNIEKEKLDFLAKLQNRNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKER 704

Query: 696 XXXXXXXXXXGFSHAMEDELL-NDNELIKESVPEEVL-QEFEDADKLLEDQEKLGRKKSK 753
                     G  H +EDE+L  D   +  SVPEEVL +EF+DAD+LL  Q K   K+ K
Sbjct: 705 KELLEKERMAGLRHTVEDEILKGDENEVGYSVPEEVLHREFQDADELLGAQSK--SKRPK 762

Query: 754 SFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSK 813
           SFRDP FFLSHYAP   + + +L +T+GFT +AA A  D++ DDKVQ HKQ AT KWD K
Sbjct: 763 SFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQVATTKWDKK 822

Query: 814 KKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLR 873
           ++KY+N+QG DNKKYI+GESG KIPASFRSGK+ EWSKAR L P+KVGA+ES T A ML 
Sbjct: 823 RQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKESSTTAKMLS 882

Query: 874 NPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRG 933
           NP      +GQR++GG+FKH +V+APKLPDKHRDDYH QKKKV++A+  GI VKGYN  G
Sbjct: 883 NPT----AEGQRSIGGRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIPVKGYNAPG 938

Query: 934 APKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
             K+E++S  QI K+R   EKK AKNARP+KKRK+
Sbjct: 939 M-KSEMRSTQQIYKERVAKEKKRAKNARPAKKRKF 972

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/900 (65%), Positives = 707/900 (78%), Gaps = 14/900 (1%)

Query: 76  KDKSFPKLEASGXXXXXXXXX----VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISR 131
           K  SFP LE S              V EYF+TT     KHKKGSF SFGLSK I++NI++
Sbjct: 81  KQASFPLLELSDDEEEQAANDGEDDVTEYFTTTNAEASKHKKGSFASFGLSKFIISNIAK 140

Query: 132 KGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILS 191
           KGF QPTPIQRKTIPLILQ RDIVG+ARTGSGKTAAF+LPMIE+LK HS+K+GARAVI+S
Sbjct: 141 KGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIGARAVIMS 200

Query: 192 PSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVE 251
           PSRELA+QTHKVF++FSRG+ LRSVLLTGG+SLEEQFG+MMSNPDV++ATPGRFLHLKVE
Sbjct: 201 PSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVE 260

Query: 252 MNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGL 311
           MNLDLKSIEY VFDE+DRLFEMGFEEQLNELLAA P  RQTLLFSATLP+SLVDFAKAGL
Sbjct: 261 MNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLVDFAKAGL 320

Query: 312 TNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXX 371
           T+PVLVRLD E+K+SENLEML+LS+K++EREA LLYL+QE +QIP+ATEEQ+        
Sbjct: 321 TSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQLAEYRTKIK 380

Query: 372 XXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNC 431
                    +                +MPAAN+LPSE +TI+FVPTRHHVEYI  LLK+C
Sbjct: 381 DDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHATIVFVPTRHHVEYITQLLKDC 440

Query: 432 GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKI 491
           GYLVSY+YG+LDQ AR +QL+NFRAGLT+ILVVTDVAARGVDIPMLANV+N+S P+SSKI
Sbjct: 441 GYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPMLANVVNYSLPASSKI 500

Query: 492 FVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEE 551
           FVHRVGRTARAGN+G AYSI+S              GKKIL TPMYEA T++L+ RW+ E
Sbjct: 501 FVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMYEATTEMLKSRWIAE 560

Query: 552 GKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYL 610
           GK ++ F APK SYTNR+VLG+CPRL++++ GDL+K+L+ SSF+L+ L+ VA KAEKLY 
Sbjct: 561 GKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLKQLKAVANKAEKLYF 620

Query: 611 RTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNA 670
           RTR  AS +S+KRS+E+++SGWDEQN+ FGKN+EKEKLDFLAKLQ+R +KETVFEFARN 
Sbjct: 621 RTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQNRHHKETVFEFARNH 680

Query: 671 DDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELLNDNEL-IKESVPEE 729
           DDE ++LMKKRR Q+API                 G  H++EDE+L  +E  +  SVPEE
Sbjct: 681 DDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSVEDEILKGDETEVGYSVPEE 740

Query: 730 VL-QEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQ 788
           VL QEFEDAD+LLE Q+K   KK KSFRDP +FLSHYAP   + + +L +++GFT +AA 
Sbjct: 741 VLHQEFEDADELLEGQKK--EKKQKSFRDPTYFLSHYAPASEIQDKQLEVSNGFTNEAAN 798

Query: 789 AACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAE 848
           A  D++ DDKVQ HKQ AT+KWD K++KY+NSQG DNKKYI GESG KIPASFRSGK+ E
Sbjct: 799 ATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGLDNKKYITGESGHKIPASFRSGKFDE 858

Query: 849 WSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDD 908
           WSKAR L PIKVGARES + + ML NP  N+    QR  GGKFKH +VKAPKLPDK+RDD
Sbjct: 859 WSKARKLGPIKVGARESSSTSKMLSNPTSNN----QRMGGGKFKHNKVKAPKLPDKNRDD 914

Query: 909 YHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968
           YH QKKKV++A+  GI VKG+N  G  K+E+++  QI K+R   EKK AKNARP+KKRKY
Sbjct: 915 YHVQKKKVEKAISSGIRVKGFNAPGM-KSEMRTPQQIYKERVAKEKKRAKNARPAKKRKY 973

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1187 bits (3070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/878 (67%), Positives = 706/878 (80%), Gaps = 12/878 (1%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           ++EYF+T    +KKHKKGSFPSFG SK ILNNI++KGF QPTPIQRKTIPLILQ+RDIVG
Sbjct: 106 ISEYFTTNNSESKKHKKGSFPSFGFSKFILNNINKKGFRQPTPIQRKTIPLILQNRDIVG 165

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
           +ARTGSGKTAAF+LPMIEKLK+HSSK+GARAVILSPSRE+AMQT+KVFK+FS+G+ LRSV
Sbjct: 166 MARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSV 225

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
           LLTGGDSLE+QFGMMMSNPDV+VATPGRFLHLKVEMNL+LKS+EYAVFDE+DRLFEMGF 
Sbjct: 226 LLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFA 285

Query: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
           EQLNELLA+LP  RQTLLFSATLPN+LVDFAKAGLTNPVLVRLD ESKISENLEMLF+ST
Sbjct: 286 EQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST 345

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXX--XXXXXXXXXXXXNGXXXXXXXXXXXX 394
           KHDEREA L YL+QEVI+IPLATEEQ  ++                NG            
Sbjct: 346 KHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGKKDRRKKGKKNK 405

Query: 395 XXV-RMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYN 453
               ++P+AN+LPSEK+TI+FVPTRHHVEYI+ LLK CGYLVSYIYG+LDQ AR RQLYN
Sbjct: 406 AKRPKLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYN 465

Query: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           FRAGLTSILVVTDVAARGVDIPMLANVINF+ PSSSKIFVHRVGRTARAGNRGWAYSI+S
Sbjct: 466 FRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525

Query: 514 XXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGS 573
                         GKKIL  PMYEA  +LL+++WV EG ++  F+ PK SYT+R+VLGS
Sbjct: 526 ESELPYLLDLELFLGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGS 585

Query: 574 CPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGW 632
           CPR++++SMGDLYKNLM S+++L + RGV+ KAE +Y+RTR  AS ES+KR+++++ SGW
Sbjct: 586 CPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGW 645

Query: 633 DEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITXXX 692
           DEQN++FGKN+E EK  FLAKLQDR NKETVFEFARN DD+ S+LMKKRR Q+ P+    
Sbjct: 646 DEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRA 705

Query: 693 XXXXXXXXXXXXXGFSHAMEDELLNDNE-LIKESVPEEVLQEFEDADKLLEDQEKLG--- 748
                        G +H++EDE+L+  +  +  SVP+ VL+EFEDAD++LEDQE  G   
Sbjct: 706 KQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGKKQ 765

Query: 749 RKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATV 808
           ++KSKSF+D NFF+SHYAP   + +++LN++SGFTTDAAQA+ D+N DDK+QVHKQ ATV
Sbjct: 766 KQKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATV 825

Query: 809 KWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTA 868
           KWD KKKKY+N QGADN +YI  ESGQKIPAS+RSGK+ EWSK R L+  KVG+RES  A
Sbjct: 826 KWDKKKKKYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMA 885

Query: 869 ANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKG 928
            N+L++P + +P+   R    +F HKQVKAPK+PDK+RDDY KQK KV +AL+KGI+VKG
Sbjct: 886 TNLLQDPTRGNPSSNNR----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKG 941

Query: 929 YNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKR 966
           +N      NEL+S  QIRKQR   +K+ AKNAR  KKR
Sbjct: 942 HNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1185 bits (3065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/914 (64%), Positives = 706/914 (77%), Gaps = 24/914 (2%)

Query: 77  DKSFPKLEASGXXXXXXXXX-------------VNEYFSTTAQTNKKHKKGSFPSFGLSK 123
           DKSFP LE S                       +N YFSTT     KHKKGSFPSFGLSK
Sbjct: 80  DKSFPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNLEKSKHKKGSFPSFGLSK 139

Query: 124 LILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKV 183
           +I+ NI+++GF QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAFILPMI K+K+HSSK+
Sbjct: 140 IIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKI 199

Query: 184 GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPG 243
           GARAVILSPSRELAMQTH VFK+FS+GT LRSVLLTGGDSLE+QFGMMM+NPDVI+ATPG
Sbjct: 200 GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPG 259

Query: 244 RFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSL 303
           RFLHLKVEM+LDLKSIEYAVFDE+DRLFEMGF++QLNELLA+LPSNRQTLLFSATLP+SL
Sbjct: 260 RFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSL 319

Query: 304 VDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLAT-EEQ 362
           VDFAKAGLTNPVLVRLD ESKISENLEMLFLSTK+DEREA LLYL+Q+VI+IPLAT E+Q
Sbjct: 320 VDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQ 379

Query: 363 IKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVE 422
            K                +                R+P ANQLPSEK+TILFVPTRHHVE
Sbjct: 380 RKFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERLPPANQLPSEKATILFVPTRHHVE 439

Query: 423 YIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN 482
           YI+ LLK+ GYL+SYIYG+LDQ AR RQLYNFR GLTSILVVTDVAARGVDIPMLANVIN
Sbjct: 440 YISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVIN 499

Query: 483 FSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATD 542
           FS P+SSKIF+HRVGRTARAGNRGWAYSI+S              GKKI+ TPMY++  +
Sbjct: 500 FSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMYDSLCE 559

Query: 543 LLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGV 601
           +++ +W+ EG ++  F  PK +YT+RL+LGS PRL+++ +GDLYKN+M ++FEL+ ++ V
Sbjct: 560 IMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDV 619

Query: 602 AKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKE 661
           A KAEKLY RTRT+AS ES+KRS+E++ SGWDEQNV+FGKN EKEKLDFLAKLQ+R NKE
Sbjct: 620 AMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKE 679

Query: 662 TVFEFARNADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELL--NDN 719
           TVFEF+RN DDE S+ MK+RR Q+API                 G +H++EDE+L  +DN
Sbjct: 680 TVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDN 739

Query: 720 ELIKESVPEEVL-QEFEDADKLLEDQEKLGRKKSKSFRD---PNFFLSHYAPQGGLHENE 775
           E    SV E+ L Q+F+DAD+LL DQE   +K  KS +    PNFFLSHYAP G + + +
Sbjct: 740 E-AGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKDPNFFLSHYAPAGDIQDKQ 798

Query: 776 LNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQ 835
           L LT+GF  DAA+ A D+N DDKVQVHKQ A VKWD K+KKY+N+QG DNKKYI+GE GQ
Sbjct: 799 LELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQ 858

Query: 836 KIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQ-NHPTDGQRTVGGKFKHK 894
           KI ASFRSGK+ EW+K R ++P+KVGARE+   +N+L NP   +H + G  T+ GKFKHK
Sbjct: 859 KIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGSQGN-TIRGKFKHK 917

Query: 895 QVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEK 954
           Q+KAPK+PDKHRDDYH QKKKV++AL  GI V+GY       NEL+S  QI K R   E 
Sbjct: 918 QMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKEN 977

Query: 955 KHAKNARPSKKRKY 968
           K AKNARPSK+RK+
Sbjct: 978 KRAKNARPSKRRKF 991

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/901 (63%), Positives = 692/901 (76%), Gaps = 22/901 (2%)

Query: 74  APK-DKSFPKLEASGXXXXXX--XXXVNEYFSTTAQ-TNKKHKKGSFPSFGLSKLILNNI 129
           AP+ D +FP LE S            V+ YF+TT+Q    K KKGSF SFGLSK IL NI
Sbjct: 76  APRSDAAFPSLELSDGEDADNGDKDDVDSYFNTTSQLAASKAKKGSFASFGLSKFILGNI 135

Query: 130 SRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVI 189
           SRKGF QPTPIQRKTIPLILQ RDIVG+ARTGSGKTAAF+LP+IEKLK HS+K+GARA+I
Sbjct: 136 SRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMI 195

Query: 190 LSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLK 249
           LSPSRELAMQTHKVFK+F++G++LRSVLLTGGD LE+QF MMMSNPDVI+ATPGRFLHLK
Sbjct: 196 LSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLK 255

Query: 250 VEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKA 309
           VEMNLDL SIEY VFDE+DRLFEMGF+EQLNELL +LP+ RQTLLFSATLP+SLVDFAKA
Sbjct: 256 VEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKA 315

Query: 310 GLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXX 369
           GLTNPVLVRLD E+K+SENLEMLFLS K+DEREA LLYL+QEVI+IP+ATEEQ++     
Sbjct: 316 GLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRKQ 375

Query: 370 XXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLK 429
                                        +P+A  +PS  STI+FV TRHHVEY++NLLK
Sbjct: 376 SNDDADDSDDETDKKKKHSKKSKQP----LPSAKDMPSPNSTIIFVSTRHHVEYVSNLLK 431

Query: 430 NCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSS 489
           +CGYLVSY+YG+LDQ AR +QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N S P+SS
Sbjct: 432 DCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASS 491

Query: 490 KIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWV 549
           KIFVHRVGRTARAGN+GWAY+I+S              GKK+L TPMYEA  DLL+K+W+
Sbjct: 492 KIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMYEATCDLLKKKWI 551

Query: 550 EEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKL 608
            EG E  LF+ PK SY NRL+LGS PRLD+++MGDL+KNL+ S+FEL+ L+ V+ KAEKL
Sbjct: 552 SEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKL 611

Query: 609 YLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFAR 668
           YLRTR  AS ES+KR++E++ +GWDEQNV FGKN+EKEKL+FLAKLQ+R NKETVFEFAR
Sbjct: 612 YLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFAR 671

Query: 669 NADDETSMLMKKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELLNDNE-LIKESVP 727
           N DDE ++LMK+RR Q+API                 G  H +EDE+L   E  +  SVP
Sbjct: 672 NHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVP 731

Query: 728 EEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAA 787
           +E+L++FEDAD+L        R   K FRD NF+LSH+AP   + + +L + S FT + +
Sbjct: 732 QELLRDFEDADELAAK-----RNTKKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVS 786

Query: 788 QAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYA 847
           +A  D++ DDKVQVHKQ ATVKWD K+KKY+N QG DNKKYI+GESGQKIPASFRSGK+ 
Sbjct: 787 KATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFD 846

Query: 848 EWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRD 907
           EWSKAR L P+KVGARES   AN+L +P       G R   GKFKHKQ+KAPK+PDK+RD
Sbjct: 847 EWSKARKLAPLKVGARESSIPANLLADPT------GSRLANGKFKHKQIKAPKMPDKNRD 900

Query: 908 DYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRK 967
           DY  Q KKV +A++ G++VKGYN  G  K EL++  QIRKQR  +EK+ AKNARP+KKRK
Sbjct: 901 DYQSQLKKVNKAMESGLHVKGYNAPGM-KQELRTTEQIRKQRSMAEKRKAKNARPAKKRK 959

Query: 968 Y 968
           +
Sbjct: 960 F 960

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/897 (54%), Positives = 614/897 (68%), Gaps = 48/897 (5%)

Query: 80  FPKLEASGXXXXXXXXXVNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTP 139
           FP+L+ +          +N+YF+TT    KK KKGSF SFG ++ I+NNI++KG+ QPTP
Sbjct: 72  FPQLDGN-VEVESDDDDINDYFATTHLDTKKFKKGSFASFGFNRFIMNNINKKGYKQPTP 130

Query: 140 IQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQ 199
           IQRKTIPLILQ RDIVG+ARTGSGKTAAF+LPMIEKLK+HSSK+G R VILSPSRE+A+Q
Sbjct: 131 IQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIGVRGVILSPSREIAIQ 190

Query: 200 THKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSI 259
           TH+VFK+FS+ T LRSVLLTGGDSLE+QFGMMMSNPDV++ATPGRFLHLKVEM LDLKS+
Sbjct: 191 THRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGRFLHLKVEMKLDLKSV 250

Query: 260 EYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRL 319
           EY VFDE+DRLFEMGFEEQLNELLAALP NRQ+LLFSATLPNSLV+FAKAGL NPVLV+L
Sbjct: 251 EYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLVEFAKAGLKNPVLVKL 310

Query: 320 DQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXX 379
           DQESKIS+NLEMLFLS K +ERE+ LL+L+Q+VI +P+A+ E++K               
Sbjct: 311 DQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMKRFQTDSREVEEKEEK 370

Query: 380 XNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIY 439
                             +   ++++P E++TI+FVPTRHHVEYI+ LL  CGYLVSY+Y
Sbjct: 371 E------KEKGKEKEKRAKYYKSDEIPHEQATIIFVPTRHHVEYISQLLMKCGYLVSYLY 424

Query: 440 GSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRT 499
           G+LDQ AR  QL  F  G+T ILVVTDVAARGVDIP+L NVIN+S P SSKIFVHRVGRT
Sbjct: 425 GTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLLPNVINYSLPGSSKIFVHRVGRT 484

Query: 500 ARAGNRGWAYSIISXXXXXXXXXXXXXXGKKILTTPMYEAATDLLEKRWVEEGKEKILFK 559
           ARAGNRGWAYSI+S              GKK++TT M                 EK+   
Sbjct: 485 ARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMV----------------EKLGVS 528

Query: 560 APKPSYTNRLVLGSCPRLDIDSMGDLYKNLMS-SFELETLRGVAKKAEKLYLRTRTAASV 618
             K SY   +VLGS PR+D++S GDLYKN+    F+L+  +   +KAEKLYLRTR  AS 
Sbjct: 529 FDKISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEKAEKLYLRTRGGASN 588

Query: 619 ESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLM 678
           +SVKRS+EL+   WD QNV FG++LE+ KL+ L K   R NKETVFEF +N +DE S LM
Sbjct: 589 DSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFALRKNKETVFEFGKNGEDEMSTLM 648

Query: 679 KKRRFQVAPITXXXXXXXXXXXXXXXXGFSHAMEDELLNDNELIKESVPEEV-LQEFEDA 737
            +R   V  I                        +E L               L +  + 
Sbjct: 649 NRRWKVVKGIERKAKRRREMKEEEEGGVEEELQFEEELGSGSGPGPGQGPGQDLVDAGNY 708

Query: 738 DKLLEDQEKL--GRKKSK-SFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDIN 794
           + + ED + +  G+ K + +F+D  FFLSHYA    + ENE  +  GF   A++A+ D+N
Sbjct: 709 NGVFEDGDAILNGQTKKRKTFKDERFFLSHYADPKKV-ENE-EVVDGFINAASEASYDLN 766

Query: 795 GDDKVQVHKQ-NATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKAR 853
            D+K+QVHKQ +ATVKWD K+KKY+N QG DNKKYI+GESG+KIPA+FRSGKY EW+KAR
Sbjct: 767 NDEKIQVHKQSSATVKWDRKRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKAR 826

Query: 854 NLQP---IKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYH 910
           N+     ++VGARES  +                     +FKHK  K PK+PDK+RDDY 
Sbjct: 827 NINTRNVMRVGARESEGSVVGGGRGGGGG----------RFKHKLDKKPKMPDKYRDDYK 876

Query: 911 KQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRK 967
           KQK+K + A+++G+ +KG   RG  K+EL+++A+IRK R   EK+ AKN RP ++R+
Sbjct: 877 KQKEKNERAVERGV-MKG--KRGY-KDELKNVAEIRKNRVEKEKRRAKNGRPGRERR 929

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  229 bits (584), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 134/420 (31%), Positives = 226/420 (53%), Gaps = 58/420 (13%)

Query: 100 YFSTTAQTNKKHKK--GSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGL 157
           +++  +++ +  KK   +F S  LS+ +L  +   G+  P+PIQ  TIP+ L  +DI+  
Sbjct: 221 FYAPQSESEEAKKKVFNNFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAG 280

Query: 158 ARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH-LRS 215
           A TGSGKTAAF++P+IE+L    +KV + R ++L+P+RELA+Q   V K   +  + L  
Sbjct: 281 AVTGSGKTAAFMIPIIERLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTF 340

Query: 216 VLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMG 274
            +  GG +L +Q  ++ + PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E G
Sbjct: 341 GIAVGGLNLRQQEQILKTRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEG 400

Query: 275 FEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFL 334
           F++++NE++  LPS RQT+LFSAT+ + +       L  PV V  D   +    L+  F+
Sbjct: 401 FQDEINEIMHLLPSKRQTMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFV 460

Query: 335 STKHDE--REAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXX 392
             +  +  + + L YLI+                                          
Sbjct: 461 RIRKRDHLKPSTLFYLIK------------------------------------------ 478

Query: 393 XXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLY 452
                ++  A Q    K  ++FV  +  V  +  +L   G  V+ ++GSL+Q  R + + 
Sbjct: 479 -----KLDGAAQ----KRMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSIN 529

Query: 453 NFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            F++    +L+ TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + S +
Sbjct: 530 KFKSLEVPVLICTDLASRGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFV 589

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  229 bits (583), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 139/418 (33%), Positives = 219/418 (52%), Gaps = 62/418 (14%)

Query: 103 TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGS 162
           T     KK    +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 203 TEGDEAKKQLYDNFNSLSLSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGS 262

Query: 163 GKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTG 220
           GKTAAF++P+IE+L    +K+ + R ++L P+RELA+Q   V K  +R  + +   L  G
Sbjct: 263 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVG 322

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           G +L +Q  M+ S PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++L
Sbjct: 323 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 382

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
           NE++  LPSNRQ LLFSAT+ + +       L  PV + +D   K +  L   F+  +  
Sbjct: 383 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKR 442

Query: 340 E--REAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
           +  + A L  LI+++  +                                          
Sbjct: 443 DHLKPALLFNLIRKLDPV------------------------------------------ 460

Query: 398 RMPAANQLPSEKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNF 454
                     +K  ++FV    T H +  I  LL   G  V  ++GSL Q  R   +  F
Sbjct: 461 ---------GQKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKF 508

Query: 455 RAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +     +L+ TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + + +
Sbjct: 509 KNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFV 566

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  227 bits (579), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 219/415 (52%), Gaps = 56/415 (13%)

Query: 103 TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGS 162
           T     KK    +F S  LS+ +L  ++  G+  P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 226 TEGNEAKKQMYDNFNSLSLSRPVLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGS 285

Query: 163 GKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGT-HLRSVLLTG 220
           GKTAAF++P+IE+L    +K+ + R ++L P+RELA+Q   V K  +R    +   L  G
Sbjct: 286 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVG 345

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           G +L +Q  M+ S PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++L
Sbjct: 346 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 405

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KH 338
           NE++  LPS+RQ LLFSAT+ + +       L  PV + +D   K +  L   F+   K 
Sbjct: 406 NEIMGLLPSSRQNLLFSATMNSKIKSLVSLSLKRPVRIMIDPPKKAATKLTQEFVRIRKR 465

Query: 339 DEREAALLY-LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
           D  + AL++ LI+++   P+A                                       
Sbjct: 466 DHLKPALIFNLIRKL--DPMA--------------------------------------- 484

Query: 398 RMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAG 457
                     +K  ++FV  +     +  ++   G  V  ++GSL Q  R   +  F+  
Sbjct: 485 ----------QKRIVVFVARKESAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNL 534

Query: 458 LTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
              +L+ TD+A+RG+DIP +  VIN+  P S ++++HRVGRTARAG  G + + +
Sbjct: 535 EVPVLICTDLASRGLDIPKIEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFV 589

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  227 bits (578), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 219/414 (52%), Gaps = 66/414 (15%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           KK    +F +  LS+ +L  ++  G+ +P+PIQ   IP+ L  +DI+  A TGSGKTAAF
Sbjct: 231 KKQVHNTFNTLSLSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAF 290

Query: 169 ILPMIEKLKSHSSKV-GARAVILSPSRELAMQTHKVFKDFSRGTHLRSV---LLTGGDSL 224
           ++P+IE+L    +KV   R ++L+P+RELA+Q   V K    G  +  V   L  GG +L
Sbjct: 291 MIPIIERLLYKPAKVTSTRVIVLTPTRELAIQVSDVGKKV--GKFVNGVTFGLAVGGLNL 348

Query: 225 EEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELL 283
            +Q   + S PD++VATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++LNE++
Sbjct: 349 RQQEQQLKSRPDIVVATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIM 408

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KHDERE 342
           + LPS RQTLLFSAT+ + +       L  PV + +D   + +  L   F+   K D  +
Sbjct: 409 SLLPSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLK 468

Query: 343 AALLY-LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPA 401
            ALLY LI+                                               ++  
Sbjct: 469 PALLYTLIR-----------------------------------------------KLDG 481

Query: 402 ANQLPSEKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
           A Q    K  ++FV    T H +  I  LL   G  V  ++GSL Q  R   +  F++  
Sbjct: 482 AGQ----KRIVVFVARKETAHKLRIILGLL---GQSVGELHGSLTQEQRLDSVNKFKSLE 534

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
             +L+ TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + + +
Sbjct: 535 VPVLLCTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 588

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  225 bits (574), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 135/409 (33%), Positives = 219/409 (53%), Gaps = 56/409 (13%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           K +   SF S  LS+ +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+
Sbjct: 218 KNNTHTSFNSLSLSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAY 277

Query: 169 ILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH-LRSVLLTGGDSLEE 226
           ++P+IE+L    ++V + R V+L+P+RELA+Q   V K   +  + L   L  GG +L +
Sbjct: 278 MIPIIERLLYKPAQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQ 337

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           Q   +   PD+++ATPGRF+ H++   +  + S+E  V DE+DR+ E GF ++LNE+++ 
Sbjct: 338 QEQTLKLRPDIVIATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSL 397

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KHDEREAA 344
           +PS RQTLLFSAT+ + +       L  PV + +D   + +  L   F+   K D  + A
Sbjct: 398 IPSKRQTLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPA 457

Query: 345 LLY-LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
           LL+ LI+++ +                                                 
Sbjct: 458 LLFHLIRKIDET------------------------------------------------ 469

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
              S+K  ++FV  +     +  +L   G  V+ ++GSL Q  R + + +F++    +L+
Sbjct: 470 ---SQKRIVVFVSRKEMAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLI 526

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            TD+A+RG+DIP +  VINF  P + +I++HRVGRTARAG  G + S +
Sbjct: 527 CTDLASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFV 575

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  221 bits (564), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 220/409 (53%), Gaps = 56/409 (13%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           KK    +F +  LS+ +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF
Sbjct: 215 KKQVHTNFNTLSLSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAAF 274

Query: 169 ILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH-LRSVLLTGGDSLEE 226
           ++P+IE+L    + + + R ++L+P+RELA+Q   V K   +  + L   L  GG +L +
Sbjct: 275 MIPIIERLLYKPANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLRQ 334

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           Q   + + PDV++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+E+LNE+++ 
Sbjct: 335 QEQELKTRPDVVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMSL 394

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDE--REA 343
           LP+ RQTLLFSAT+ + +       L  PV + ++   + +  L   F+  +  +  + A
Sbjct: 395 LPTKRQTLLFSATMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKPA 454

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
            L YLI++     L +  Q +++                                     
Sbjct: 455 LLYYLIRK-----LDSSSQKRIV------------------------------------- 472

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                    +FV  +     +  ++   G  V+ ++GSL Q  R + +  F++    +L+
Sbjct: 473 ---------VFVSRKEMAHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVPVLI 523

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + + +
Sbjct: 524 CTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 572

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  220 bits (561), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 132/421 (31%), Positives = 225/421 (53%), Gaps = 58/421 (13%)

Query: 99  EYFSTTAQTN--KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           E+++   ++   KK    +F S  LS+ +L  +    + +P+PIQ  TIP+ L  +DI+ 
Sbjct: 206 EFYALEEESTEAKKTVHTNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIA 265

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTHLRS 215
            A TGSGKTAA+++P+IE+L    +++ + R ++L+P+RELA+Q   V    ++  +  S
Sbjct: 266 GAVTGSGKTAAYMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGIS 325

Query: 216 V-LLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEM 273
             L  GG +L +Q   + S PD+++ATPGR + H++   + ++ S+E  V DE+DR+ E 
Sbjct: 326 FGLAVGGLNLRQQEQTLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEE 385

Query: 274 GFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF 333
           GF+++LNE+++ +PS RQTLLFSAT+ + +       L  PV + +D   + +  L   F
Sbjct: 386 GFQDELNEIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEF 445

Query: 334 LST-KHDEREAALL-YLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXX 391
           +   K DE + ALL +LI+++  +                                    
Sbjct: 446 VRVRKRDELKPALLFHLIRKLDDL------------------------------------ 469

Query: 392 XXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQL 451
                          S+K  ++FV  +     +  +L   G  V+ ++GSL Q  R + +
Sbjct: 470 ---------------SQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAV 514

Query: 452 YNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSI 511
             F++    +L+ TD+A+RG+DIP +  VIN+  P +  I++HRVGRTARAG  G + S 
Sbjct: 515 NGFKSLQVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISF 574

Query: 512 I 512
           +
Sbjct: 575 V 575

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  218 bits (555), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 224/421 (53%), Gaps = 58/421 (13%)

Query: 99  EYFSTTAQTNKKHKK--GSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           E+++   ++ +  K    +F S  LS+ +L  +    + +P+PIQ  TIP+ L  +DI+ 
Sbjct: 198 EFYAPEEESTEARKAIHTNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIA 257

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH-LR 214
            A TGSGKTAA+++P+IE+L    ++V + R ++L+P+RELA+Q   V    ++  + + 
Sbjct: 258 GAVTGSGKTAAYMIPIIERLLYKPAQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGIN 317

Query: 215 SVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEM 273
             L  GG +L +Q   + + PDV++ATPGR + H++   + ++ S+E  V DE+DR+ E 
Sbjct: 318 FGLAVGGLNLRQQEQALRARPDVVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLED 377

Query: 274 GFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENL--EM 331
           GF+++LNE+++ +PS RQTLLFSAT+ + +       L  PV + +D   + +  L  E 
Sbjct: 378 GFQDELNEIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEF 437

Query: 332 LFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXX 391
           + +  + D + A L +LI+                                         
Sbjct: 438 VRVRKRDDLKPALLFHLIR----------------------------------------- 456

Query: 392 XXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQL 451
                 ++  A+Q    K  ++FV  +     +  +L   G  V+ ++GSL Q  R + +
Sbjct: 457 ------KLDDASQ----KRVVVFVARKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAV 506

Query: 452 YNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSI 511
             F++    +L+ TD+A+RG+DIP +  VINF  P +  I++HRVGRTARAG  G + S 
Sbjct: 507 NGFKSLQIPVLICTDLASRGLDIPKIEFVINFDMPKTYDIYLHRVGRTARAGREGRSISF 566

Query: 512 I 512
           +
Sbjct: 567 V 567

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  214 bits (546), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 219/407 (53%), Gaps = 44/407 (10%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  +++ I++  GF   TPIQ + IP I+   D++G+++TGSGKT +++LP+I 
Sbjct: 288 WSQLGLNTDVMDLITKDFGFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIR 347

Query: 175 KLKSHS----SKVGARAVILSPSRELAMQTHK-VFKDFSRGTHLRSVLLTGGDSLEEQFG 229
            +K+ +    ++ G   +IL+P+RELA+Q H+ + K  S  T + S+  TGG  L++Q  
Sbjct: 348 HIKAQNPLMKNETGPLGLILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQIN 407

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN---LDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL 286
            +     ++VATPGR + L    N   + +K + + + DE+DRLF++GFE Q+ +++  +
Sbjct: 408 SLKKGVHIVVATPGRLIDLLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTI 467

Query: 287 PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDERE-AAL 345
             ++Q +LFSAT PN L +FA   L +P+ + ++ +S ++E ++  F    +DE +   L
Sbjct: 468 RPDKQCVLFSATFPNKLRNFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDEL 527

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L +I+E    P+ T +  K                                         
Sbjct: 528 LAMIEENSSEPIETTDLGK----------------------------------EEEEEHT 553

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
           P ++ TI+FV ++   ++I   L+N GY    I+     + R + L NF++   SILV T
Sbjct: 554 PQDRKTIIFVASQQICDFIGTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVAT 613

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +V +RG++I  ++ VI F+   +   +VH  GRTAR  + G A S+I
Sbjct: 614 EVLSRGLNITEVSLVIIFNAVKTFAQYVHTTGRTARGNHSGVAISLI 660

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  205 bits (522), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 207/403 (51%), Gaps = 55/403 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 SFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIV 170

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++L+P+RELA+Q  K    F R + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDL 230

Query: 232 MSNPDVIVATPGRFLHLKVEMN-LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNR 290
               ++++ATPGR + + +E+N  +LK + Y V DE+DR+ +MGFE Q+ +++  +  +R
Sbjct: 231 ARGAEIVIATPGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR 289

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQ 350
           QTL++SAT P  +   A+  LT+P+ V++            L LS  H          I+
Sbjct: 290 QTLMWSATWPKEVKQLARDYLTDPIQVQIGS----------LELSASH---------TIK 330

Query: 351 EVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKS 410
           +V+++    E++ +L                               + + + +Q   +  
Sbjct: 331 QVVEVISEFEKRDRL----------------------------SKHLEIASEDQ---DSK 359

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F  T+   + I   L+  G+    I+G  DQR R+  L  F+ G + I+V TDVAAR
Sbjct: 360 VLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAAR 419

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+D+  +  VIN+  P + + +VHR+GRT RAG +G A S  +
Sbjct: 420 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  205 bits (521), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 204/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F + + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIREL 230

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           +   ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 231 IRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A+  L +P+ V++            L L+  H+         I +
Sbjct: 291 TLMWSATWPKEVQQLARDYLNDPIQVQIGS----------LELAASHN---------ITQ 331

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A+Q   E   
Sbjct: 332 LVEVVSEFEKRDRLVK------------------------------HLDTASQ-DKESKI 360

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I + L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 361 LIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAARG 420

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  V+N+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 421 IDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 462

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  204 bits (519), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 129/402 (32%), Positives = 200/402 (49%), Gaps = 55/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS+  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 110 SFDHLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 167

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L +   K G + +++SP+RELA Q +      +    L+   + GG   +EQ   +  +
Sbjct: 168 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS 227

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQTL 293
             V+VATPGR L L  E ++DL  + Y V DE DR+ E GFEE +  ++     S RQTL
Sbjct: 228 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTL 286

Query: 294 LFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDER--EAALLYLIQE 351
           +F+AT P  + + A + + NP+ V +    +++ N ++  +    D R  E  LL L+++
Sbjct: 287 MFTATWPKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKK 346

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
               P   E+                                                  
Sbjct: 347 YHSGPKKNEK-------------------------------------------------V 357

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 358 LIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARG 417

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 418 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 459

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  204 bits (519), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 204/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +LN +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 NFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++LSP+RELA+Q  K    F + + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  + + A+  L +P+ V++        +LE+            A  + I +
Sbjct: 294 TLMWSATWPKEVQNLARDYLNDPIQVQIG-------SLEL------------AASHTITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +++                                +  A+Q   E   
Sbjct: 335 LVEVITDFEKRDRMVK------------------------------HLEVASQ-DKESKI 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 364 LVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDVAARG 423

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  206 bits (523), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/415 (31%), Positives = 205/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L  L+L+NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 161 FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 220

Query: 176 L-------------KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                          S+  KV   AVIL+P+RELA Q +   K F+  + ++ +++ GG 
Sbjct: 221 SFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGA 280

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
           S++ Q   M    +++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 281 SIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRI 340

Query: 283 LAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P+ +   A   L + V + + +    SEN+    L  + 
Sbjct: 341 VEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVED 400

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++   LL L+        A+ E + LI                                
Sbjct: 401 FDKNDTLLDLLA-------ASNEGLTLI-------------------------------- 421

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L   G+  + I+G   Q  R R L  F+ G 
Sbjct: 422 ---------------FVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGR 466

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            +ILV T VAARG+DIP + +VINF  P+    +VHR+GRT RAGN G A +  +
Sbjct: 467 ATILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVATTFFN 521

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  205 bits (521), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/414 (31%), Positives = 204/414 (49%), Gaps = 71/414 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L  L++ NI   GF++PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+   
Sbjct: 152 FGSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 211

Query: 174 ----------EKLKSHSSKVG-ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     EK +S  S+ G   A++L+P+RELA Q  +  + F+  + +R  ++ GG 
Sbjct: 212 LFRFGPSPVPEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 271

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +I+Y V DE+DR+ +MGFE Q+  +
Sbjct: 272 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 331

Query: 283 LAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P  +   A+  L N + + + +    SEN+    L    
Sbjct: 332 VEGCDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 391

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++AL         + L + E   L                                 
Sbjct: 392 LDKKSAL---------LDLLSAEHTGL--------------------------------- 409

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                       T++FV T+   + + + L    +  + I+G   Q  R R L+ F+  +
Sbjct: 410 ------------TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNV 457

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
             ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A S  
Sbjct: 458 ADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVASSFF 511

>Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {ON}
           YPL119C (REAL)
          Length = 618

 Score =  204 bits (520), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 205/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L  L+L NI   GF++PTP+Q+ ++P++  +RD++  A+TGSGKT  F+ P+   
Sbjct: 154 FDSPPLDALLLENIKLAGFNKPTPVQKYSVPIVTNNRDLMACAQTGSGKTGGFLFPVFTE 213

Query: 174 ----------EKLKSHSSKVG-ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     EK +S  S+ G   A++L+P+RELA Q  +  + F+  + +R  ++ GG 
Sbjct: 214 LFHSGPSPAPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 273

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +I+Y V DE+DR+ +MGFE Q+  +
Sbjct: 274 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 333

Query: 283 L--AALPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P  +   A+  L N + + + +    SEN+    L    
Sbjct: 334 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 393

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A  E + LI                                
Sbjct: 394 MDKKSALLDLLS-------AEHEGLTLI-------------------------------- 414

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  F++ +
Sbjct: 415 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKSNV 459

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A S  +
Sbjct: 460 ADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 514

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  203 bits (516), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 110 SFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIV 169

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++L+P+RELA+Q  K    F + + +R+  + GG    +Q   +
Sbjct: 170 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 229

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 230 ARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 289

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L L+  H+         I++
Sbjct: 290 TLMWSATWPKEVKQLASDYLHDPIQVQIGS----------LELAASHN---------IKQ 330

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           V+++    E++ +L                                 M  A+Q   E   
Sbjct: 331 VVEVITDFEKRDRLTK------------------------------HMDIASQ-DKESKI 359

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L++ G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 360 LVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARG 419

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 420 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 461

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  202 bits (514), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 200/402 (49%), Gaps = 55/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS+  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 114 SFDYLSLDPSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 171

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L +   K G + +++SP+RELA Q +      +    ++   + GG   +EQ   +  +
Sbjct: 172 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS 231

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQTL 293
             V+VATPGR L L  E ++DL  + Y V DE+DR+ E GFEE +  ++     S RQTL
Sbjct: 232 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTL 290

Query: 294 LFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDER--EAALLYLIQE 351
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL L+++
Sbjct: 291 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELLKK 350

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
               P   E+                                                  
Sbjct: 351 YHSGPKKNEK-------------------------------------------------V 361

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 362 LIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 421

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 422 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 463

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  202 bits (514), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 199/402 (49%), Gaps = 55/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS+  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 115 SFDYLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 172

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L +   K G + +++SP+RELA Q +      +    ++   + GG   +EQ  + +  
Sbjct: 173 HLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKK 231

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQTL 293
             V+VATPGR L L  E ++DL  + Y V DE+DR+ E GFEE +  ++     S RQTL
Sbjct: 232 SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTL 291

Query: 294 LFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDER--EAALLYLIQE 351
           +F+AT P  + + A   + NP+ V +    +++ N  +  +    D R  E  LL L+++
Sbjct: 292 MFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKK 351

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
               P   E+                                                  
Sbjct: 352 YHSGPKKNEK-------------------------------------------------V 362

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 363 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 422

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 423 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 464

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  202 bits (513), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 200/402 (49%), Gaps = 55/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L+  I   IS+  F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 108 SFDYLSLNPSIQAEISK--FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 165

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L +   K G + +++SP+RELA Q +      +    ++   + GG   +EQ   +  +
Sbjct: 166 HLMNDQGKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKRS 225

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQTL 293
             V+VATPGR L L  E ++DL  + Y V DE+DR+ E GFEE +  ++     S RQTL
Sbjct: 226 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTL 284

Query: 294 LFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDER--EAALLYLIQE 351
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL L+++
Sbjct: 285 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKK 344

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
               P   E+                                                  
Sbjct: 345 YHSGPKKNEK-------------------------------------------------V 355

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 356 LIFALYKKEATRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 415

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 416 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 457

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  204 bits (519), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 130/410 (31%), Positives = 203/410 (49%), Gaps = 71/410 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-EKLKSH 179
           L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K+ 
Sbjct: 176 LDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTG 235

Query: 180 SSKVGAR------------AVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQ 227
            SK   +            A+IL+P+RELA Q     K F+  + +R  ++ GG  +  Q
Sbjct: 236 PSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQ 295

Query: 228 FGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELL--AA 285
              +    D++VATPGR   L     + L +I Y V DE+DR+ +MGFE Q+ +++  + 
Sbjct: 296 MREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSD 355

Query: 286 LP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +P   +RQTL+FSAT P  +   A+  L + + + + +    SEN+  + L  +  ++ +
Sbjct: 356 MPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYS 415

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
           ALL L+        AT + + LI                                     
Sbjct: 416 ALLDLLA-------ATTDGLTLI------------------------------------- 431

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                     FV T+   + + + L    +  + I+G   Q+ R R L  FRAG  +ILV
Sbjct: 432 ----------FVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATILV 481

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            T VAARG+DIP + +VINF  P     +VHR+GRT RAGN G A S  +
Sbjct: 482 ATAVAARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSFFN 531

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  202 bits (513), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 201/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +LN +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGS----------LELSASHN---------ITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L                                 +  A+Q  +E  T
Sbjct: 335 IVEVVSDFEKRDRLNKY------------------------------LETASQ-DNEYKT 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 364 LIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARG 423

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  202 bits (513), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +LN +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 116 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 175

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 176 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 235

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 236 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 295

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 296 TLMWSATWPKEVKQLASDYLNDPIQVQIGS----------LELSASHN---------ITQ 336

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A+Q   E   
Sbjct: 337 LVEVVSEFEKRDRLLK------------------------------HLETASQ-DQESKI 365

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + +   L+  G+    I+G  DQR R+  L  FR+G + I+V TDVAARG
Sbjct: 366 LIFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAARG 425

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 426 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 467

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  201 bits (512), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 119 SFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 178

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 179 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 238

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 239 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 298

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 299 TLMWSATWPKEVQQLASDYLNDPIQVQVGS----------LELSASHN---------IAQ 339

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A++   E   
Sbjct: 340 LVEVLSEFEKRDRLLK------------------------------HLETASE-DKESKI 368

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I  +L+  G+    I+G  DQR R+  L  FRAG + I+V TDVAARG
Sbjct: 369 LIFASTKRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAARG 428

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG +G A S  +
Sbjct: 429 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 470

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  203 bits (516), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 206/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L  L+L NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++  
Sbjct: 157 FTSPPLDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQ 216

Query: 174 ----------EKLK-SHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     E LK S   K    A++L+P+RELA Q +   K F+  + +R V++ GG 
Sbjct: 217 SFKNGPAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGS 276

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 277 DVGTQIRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 283 L--AALP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P  +NRQTL+FSAT P+ +   A+  L + + + + +    SEN+    L  + 
Sbjct: 337 VDGCDMPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVED 396

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A  + + LI                                
Sbjct: 397 MDKKSALLDLLA-------AENDGLTLI-------------------------------- 417

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    ++ + I+G   Q  R R L  F+ G 
Sbjct: 418 ---------------FVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGR 462

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            ++LV T VAARG+DIP + +VIN+  P+    +VHR+GRT RAGN G A S  +
Sbjct: 463 ANVLVATAVAARGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSFFN 517

>Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {ON}
           YPL119C (REAL)
          Length = 619

 Score =  202 bits (515), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 206/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L  L++ NI   GF++PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 156 FNSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 176 L----------KSHS--SKVG-ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
           L          K+HS  S+ G   A++L+P+RELA Q  +  + F+  + +R  ++ GG 
Sbjct: 216 LFQIGPSSVPEKAHSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L + +Y V DE+DR+ +MGFE Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANTKYLVLDEADRMLDMGFEPQIRHI 335

Query: 283 L--AALPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P  +   A+  L N + + + +    SEN+    L    
Sbjct: 336 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A  + + LI                                
Sbjct: 396 MDKKSALLDLLS-------AEHKGLTLI-------------------------------- 416

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  F+A +
Sbjct: 417 ---------------FVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANI 461

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A S  +
Sbjct: 462 ADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 516

>YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON}
           DBP1Putative ATP-dependent RNA helicase of the DEAD-box
           protein family; mutants show reduced stability of the
           40S ribosomal subunit scanning through 5' untranslated
           regions of mRNAs
          Length = 617

 Score =  202 bits (514), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 131/415 (31%), Positives = 204/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L +L++ NI    F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+   
Sbjct: 156 FSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 174 ----------EKLKSHSSKVG-ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     EK +S  S+ G   A++L+P+RELA Q  +  + F+  + +R  ++ GG 
Sbjct: 216 LFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +I+Y V DE+DR+ +MGFE Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHI 335

Query: 283 L--AALPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P  +   A+  L N + + + +    SEN+    L    
Sbjct: 336 VEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A  + + LI                                
Sbjct: 396 MDKKSALLDLLS-------AEHKGLTLI-------------------------------- 416

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  F+A +
Sbjct: 417 ---------------FVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANV 461

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A S  +
Sbjct: 462 ADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 516

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  202 bits (514), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/417 (30%), Positives = 202/417 (48%), Gaps = 73/417 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L +L+ +N+ R GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F+ P++ +
Sbjct: 138 FTSPPLEQLLFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSE 197

Query: 176 L---------------KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTG 220
           +                S+  KV   A++L+P+RELA Q  +  + F+  + +R  ++ G
Sbjct: 198 MFTAGPAPKPQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYG 257

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLN 280
           G  +  Q G +    D++VATPGR   L     + L +I+Y   DE+DR+ +MGFE Q+ 
Sbjct: 258 GAPVGAQMGELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIR 317

Query: 281 ELLAAL---PSN-RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
            ++      P N RQTL+FSAT P  +   A+  L + + + + +    SEN+    L  
Sbjct: 318 HIVEDCDMPPVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYV 377

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
              ++++ALL L+        +T+  + LI                              
Sbjct: 378 DDMDKKSALLDLLS-------STKGGLTLI------------------------------ 400

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRA 456
                            FV T+   + + + L       + I+G   Q  R R L  F++
Sbjct: 401 -----------------FVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFKS 443

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G   +LV T VAARG+DIP +  VIN+  P     +VHR+GRT RAGN G A S  +
Sbjct: 444 GTADVLVATAVAARGLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISFFN 500

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  200 bits (509), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G  + +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 124 TFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 183

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 184 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDL 243

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 244 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 303

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A+  L +P+ V          N+  L L+  H          I +
Sbjct: 304 TLMWSATWPKEVQQLARDYLHDPIQV----------NIGSLELAASH---------TITQ 344

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A++ P E   
Sbjct: 345 IVEVISDFEKRDRLVK------------------------------HLDIASKDP-ESKI 373

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  T+   + I + L+  G+    I+G   Q+ R+  L  FR G + I+V TDVAARG
Sbjct: 374 IIFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARG 433

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 434 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 475

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score =  201 bits (512), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 203/415 (48%), Gaps = 70/415 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 151 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 175 KLKSHSS------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
             K+  S            K    AVI++P+RELA Q     K F+  + +++ ++ GG 
Sbjct: 211 SFKTGPSPQPEAQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 270

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 271 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 330

Query: 283 LAALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +          RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  ++
Sbjct: 331 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 390

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+         T++ + LI                                
Sbjct: 391 QDKKSALLDLLSAT------TDDGLTLI-------------------------------- 412

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 413 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA 457

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            S+LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 458 ASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFN 512

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  204 bits (520), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 217/408 (53%), Gaps = 49/408 (12%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL   ++N I     +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++ 
Sbjct: 259 WSQLGLMTDVMNFIMHNLKYDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLR 318

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHKVFKDFSRGT-HLRSVLLTGGDSLEEQFG 229
           ++K+     +++ G   +IL+P+RELA+Q H+  + F++    + S+  TGG  L++Q  
Sbjct: 319 QIKAQRPLATNETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQIN 378

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           M+    +++VATPGRF+ L + +N    L  K I + V DE+DRLF++GFE Q+ +++  
Sbjct: 379 MLKRGTEIVVATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKT 437

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDERE-AA 344
           +  ++Q +LFSAT PN L  FA   L  P+ + ++ ++ ++EN++  F     DE +  A
Sbjct: 438 IRPDKQCVLFSATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRA 497

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           LL ++ + ++                                               A+ 
Sbjct: 498 LLSILDKRMK-------------------------------------EEDENEESELADD 520

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
             ++   I+FV ++   +++   L+N GY +  I+     + R   L NFR    SIL+ 
Sbjct: 521 EVNDDKAIIFVSSQQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLC 580

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR  N G A +++
Sbjct: 581 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITLL 628

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  204 bits (519), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 217/409 (53%), Gaps = 64/409 (15%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  I+N ++R+  F  PTPIQ + IP I+  RD++G+++TGSGKT +FILP++ 
Sbjct: 238 WSQLGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLR 297

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHKVFKDFSRGT-HLRSVLLTGGDSLEEQFG 229
           ++K+       + G   +ILSP+RELA+Q H+    F+ G   +RS+  TGG  L+ Q  
Sbjct: 298 QIKAQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQIN 357

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    ++++ATPGRF+ L + +N    ++ K I + V DE+DRLF++GFE Q+N+++  
Sbjct: 358 DIKRGVEIVIATPGRFIDL-LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKC 416

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLE--MLFLSTKHDEREA 343
           +  ++Q +LFSAT PN L  FA   L +PV + ++ +S I+EN+E  +   S + D+ ++
Sbjct: 417 IRPDKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKS 476

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
            + +         LA  +Q                                         
Sbjct: 477 LIHW---------LALTQQ----------------------------------------- 486

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
            L  EK+ I+FV ++   + + N L+  G+    I+       R   L  F+     IL+
Sbjct: 487 NLNDEKT-IVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILI 545

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            T+V +RG+++P ++ VI ++   +   +VH  GRTAR  N+G A +++
Sbjct: 546 CTEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  199 bits (506), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 201/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGS----------LELSASHN---------ITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L                                 +  A+Q  +E  T
Sbjct: 335 IVEVVSDFEKRDRLNKY------------------------------LETASQ-DNEYKT 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 364 LVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARG 423

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  200 bits (509), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 204/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 175 KLKSHSS------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
             K+  S            K    AVI++P+RELA Q     K F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 267

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 283 LAALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +         +RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  ++
Sbjct: 328 VEDCDMTPVGDRQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A+ + + LI                                
Sbjct: 388 QDKKSALLDLLS-------ASTDGLTLI-------------------------------- 408

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 409 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA 453

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            S+LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 454 ASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFN 508

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  198 bits (504), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 NFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++LSP+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDL 230

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           +   ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 231 VRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 291 TLMWSATWPKEVRQLAADYLNDPIQVQVGS----------LELSASHN---------ITQ 331

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L                               + + + ++   +   
Sbjct: 332 LVEVLSDFEKRDRL----------------------------SKHLEIASEDK---DSKI 360

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQ+ R+  L  FR G + I+V TDVAARG
Sbjct: 361 LVFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARG 420

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG +G A S  +
Sbjct: 421 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  200 bits (508), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 202/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 175 KLKSHSS------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
             K+  S            K    AVI++P+RELA Q     K F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGS 267

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 283 LAALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +          RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  ++
Sbjct: 328 VEDCDMTPVGARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A+ + + LI                                
Sbjct: 388 QDKKSALLDLLS-------ASTDGLTLI-------------------------------- 408

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 409 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGT 453

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            S+LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 454 ASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVATAFFN 508

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  201 bits (510), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 201/410 (49%), Gaps = 71/410 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-EKLKS- 178
           L  L+L NI+   F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  KS 
Sbjct: 192 LDDLLLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSEAFKSG 251

Query: 179 -----------HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQ 227
                      +S K    ++IL+P+RELA Q  +  K F+  + ++  ++ GG  +  Q
Sbjct: 252 PSPTPEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQ 311

Query: 228 FGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
              +    D++VATPGR   L     + L++I+Y V DE+DR+ +MGFE Q+  ++  + 
Sbjct: 312 MREIDHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVD 371

Query: 288 ----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
                 RQTL+FSAT P  +   A+  L + V + + +    S+N+    L  +  ++ +
Sbjct: 372 MPQVGERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYS 431

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
           ALL L+        AT + + LI                                     
Sbjct: 432 ALLDLLS-------ATSDGLTLI------------------------------------- 447

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                     FV T+   + + + L    +  + I+G   Q  R R L  F+AG  ++LV
Sbjct: 448 ----------FVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLLV 497

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            T VAARG+DIP + +VINF  PS    +VHR+GRT RAGN G A S  +
Sbjct: 498 ATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 547

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  197 bits (501), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 202/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPDYVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 174

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++LSP+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 175 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDL 234

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 235 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++        +LE+            A  + I +
Sbjct: 295 TLMWSATWPKEVKQLAADYLNDPIQVQVG-------SLEL------------AASHTITQ 335

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L                                 +  A+Q   E  T
Sbjct: 336 LVEVVSDFEKRDRL------------------------------NKHLETASQ-DDEYKT 364

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 365 LIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARG 424

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 425 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAVSFFT 466

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  198 bits (504), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 202/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 144 FTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 203

Query: 175 KLKSHSS------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
             K+  S            K    AVI++P+RELA Q     K F+  + +++ ++ GG 
Sbjct: 204 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 263

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 264 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 323

Query: 283 LAALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +          RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  ++
Sbjct: 324 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 383

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A+ + + LI                                
Sbjct: 384 QDKKSALLDLLS-------ASTDGLTLI-------------------------------- 404

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 405 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA 449

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            ++LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 450 ATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFN 504

>KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 621

 Score =  199 bits (505), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 205/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L +L+L+NI +  F +PTP+Q+ ++P+I   RD++  A+TGSGKT  F+ P++ +
Sbjct: 151 FTSPPLDQLLLDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 176 LKSHSS-------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
             ++               K    AV+L+P+RELA Q     K F+  + +R  ++ GG 
Sbjct: 211 SFANGPAPVPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGA 270

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +I+Y V DE+DR+ +MGFE Q+  +
Sbjct: 271 DIGSQIKELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHI 330

Query: 283 LAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS   RQTL+FSAT P  +   A+  L + V + + +    SEN+    L  + 
Sbjct: 331 VEGCDMPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVED 390

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A+++ + LI                                
Sbjct: 391 MDKKSALLDLLA-------ASDDGLTLI-------------------------------- 411

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L       + I+G   Q  R R L  FR+G 
Sbjct: 412 ---------------FVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSGK 456

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            S+LV T VAARG+DIP + +VIN+  P+    +VHR+GRT RAGN G A + ++
Sbjct: 457 ASLLVATAVAARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATAFLN 511

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  197 bits (500), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 201/402 (50%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L+ + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H          I +
Sbjct: 294 TLMWSATWPKEVKQLASDYLHDPIQVQIGS----------LELSASH---------TITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L                                 +  A+Q    K  
Sbjct: 335 IVEVLTDFEKRDRLAK------------------------------HLETASQDQDSK-I 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  T+   + I + L+  G+    I+G   Q  R+  L  FR+G + I+V TDVAARG
Sbjct: 364 IIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARG 423

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG+ G A S  +
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFT 465

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  198 bits (503), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 127/415 (30%), Positives = 202/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L  L+L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++  
Sbjct: 147 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSE 206

Query: 174 -------EKLK----SHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                  EK      S+  K    AV+++P+RELA Q     K F   + ++  ++ GG 
Sbjct: 207 SFLTGPAEKAANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGA 266

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   M    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 267 PIGNQMREMDHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHI 326

Query: 283 L--AALP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P    RQTL+FSAT P+ +   A+  L + + + + +    SEN+    L  ++
Sbjct: 327 VEDCDMPPTGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVEN 386

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++ +ALL L+        A+ + + LI                                
Sbjct: 387 RDKNSALLDLLA-------ASNDNLTLI-------------------------------- 407

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 408 ---------------FVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGR 452

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            +ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 453 ANILVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVATAFFN 507

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  199 bits (507), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 212/407 (52%), Gaps = 54/407 (13%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  I+N I+    F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+ 
Sbjct: 109 WSQLGLTTDIMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLR 168

Query: 175 KLKS----HSSKVGARAVILSPSRELAMQTHKVFKDFSRG-THLRSVLLTGGDSLEEQFG 229
           ++K+       + G   +IL+P+RELA+Q H+    F +G T LRS+  TGG  L++Q  
Sbjct: 169 QIKALRPLAREESGPLGLILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQIN 228

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    +++VATPGRF+ L + +N    ++ + I + V DE+DRLF++GFE Q+ E++  
Sbjct: 229 DLKKGVEIVVATPGRFIDL-LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKT 287

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAAL 345
           +  ++Q +LFSAT P+ L  FA   L  PV + ++ +S I+EN+E      ++DE +   
Sbjct: 288 VRPDKQCVLFSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEKFNS 347

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L    EV++  +  E                                        A +  
Sbjct: 348 LL---EVLKAQINRE----------------------------------------AESHD 364

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
             ++ TI+FV ++   + I   L +  Y    I+       R   L  F+     IL+ T
Sbjct: 365 DKDEKTIIFVSSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCT 424

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +V +RG+++P ++ V+ ++   +   +VH  GRTAR   +G A S++
Sbjct: 425 EVLSRGLNVPEVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLL 471

>ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR204W
           (DED1) and YPL119C (DBP1)
          Length = 623

 Score =  197 bits (501), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 200/414 (48%), Gaps = 70/414 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L +L+L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQ 207

Query: 176 LKSHSS------------KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDS 223
             S+              K    AV+L+P+RELA Q     K F+  + ++  ++ GG  
Sbjct: 208 SFSNGPASTPDESGYYMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGAD 267

Query: 224 LEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELL 283
           + +Q   +    D+IVATPGR   L     + L S++Y V DE+DR+ +MGFE Q+  ++
Sbjct: 268 IRQQIRELERGCDLIVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIV 327

Query: 284 AA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
               +P+  NRQTL+FSAT P  +   A   L + + + + +    SEN+    L  +  
Sbjct: 328 EGCDMPTVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDI 387

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRM 399
           ++ + LL L+        A++  + L+                                 
Sbjct: 388 DKRSVLLDLLA-------ASDGGLTLV--------------------------------- 407

Query: 400 PAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLT 459
                         FV T+   + + + L       + I+G   Q  R R L  FR G  
Sbjct: 408 --------------FVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRA 453

Query: 460 SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ++LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 454 NVLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFN 507

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  197 bits (500), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 198/410 (48%), Gaps = 71/410 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI------- 173
           L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++       
Sbjct: 145 LEGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNG 204

Query: 174 -----EKLKSH-SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQ 227
                E   SH   K    AVI++P+REL  Q     K F+  + ++  ++ GG  +  Q
Sbjct: 205 PTPLPENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQ 264

Query: 228 FGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
              M    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  ++    
Sbjct: 265 MREMDRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCD 324

Query: 288 ----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
                 RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  + +++++
Sbjct: 325 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKS 384

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
           ALL L+        A++E + LI                                     
Sbjct: 385 ALLDLLA-------ASDEGLTLI------------------------------------- 400

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                     FV T+   + + + L    +  + I+G   Q  R R L  FR+G  ++LV
Sbjct: 401 ----------FVETKRLADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLLV 450

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            T VAARG+DIP + +VINF  PS    +VHR+GRT RAGN G A +  +
Sbjct: 451 ATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATAFFN 500

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  197 bits (500), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/417 (29%), Positives = 201/417 (48%), Gaps = 72/417 (17%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPM-- 172
           +F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P+  
Sbjct: 146 AFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS 205

Query: 173 ---------IEKLKSHS---SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTG 220
                    ++  +SH     K    AVI++P+RELA Q     K F   + ++  ++ G
Sbjct: 206 ESFKTGPTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYG 265

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLN 280
           G  +  Q   M    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+ 
Sbjct: 266 GSPIGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIR 325

Query: 281 ELLAALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
            ++          RQTL+FSAT P  +   A+  L + + + + +    SEN+    L  
Sbjct: 326 AIVEGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYV 385

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
           ++ ++++ALL L+        A+ + + LI                              
Sbjct: 386 ENQDKKSALLDLLS-------ASNDGLTLI------------------------------ 408

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRA 456
                            FV T+   + + + L    +  + I+G   Q+ R R L  FR+
Sbjct: 409 -----------------FVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRS 451

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G  ++LV T VAARG+DIP + +VIN+  P     +VHR+GRT RAGN G A +  +
Sbjct: 452 GRANLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVATAFFN 508

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/414 (29%), Positives = 199/414 (48%), Gaps = 70/414 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L +L+L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 137 FTSPPLDELLLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 196

Query: 175 KLKS-----------HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDS 223
             K+           +  K    AV+++P+RELA Q     K F   + ++  +  GG  
Sbjct: 197 SFKTGPTATHDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAP 256

Query: 224 LEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELL 283
           +  Q   M    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  ++
Sbjct: 257 IGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIV 316

Query: 284 AALP----SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
                     RQTL+FSAT P  +   A+  L + + + + +    SEN+    L  ++ 
Sbjct: 317 EGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQ 376

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRM 399
           ++++ALL L+        A+E+ + LI                                 
Sbjct: 377 DKKSALLDLLS-------ASEDGLTLI--------------------------------- 396

Query: 400 PAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLT 459
                         FV T+   + + + L    +  + I+G   Q  R R L  F++G  
Sbjct: 397 --------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAA 442

Query: 460 SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ++LV T VAARG+DIP + +VIN+  P     +VHR+GRT RAGN G A +  +
Sbjct: 443 TLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIATAFFN 496

>SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {ON}
           similar to uniprot|P06634 Saccharomyces cerevisiae
           YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box
           RNA helicase required for translation initiation of all
           yeast mRNAs mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 624

 Score =  196 bits (499), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 204/415 (49%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L++L+L+NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++  
Sbjct: 153 FTSPPLNELLLDNIKSARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 212

Query: 174 ----------EKLKS-HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     E+  S +  K    AV+L+P+RELA Q     K F+  + ++  ++ GG 
Sbjct: 213 SFNNGPAPVPEQASSFYIRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 272

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 273 DIRSQIRELERGCDLLVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQIRHI 332

Query: 283 L--AALPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  NRQTL+FSAT P  +   A+  L + + + + +    SEN+    L  + 
Sbjct: 333 VQDCDMPSAENRQTLMFSATFPMDIQHLARDFLEDYIFLSVGRVGSTSENITQKVLYVED 392

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++ +ALL L+        AT+  + LI                                
Sbjct: 393 ADKRSALLDLLA-------ATDGGLTLI-------------------------------- 413

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L       + I+G   Q  R R L  FR+G 
Sbjct: 414 ---------------FVETKRMADALTDFLIMQELKATAIHGDRSQPERERALAAFRSGR 458

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            ++LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 459 ANLLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATAFFN 513

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  194 bits (494), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 200/402 (49%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L+ +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 139 TFDEAGFPDYVLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 198

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +        G   ++L+P+RELA+Q  K    F + + +R+  + GG    +Q   +
Sbjct: 199 HINAQPLLGPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 258

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++ +ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 259 QRGAEICIATPGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 318

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A+  L + + V          N+  L L+  H+         I +
Sbjct: 319 TLMWSATWPKEVQQLAQDYLHDYIQV----------NVGSLELAASHN---------ITQ 359

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           VI++    +++ +L+                                M  A+Q  +E   
Sbjct: 360 VIEVVSDFDKRDRLVK------------------------------HMEVASQ-DAESKI 388

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G   Q+ R+  L  FR+G + I+V TDVAARG
Sbjct: 389 LVFASTKRMCDEITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAARG 448

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  S
Sbjct: 449 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFS 490

>TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {ON}
           Anc_8.614 YOR204W
          Length = 631

 Score =  196 bits (497), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 201/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L+ L++ NI    F +PTP+Q+ +IP++ Q RD++  A+TGSGKT  F+ P++ +
Sbjct: 157 FTSPPLADLLMENIKLAHFTKPTPVQKYSIPIVEQGRDLMACAQTGSGKTGGFLFPVLSE 216

Query: 176 -------------LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                          S+  K    AVIL+P+RELA Q     K F+  + ++  ++ GG 
Sbjct: 217 SFSTGPADLPENTQSSYMRKAYPTAVILAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 276

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +     ++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 277 DIRNQIRELERGCALLVATPGRLNDLLERGRISLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 283 L--AALP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P    RQTL+FSAT P+ +   A+  L++ + + + +    SEN+    L  + 
Sbjct: 337 VDGCDMPPAGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGRVGSTSENITQHILYVED 396

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ALL L+        A+   + LI                                
Sbjct: 397 MDKKSALLDLLS-------ASNSGLTLI-------------------------------- 417

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L+ FR G 
Sbjct: 418 ---------------FVETKRMADELTDFLIMQNFRATAIHGDRTQSERERALHAFRNGR 462

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             +LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 463 ADLLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGTATAFFN 517

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  199 bits (506), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 213/409 (52%), Gaps = 48/409 (11%)

Query: 115 SFPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI 173
           ++   GLS L +N I++   F  PTPIQ + IP I+  +DI+G+++TGSGKT A+ILP++
Sbjct: 290 NWAQLGLSSLTMNYITQILKFETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLL 349

Query: 174 EKLKSHS----SKVGARAVILSPSRELAMQTHKVFKDF--SRGTHLRSVLLTGGDSLEEQ 227
             +++      ++ G  A++L+P+RELA+Q +    +F  +    L S+   GG  L  Q
Sbjct: 350 RHVRAQKPLSRNETGPIALVLAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQ 409

Query: 228 FGMMMSNPDVIVATPGRFLHLKVEMNLDL---KSIEYAVFDESDRLFEMGFEEQLNELLA 284
             ++     +IVATPGR++ L      +L   K I + V DE+DRLF++GFE Q+++++ 
Sbjct: 410 INIIKKGVSIIVATPGRYIDLLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMK 469

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD-EREA 343
            +  ++  +LFSAT P  L  FA   L +P+ + +D E+ I+EN+E  F   K D E+  
Sbjct: 470 TIRPDKHGVLFSATFPKKLRSFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFN 529

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
            LL ++ +         E I+                                 R   +N
Sbjct: 530 NLLDILNK------HDYENIQ-----------------------------SSASRDGISN 554

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
           +  ++K  I+FV ++   E I N L+N G+    I+       R + L NFR    SIL+
Sbjct: 555 E--NDKKIIIFVSSQQISELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILL 612

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            T+V +RG+++P  + VI ++   +   +VH  GRT R   RG A S++
Sbjct: 613 CTEVLSRGLNVPETSLVIIYNAVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  192 bits (489), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 116/402 (28%), Positives = 200/402 (49%), Gaps = 53/402 (13%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G  + +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 112 TFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 171

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q       F + + +R+  + GG     Q   +
Sbjct: 172 HINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 231

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 232 TRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 291

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A+  L +P+ V          N+  L L+  H+         I +
Sbjct: 292 TLMWSATWPKEVQQLARDYLHDPIQV----------NVGSLELAASHN---------IAQ 332

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A++    K  
Sbjct: 333 IVEVVSDMEKRDRLLK------------------------------HLETASEDKDSK-I 361

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G   Q  R+  L  FR G + I+V TDVAARG
Sbjct: 362 LIFASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARG 421

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 422 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 463

>ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 603

 Score =  194 bits (492), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/415 (29%), Positives = 200/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L +L+L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 135 FTSPPLDELLLENIKFAHFVKPTPVQKYSIPIVANKRDLMACAQTGSGKTGGFLFPVLSE 194

Query: 176 -------------LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                          S+  K    AV+L+P+RELA Q     K F+  + +R  ++ GG 
Sbjct: 195 SFFTGPSEIPEAARSSYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGS 254

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L  ++Y V DE+DR+ +MGFE Q+  +
Sbjct: 255 DVGSQMRDLDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRNI 314

Query: 283 LAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P    RQTL+FSAT P  +   A+  L++ + + + +    SEN+    L  + 
Sbjct: 315 VEGCDMPGVDQRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVED 374

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
           +++++ALL L+        A+   + LI                                
Sbjct: 375 EDKKSALLDLLS-------ASSGGLTLI-------------------------------- 395

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L +F+ G 
Sbjct: 396 ---------------FVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALGSFKTGK 440

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             +LV T VAARG+DIP + +VIN+  P     +VHR+GRT RAGN G A + ++
Sbjct: 441 ADLLVATAVAARGLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGLATAFLN 495

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/389 (30%), Positives = 208/389 (53%), Gaps = 61/389 (15%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHS----SKVGARAVI 189
           F+ PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++ ++KS       + G   ++
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGLL 377

Query: 190 LSPSRELAMQTHK-VFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHL 248
           L+P+RELA+Q H+ V K  +    ++S+  TGG  +++Q   +    ++IVATPGRF+ L
Sbjct: 378 LAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRFIDL 437

Query: 249 KVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLV 304
            + +N    ++ K I + V DE+DRLF++GFE Q+N+++  +  ++Q +LFSAT P  L 
Sbjct: 438 -LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPTKLK 496

Query: 305 DFAKAGLTNPVLVRLDQESKISENLEM-LFLSTKHDEREAALLYLIQEVIQIPLATEEQI 363
            FA   L NP+ + ++ +S I+EN+E  + +    + +  +LL+ +     +P  T E  
Sbjct: 497 SFASKILHNPIHITINSKSLINENIEQRVEIFGDEESKFKSLLHWL-----VPTQTRE-- 549

Query: 364 KLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEY 423
                                                       ++ TI+FV ++   ++
Sbjct: 550 -------------------------------------------VDEKTIIFVSSQQICDF 566

Query: 424 IANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINF 483
           ++N L+  G     I+       R   L +F+     IL+ T+V +RG+++P ++ V+ +
Sbjct: 567 LSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSLVLIY 626

Query: 484 SFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +   S   +VH  GRTAR  N+G A +++
Sbjct: 627 NAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  189 bits (480), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 132/410 (32%), Positives = 188/410 (45%), Gaps = 66/410 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S GLSK +  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K
Sbjct: 4   FKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK 63

Query: 176 LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNP 235
                S  G   V+L+P+RELAMQ  + F       ++R  ++ GG+S+ +Q   +   P
Sbjct: 64  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKP 121

Query: 236 DVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--SN 289
             I+ATPGR  H  +    D    L   +Y V DE+D L    F + L   ++ALP    
Sbjct: 122 HFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDK 181

Query: 290 RQTLLFSATLPNSLVDFAKAGLT--NPVLVRLDQES----KISENLEMLFLSTKHDEREA 343
           RQTLLF+AT+ + +     A +    P L     ES     I   L++ ++      +EA
Sbjct: 182 RQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEA 241

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
            L  L        L  EE                                          
Sbjct: 242 YLYQL--------LTCEEY----------------------------------------- 252

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                K+ I+FV      E +   LK     V+ ++  + Q+ R   L+ FRA    IL+
Sbjct: 253 ---ENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILI 309

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            TDVA+RG+DIP +  V+N+  PS   +F+HR GRTARAG  G A S ++
Sbjct: 310 ATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 204/408 (50%), Gaps = 71/408 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-E 174
           F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 142 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 201

Query: 175 KLKSHSSKV--GAR----------AVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
              +  S++   AR          AV+L+P+RELA Q     K F+  + +R+ ++ GG 
Sbjct: 202 SFSTGPSEIPENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGA 261

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L  ++Y V DE+DR+ +MGFE Q+  +
Sbjct: 262 DVGSQMRELDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHI 321

Query: 283 LAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P   +RQTL+FSAT P  +   A+  L++ + + + +    SEN+      T+H
Sbjct: 322 VEGCDMPGVEDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENI------TQH 375

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
                 +LY+  E  +  L     + LI                                
Sbjct: 376 ------VLYVEDEDKKSAL-----LDLISSA----------------------------- 395

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                   ++  T++FV T+   + + + L    +  + I+G   Q  R R L  FR+G 
Sbjct: 396 --------TDGLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGK 447

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRG 506
            ++LV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G
Sbjct: 448 ANLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  194 bits (492), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 203/415 (48%), Gaps = 71/415 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L  L+L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 162 FTSPPLDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSE 221

Query: 176 -------------LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                         KS   K    A++L+P+RELA Q +   K F+  + +R  ++ GG 
Sbjct: 222 SFKNGPSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGS 281

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+ ++
Sbjct: 282 DIGSQIRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQI 341

Query: 283 L--AALP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P    RQTL+FSAT P+ +   A+  L++ + + + +    SEN+    L  + 
Sbjct: 342 VDGCDMPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVED 401

Query: 339 DEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVR 398
            ++++ LL L+        A+ + + LI                                
Sbjct: 402 MDKKSTLLDLLS-------ASNDGLTLI-------------------------------- 422

Query: 399 MPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGL 458
                          FV T+   + + + L    +  + I+G   Q  R R L  F+ G 
Sbjct: 423 ---------------FVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGN 467

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            ++LV T VAARG+DIP + +V+N+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 468 ANLLVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVATAFFN 522

>Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  188 bits (477), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 135/411 (32%), Positives = 186/411 (45%), Gaps = 68/411 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S GLSK +  ++      QPT IQR  IP IL+ RD +G A+TGSGKT AF  PM+ K
Sbjct: 10  FKSLGLSKWLTESLKAMKITQPTAIQRACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK 69

Query: 176 LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNP 235
                   G   V+L+P+RELAMQ  + F       ++R  ++ GG+S+ +Q   +   P
Sbjct: 70  WSE--DPCGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIVQQALDLQRKP 127

Query: 236 DVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--SN 289
             I+ATPGR  H  +    D    L   +Y V DE+D L    F   L   + ALP    
Sbjct: 128 HFIIATPGRLAHHIMSSGDDTVGGLMRTKYLVLDEADILLTSTFAGHLATCIGALPPKDK 187

Query: 290 RQTLLFSATLPN---SLVDFAKAGLTNPVLVRLDQES----KISENLEMLFLSTKHDERE 342
           RQTLLF+AT+ +   SL D A A    P L     ES     I   L+  ++      +E
Sbjct: 188 RQTLLFTATITDQVRSLQD-APAQEAKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKE 246

Query: 343 AALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAA 402
           A L  L        L  EE                                         
Sbjct: 247 AYLYQL--------LTCEEY---------------------------------------- 258

Query: 403 NQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSIL 462
                 K+ I+FV      E +   LK     V+ ++  + Q+ R   L+ FRA    +L
Sbjct: 259 ----ENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVL 314

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           + TDVA+RG+DIP +  V+N+  PS   +F+HR GRTARAG  G A S ++
Sbjct: 315 IATDVASRGLDIPTVELVVNYDIPSDPDVFIHRAGRTARAGRNGDAISFVT 365

>Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar to
           Ashbya gossypii ADL273C
          Length = 638

 Score =  191 bits (486), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/418 (29%), Positives = 197/418 (47%), Gaps = 74/418 (17%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 154 FTSPPLDNLLLENIKMARFTRPTPVQKYSVPIVALGRDLMACAQTGSGKTGGFLFPVLSQ 213

Query: 176 LKS----------------HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLT 219
                              +S K    AV+L+P+RELA Q     K F+  + ++  ++ 
Sbjct: 214 SFGAGPAVVTEESGNNNYYNSRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVY 273

Query: 220 GGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           GG  + +Q   +    D+IVATPGR   L     + L +++Y V DE+DR+ +MGFE Q+
Sbjct: 274 GGADIRQQLRELEHGCDLIVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQI 333

Query: 280 NELLAA--LPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLS 335
             ++    +PS  NRQTL+FSAT P  +   A   L + + + + +    SEN+    L 
Sbjct: 334 RHIVEGCDMPSVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLY 393

Query: 336 TKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXX 395
            +  ++ + LL L+        A++  + L+                             
Sbjct: 394 VEDLDKRSVLLDLLA-------ASDGGLTLV----------------------------- 417

Query: 396 XVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455
                             FV T+   + + + L       + I+G   Q  R R L  FR
Sbjct: 418 ------------------FVETKRMADALTDFLIMQNLSATAIHGDRSQAERERALQFFR 459

Query: 456 AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
               +ILV T VAARG+DIP + +VIN+  PS    +VHR+GRT RAGN G A +  +
Sbjct: 460 TARANILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFN 517

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  186 bits (472), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 187/410 (45%), Gaps = 66/410 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F + G+SK ++  +      QPT IQ+  IP ILQ +D +G A+TGSGKT AF  PM+ K
Sbjct: 5   FATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTK 64

Query: 176 LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNP 235
                S  G   V+L+P+RELAMQ  + F       ++R  L+ GG+S+ +Q   +   P
Sbjct: 65  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRKP 122

Query: 236 DVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--SN 289
             IVATPGR  H  +    D    LK  ++ V DE+D L    F E L   ++ LP    
Sbjct: 123 HFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKEK 182

Query: 290 RQTLLFSATLPNSL--VDFAKAGLTNPVLVRLDQES----KISENLEMLFLSTKHDEREA 343
           RQTLLF+AT+ + +  +  A A    P L   + ES     I   L+  +L      +EA
Sbjct: 183 RQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKEA 242

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
            L  ++                                                     N
Sbjct: 243 YLYQIL----------------------------------------------------TN 250

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
              +E S I+FV      E +   LK     V+ ++  + Q+ R   L+ FRA    +L+
Sbjct: 251 ATYNESSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLI 310

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            TDVA+RG+DIP +  VIN+   S+   F+HR GRTARAG  G +   ++
Sbjct: 311 ATDVASRGLDIPTVQLVINYDISSNPDTFIHRAGRTARAGRSGESICFVA 360

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  194 bits (492), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/401 (28%), Positives = 211/401 (52%), Gaps = 48/401 (11%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH- 179
           ++ +++N++    F  PT IQ + IP I+  RD++G+++TGSGKT +++LP+I  +K+  
Sbjct: 251 ITSVLINDLK---FENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQR 307

Query: 180 ---SSKVGARAVILSPSRELAMQTHKVFKDFS-RGTHLRSVLLTGGDSLEEQFGMMMSNP 235
              S + G   ++L+P+RELA+Q ++    F+ +   + SV  TGG  L+EQ   +    
Sbjct: 308 HLASDESGPLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGI 367

Query: 236 DVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           +++VATPGRF+ L + +N    L  + I + + DE+DRLF+MGFE Q+ +++  +  ++Q
Sbjct: 368 EIVVATPGRFIDL-LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQ 426

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
            +LFSAT PN L +FA   L  P+ + ++ +S ++EN+   F     DE +   L  I E
Sbjct: 427 CVLFSATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTLLRILE 486

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
                                        NG              ++    +    ++  
Sbjct: 487 -----------------------KHEESSNG------------VPMQQDWNDSENKDEKA 511

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+FV ++   + +   L+N GY +  I+     + R   L NF++   SIL+ T+V +RG
Sbjct: 512 IIFVSSQQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLSRG 571

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +++P ++ V+ ++   +   +VH  GRTAR  + G A +++
Sbjct: 572 LNVPEVSLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLL 612

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  192 bits (489), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/408 (29%), Positives = 211/408 (51%), Gaps = 58/408 (14%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  I++ I+++  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ 
Sbjct: 234 WSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLR 293

Query: 175 KLKS----HSSKVGARAVILSPSRELAMQTHKVFKDF-SRGTHLRSVLLTGGDSLEEQFG 229
           ++K+     S + G   +IL+P+RELA+Q H+  + F +  + LRS+  TGG  L++Q  
Sbjct: 294 QIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIK 353

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    +++VATPGRF+ L + +N    L+ + + + V DE+DRLF++GFE Q+ E++  
Sbjct: 354 ELKKGVEIVVATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKT 412

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDERE-AA 344
           +  ++Q +LFSAT P  L  FA   L  P+ + ++ +S I+EN+E       +DE +   
Sbjct: 413 IRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEG 472

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           LL ++++  Q+    E   K+                                       
Sbjct: 473 LLDILRKQTQMSSDDERDEKI--------------------------------------- 493

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
                  I+F+ ++   + I   L+   Y    I+       R   L  F+     IL+ 
Sbjct: 494 -------IVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLC 546

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 547 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score =  187 bits (475), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 129/407 (31%), Positives = 203/407 (49%), Gaps = 75/407 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK----- 175
           L  +I N++    +++PT IQR TIP ++ +RD +G+A TGSGKT AF+LP++ K     
Sbjct: 148 LLNIITNDLH---YNEPTSIQRSTIPNVINNRDFIGVASTGSGKTLAFLLPILIKLHGIP 204

Query: 176 -LKSHSSKVGARAVILSPSRELAMQT----HKVFKDFSRGTHLRSVLLTGGDSLEEQFGM 230
            L S +   G  A++L+P+RELA Q       + K + R  ++ S++  GG SLEE    
Sbjct: 205 PLNSITKHDGPLALVLAPTRELAQQIQHEGQSITKLWKRPCNIVSIV--GGHSLEEISAN 262

Query: 231 MMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP--S 288
           +    D++VATPGR L       L LK +   V DE+D++ + GFE+QL  +LA     S
Sbjct: 263 LRDGCDILVATPGRLLDCLDSHLLFLKQVNTLVLDEADKMIDFGFEDQLTTILAKTETIS 322

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTNPVLVRL-DQESKISENLEMLFLSTKHDEREAALLY 347
           NRQT++F+AT   ++   A   L  P  V +  +ESK                       
Sbjct: 323 NRQTMMFTATFSPTIEKVANGYLKKPSYVTVGGEESKPK--------------------- 361

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
            I+++++     EE++K++                                    + LP+
Sbjct: 362 -IKQIVRYVPDEEEKLKIL----------------------------------VKDFLPN 386

Query: 408 EKS-TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
            K+  I+F+  +   +++ + L+   +  + ++GS  Q  R   L   R G   IL+ TD
Sbjct: 387 YKAPIIIFINYKRTADWLFDKLREARFRATTLHGSKSQEQREHSLSLLRNGKVDILIATD 446

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           VA RG+DIP ++ V+N  FP S   FVHRVGRT RAG  G A + ++
Sbjct: 447 VAGRGIDIPNVSLVVNLQFPKSFDSFVHRVGRTGRAGKTGTALTFLT 493

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  192 bits (487), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 212/408 (51%), Gaps = 46/408 (11%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GLS   +  I+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 257 WSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHKVFKDFSRG-THLRSVLLTGGDSLEEQFG 229
           ++K+       + G   +IL+P+RELA+Q H+    F+   T +RSV  TGG  +++Q  
Sbjct: 317 QVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQIT 376

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    +++VATPGRF+ + + +N    L  K I + V DE+DRLF++GFE Q+ +++  
Sbjct: 377 DLKRGTEIVVATPGRFIDI-LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKT 435

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF-LSTKHDEREAA 344
           +  ++Q +LFSAT PN L  FA   L +P+ + ++ +  ++EN++  F +    DE+   
Sbjct: 436 VRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDN 495

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           L                 ++LI              +G                  +++ 
Sbjct: 496 L-----------------VQLIHERSEFFDEVQSENDGQ-----------------SSDV 521

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
              +   I+FV +++  ++I+  L N G +   I+     + R   L  F+    SIL+ 
Sbjct: 522 EEVDAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLC 581

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 582 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  184 bits (467), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 192/410 (46%), Gaps = 66/410 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S G SK ++  ++     QPT IQ+  IP IL+ RD +G A TGSGKT AF  PM+ K
Sbjct: 6   FKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTK 65

Query: 176 LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNP 235
                   G   ++L+P+RELAMQ  + F  F    ++R  ++ GG+S+ +Q   +   P
Sbjct: 66  WSEDPQ--GMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRP 123

Query: 236 DVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--SN 289
             I+ATPGR  H  +    D    LK +++ V DE+D L    F + L   ++ LP  + 
Sbjct: 124 HFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNK 183

Query: 290 RQTLLFSATLPNSLVDFAKAGLTN--PVLVRLDQES----KISENLEMLFLSTKHDEREA 343
           RQ LLF+AT+ + +   + A  T   P +   + ES     I + LE  +L      +E+
Sbjct: 184 RQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES 243

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
              YL Q      L +E+ +K                                       
Sbjct: 244 ---YLYQ-----ILTSEKYVK--------------------------------------- 256

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
                 S I+FV      E +   LK+    V+ ++  + Q+ R   +  FRA    +L+
Sbjct: 257 -----SSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVLI 311

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            TDVA+RG+DIP++  V+N+  P +   F+HR GRTARAG  G +   ++
Sbjct: 312 ATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLCFVT 361

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 205/405 (50%), Gaps = 55/405 (13%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GLS  I++ IS +  F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP++ 
Sbjct: 247 WSQLGLSSEIMDLISNELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVR 306

Query: 175 KLKSHS----SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGM 230
           ++K+       + G   +IL+P+RELA+Q  +    F +G+ + S+   GG  L++Q   
Sbjct: 307 QIKAQPPLAPDETGPIGLILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINE 366

Query: 231 MMSNPDVIVATPGRFLHLKVEMNLDLKS---IEYAVFDESDRLFEMGFEEQLNELLAALP 287
           +    D+IVATPGRF+ L    +  L S   I + V DE+DRLF++GF  Q+N+++  + 
Sbjct: 367 LKRGVDIIVATPGRFIDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIR 426

Query: 288 SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLY 347
            ++Q +LFSAT P+ L  FA   L NP+ + ++ +S I+EN                   
Sbjct: 427 PDKQCVLFSATFPSKLKHFASRTLKNPIQITINSKSLINEN------------------- 467

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
            IQ+ +QI    EE +K                                 R+ A ++   
Sbjct: 468 -IQQRVQI--FDEEHVKF-----------------------EFLLKRLSDRL-ALHRGED 500

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           EK+ I FV ++   + + + L   G     I+       R R L  F+     IL+ T+V
Sbjct: 501 EKTII-FVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEV 559

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            +RG+++P ++ VI ++   +   +VH VGRT R  N G A S +
Sbjct: 560 LSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/405 (28%), Positives = 211/405 (52%), Gaps = 46/405 (11%)

Query: 119 FGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLK 177
            GLS   +  I+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMTLITEKLRFESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 178 SH----SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHL-RSVLLTGGDSLEEQFGMMM 232
           +       + G   +IL+P+RELA+Q H+  + F+    L RSV  TGG  +++Q   + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLK 379

Query: 233 SNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS 288
              +++VATPGRF+ + + +N    L  K I + + DE+DRLF++GFE Q+ +++  +  
Sbjct: 380 RGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRP 438

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF-LSTKHDEREAALLY 347
           ++Q +LFSAT PN L  FA   L +P+ + ++ +  ++EN++  F +    DE+      
Sbjct: 439 DKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEK------ 492

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
               ++QI     E    I                                  +++   +
Sbjct: 493 -FDNLVQIVHGRAEFFNEILTEADGE---------------------------SSDFEEA 524

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +   I+FV ++   ++I+  L+N G +   I+     + R   L  F+    S+L+ T+V
Sbjct: 525 DAKAIIFVSSQQICDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEV 584

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 585 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  190 bits (482), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 212/408 (51%), Gaps = 46/408 (11%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GLS  I+  I+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 255 WSQLGLSTDIMTLITGKLHFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 314

Query: 175 KLKSHSS----KVGARAVILSPSRELAMQTHKVFKDFSRGTH--LRSVLLTGGDSLEEQF 228
           ++K+  S    + G   +IL+P+RELA+Q H+    F+ GT   +RSV  TGG  +++Q 
Sbjct: 315 QVKAQRSLSKHETGPLGLILAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQI 373

Query: 229 GMMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
             +    +++VATPGRF+ + + +N    L  K I + + DE+DRLF++GFE Q+ +++ 
Sbjct: 374 TDLKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMK 432

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            +  ++Q +LFSAT PN L  FA   L +P+ + ++ +  ++EN++  F     D+ +  
Sbjct: 433 TVRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEK-- 490

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
                + +IQI     +                                   +    ++ 
Sbjct: 491 ----FENLIQIAHGGNK---------------------------FFDEGQTEIDGETSDL 519

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
             ++   I+FV ++   + I+  L N G +   I+     + R   L  F+    SIL+ 
Sbjct: 520 DETDAKAIIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLC 579

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 580 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  189 bits (481), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/405 (28%), Positives = 213/405 (52%), Gaps = 46/405 (11%)

Query: 119 FGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLK 177
            GLS   +N I+ +  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMNLITSELQFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 178 SH----SSKVGARAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTGGDSLEEQFGMMM 232
           +       + G   +IL+P+RELA+Q H+    F+     +RSV  TGG  +++Q   + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLK 379

Query: 233 SNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS 288
              +++VATPGRF+ + + +N    L  K I + + DE+DRLF++GFE Q+ +++  +  
Sbjct: 380 RGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRP 438

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF-LSTKHDEREAALLY 347
           ++Q +LFSAT PN L  FA   L +P+ + ++ +  ++EN++  F +    DE+   L+ 
Sbjct: 439 DKQFVLFSATFPNKLRSFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQ 498

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
           ++++  +  L  E Q                                  V    ++    
Sbjct: 499 ILRK--RNELLDEVQ--------------------------------SDVDGETSDLEEV 524

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +   I+FV ++   ++I+  L N G +   I+     + R   L  F+    SIL+ T+V
Sbjct: 525 DAKAIIFVSSQQICDFISKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEV 584

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 585 LSRGLNVPEVSLVIIYNSVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON}
           complement(10370..11665) [1296 nt, 432 aa]
          Length = 431

 Score =  181 bits (459), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 192/410 (46%), Gaps = 66/410 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S GLS+ ++ +++      PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ +
Sbjct: 4   FKSLGLSRWLVESLNAMRITHPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLSQ 63

Query: 176 LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNP 235
                S  G   V+L+P+RELA+Q  + F       ++R  L+ GG+S+ +Q   +   P
Sbjct: 64  WSDDPS--GMFGVVLTPTRELAIQIAEQFTALGSSMNIRVCLVVGGESIVKQALELQKKP 121

Query: 236 DVIVATPGRFLHLKV----EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP--SN 289
             I+ATPGR  H  +    E+   L  ++Y V DE+D +    F   L+  +A LP    
Sbjct: 122 HFIIATPGRLAHHILSSGEEVVGGLSRVKYLVLDEADLILTQTFAADLSTCIAKLPPKQK 181

Query: 290 RQTLLFSATLPNSL--VDFAKAGLTNPVLVRLDQES----KISENLEMLFLSTKHDEREA 343
           RQTLLF+AT+ + +  +  A A  + P L   + E+     +   L++ +L      +EA
Sbjct: 182 RQTLLFTATITDQVRALQNAPAQDSKPPLFAYEVENVDNVAVPSTLKLEYLLVPEHVKEA 241

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
              YL Q      L T E  K                                       
Sbjct: 242 ---YLYQ------LLTCEDYK--------------------------------------- 253

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
               + S I+FV      E +   L++    V+ ++  + Q  R   L  FRA    +L+
Sbjct: 254 ----DSSVIVFVNRTTAAEVLRRTLRSLEVRVASLHSQMPQSERINSLQRFRANAARVLI 309

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            TDVAARG+DIP +  VIN+  P     F+HR GRTARAG  G A S ++
Sbjct: 310 ATDVAARGLDIPTVELVINYDIPQDPDTFIHRSGRTARAGRSGDAISFVT 359

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  184 bits (468), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 126/397 (31%), Positives = 200/397 (50%), Gaps = 71/397 (17%)

Query: 130 SRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLK-----SHSSKV- 183
           S+  + +PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + +L      +  +K+ 
Sbjct: 185 SKLKYREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKLPPLNDITKLD 244

Query: 184 GARAVILSPSRELAMQTH----KVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIV 239
           G   +IL+P+RELA Q      KV   +SR T + S++  GG S+EE    +    D++V
Sbjct: 245 GPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISYSLSDGCDILV 302

Query: 240 ATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS--NRQTLLFSA 297
           ATPGR +       L LK +   V DE+DR+ + GFE+QL  +LA   S   RQT++F+A
Sbjct: 303 ATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESVSGRQTMMFTA 362

Query: 298 TLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPL 357
           T+ N++   A   LT P  VR+  +   ++                     I+++++  L
Sbjct: 363 TMSNTVEKIANGYLTKPAYVRVGSDDTKAQ---------------------IKQIVEY-L 400

Query: 358 ATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTIL-FVP 416
            +EEQ                                   +  A + LP  ++ I+ F+ 
Sbjct: 401 PSEEQ---------------------------------RFQKMARDILPKFRAPIMIFIN 427

Query: 417 TRHHVEY-IANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIP 475
            +   ++ ++       + V+ ++GS  Q  R   L   R G   I++ TDVA RG+DIP
Sbjct: 428 YKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMIATDVAGRGIDIP 487

Query: 476 MLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            ++ V+NF   ++ + +VHR+GRT RAG  G A + +
Sbjct: 488 DVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFL 524

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  185 bits (469), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 198/408 (48%), Gaps = 70/408 (17%)

Query: 126 LNNISRKG--FHQPTPIQRKTIPLILQ-SRDIVGLARTGSGKTAAFILPMIEKLKSHSSK 182
           L NI ++   F  PTP+QR TIP I++ +RD VG+A TGSGKT AF+LPM+ +L ++   
Sbjct: 185 LTNILQRDLKFDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVP 244

Query: 183 V-------GARAVILSPSRELAMQTH----KVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
                   G   ++L P+RELA Q      KV         ++   + GG SLEE    +
Sbjct: 245 PIALKKMNGPIGLVLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEISSNL 304

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNR- 290
               D+++ATPG+ +       L + ++ Y V DE+D++ ++GFE+QL  +L  L  N  
Sbjct: 305 NEGCDILIATPGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEVNNS 364

Query: 291 ------QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
                 +TL+F+ATL + L   A   L NP+   +  E                    A 
Sbjct: 365 NVSSLYRTLMFTATLSSPLEKIASGYLRNPIYASIKAEG-------------------AD 405

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
            +  IQ+V+Q     +++ K I                                +   N 
Sbjct: 406 AMPQIQQVVQYCPTDDQKFKAIESI-----------------------------LREKNT 436

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
           + + +  I+F+  +   +++AN   +  Y V+ ++GS  Q  R   +   R+G   IL+ 
Sbjct: 437 MDNPR-VIIFINYKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQILIA 495

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+VAARG+DIP +A VINF FP     +VHR+GRT RAGN G A ++I
Sbjct: 496 TNVAARGLDIPNVALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLI 543

>KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {ON}
           Anc_8.614 YOR204W
          Length = 607

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/411 (29%), Positives = 197/411 (47%), Gaps = 72/411 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-EKLK-- 177
           L  L++ N+    F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 156 LDDLLMENVKLARFTKPTPVQKYSIPIISIGRDLMACAQTGSGKTGGFLFPVLSESFKVG 215

Query: 178 ----------SHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQ 227
                     S+  K    AVI++P+RELA Q     K F   + +   ++ GG  +  Q
Sbjct: 216 PSVVQGNEGYSYQRKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVNPCVVYGGAPIGNQ 275

Query: 228 FGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA-- 285
              M    D++VATPGR   +     + L +++Y V DE+DR+ +MGFE Q+ +++    
Sbjct: 276 LREMDRGCDLLVATPGRLSDMIERGKISLSNVKYLVLDEADRMLDMGFEIQIRQIVEGCD 335

Query: 286 LP--SNRQTLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKISENLEMLFLSTKHDERE 342
           +P  S RQTL+FSAT P  +   A+  L  + + + + +    SEN+    +  +  +++
Sbjct: 336 MPPSSERQTLMFSATFPADIQHLARDFLRPDYIFLSVGKVGSTSENITQRVMYVESMDKK 395

Query: 343 AALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAA 402
           +ALL L+        ++E  + LI                                    
Sbjct: 396 SALLDLLA-------SSEPGLTLI------------------------------------ 412

Query: 403 NQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSIL 462
                      FV T+   + + + L       + I+G   Q  R R L  F++G  +IL
Sbjct: 413 -----------FVETKRMADQLTDFLIMQNLRATAIHGDRTQSERERALAAFKSGRANIL 461

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           V T VAARG+DIP + +VIN+  P     +VHR+GRT RAGN G A +  +
Sbjct: 462 VATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGLATAFFN 512

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  187 bits (475), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 212/408 (51%), Gaps = 50/408 (12%)

Query: 116 FPSFGLSKLILNNISR-KGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  I+N+I     F + TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 260 WSQLGLNTSIMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 319

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHK-VFKDFSRGTHLRSVLLTGGDSLEEQFG 229
           ++KS     +S+ G   ++L+P+RELA+Q H+ + K  +    L  +  TGG  L++Q  
Sbjct: 320 QVKSQRDLSNSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQIS 379

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +     ++VATPGRF+ L + +N    L    I + V DE+DRLF+MGFE Q+ +++ A
Sbjct: 380 SVKRGVKIVVATPGRFIDL-LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKA 438

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDERE-AA 344
           +  ++Q +LFSAT  N +  FA   L NP+ + ++  + ++EN+   F   + D ++   
Sbjct: 439 IRPDKQCVLFSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDE 498

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           L+ L++E      A E                                         ++ 
Sbjct: 499 LISLLKERNDKHEAQE-------------------------------------GFEESDN 521

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
           L   K TI+FV ++   + +   L + G+ +  I+     + R   L  +R    S+L+ 
Sbjct: 522 LQDNK-TIIFVASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLC 580

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           T+V +RG+++P ++ VI ++   +   ++H  GRTAR  ++G A S +
Sbjct: 581 TEVLSRGLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa]
           {ON} Anc_5.69 YHR169W
          Length = 393

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 190/407 (46%), Gaps = 58/407 (14%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F + GLS+ ++ ++       PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   NFENLGLSRWLVESLKSMKITTPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLT 66

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           K        G  AVIL+P+RELAMQ  + F       ++R  L+ GG+++ +Q   + + 
Sbjct: 67  KWS--EDPCGMFAVILTPTRELAMQIAEQFTALGSSMNIRVCLVVGGENIVKQALELQNK 124

Query: 235 PDVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--S 288
           P  I+ATPGR  H  +    D        +Y V DE+D L    F + L+  +  LP   
Sbjct: 125 PHFIIATPGRLAHHILRSGEDTVGGFIRCKYLVLDEADILLTSTFSKDLSVCIGKLPPKE 184

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYL 348
            RQTLLF+AT                          I++ +++L  + KHD R     Y 
Sbjct: 185 KRQTLLFTAT--------------------------ITDQVKVLQDAPKHDGRLPLFSYQ 218

Query: 349 IQEV--IQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLP 406
           ++ +  + IP   + +  L+                              +   A N   
Sbjct: 219 VESIDKVAIPSTLKTEYVLV------------------PGHVKEAYLYHLLTCEAYN--- 257

Query: 407 SEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
            E S I+FV      E +   L +    V+ ++  + Q+ R   L+ FRA    +L+ TD
Sbjct: 258 -ESSAIVFVNRTVTAEILRRTLYDLEVRVTSLHSQMPQQERTNSLHRFRANAARVLIATD 316

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           VA+RG+DIP +  VIN+  P+    F+HR GRTARAG  G A S ++
Sbjct: 317 VASRGLDIPTVELVINYDLPADPDTFIHRSGRTARAGRTGDAISFVT 363

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  179 bits (454), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 129/429 (30%), Positives = 191/429 (44%), Gaps = 66/429 (15%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G++K +   ++     QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   TFKDLGVAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLT 66

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           K    +   G   ++L+P+RELAMQ  + F       ++R  L+ GG+ +  Q   +   
Sbjct: 67  KWS--ADPCGMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRK 124

Query: 235 PDVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--S 288
           P  I+ATPGR  H  +    D    LK + Y V DE+D L    F + L   +  LP   
Sbjct: 125 PHFIIATPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKE 184

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTN--PVLVRLDQES----KISENLEMLFLSTKHDERE 342
            RQ LLF+AT+ + ++    A  T+  P L     E+     +  +L+  +L      +E
Sbjct: 185 KRQNLLFTATMTDQVLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKE 244

Query: 343 AALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAA 402
           A   YL Q      L++EE                                         
Sbjct: 245 A---YLYQV-----LSSEEY---------------------------------------- 256

Query: 403 NQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSIL 462
                 KS I+FV      E +  +L      V+ ++  + QR R   L  FRA    +L
Sbjct: 257 ----KSKSAIVFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVL 312

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXX 522
           + TDVA+RG+DIP +  V+N+  P++   ++HR GRTARAG  G A S I+         
Sbjct: 313 IATDVASRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQA 372

Query: 523 XXXXXGKKI 531
                GKK+
Sbjct: 373 IEERIGKKM 381

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  186 bits (472), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/388 (28%), Positives = 199/388 (51%), Gaps = 55/388 (14%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH----SSKVGARAVI 189
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++  +K+      ++ G  A+I
Sbjct: 325 FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLALI 384

Query: 190 LSPSRELAMQTHK-VFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHL 248
           ++P+RELA+Q ++   +       LR++  TGG  L+ Q   +    +++VATPGRF+ L
Sbjct: 385 IAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVVATPGRFIDL 444

Query: 249 KVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLV 304
            + MN    +  K I + V DE+DRLF+MGFE Q+ +++  +  ++Q +LFSAT PN L 
Sbjct: 445 -LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPNKLR 503

Query: 305 DFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIK 364
           +FA   L +P+ + ++  + ++EN+        ++  +  +L  + E  Q  L + EQ  
Sbjct: 504 NFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAKLVSPEQ-- 561

Query: 365 LIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYI 424
                                                      ++  I+FV ++   + +
Sbjct: 562 -------------------------------------------DEKVIIFVASQQICDTL 578

Query: 425 ANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFS 484
              L+N  Y +  I+     + R   L  F+    SIL+ T+V +RG+++P ++ V+ F+
Sbjct: 579 YAKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVPEVSLVVIFN 638

Query: 485 FPSSSKIFVHRVGRTARAGNRGWAYSII 512
              +   +VH  GRTAR  N G A +++
Sbjct: 639 AIKTFAQYVHTTGRTARGNNHGDAITLL 666

>KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {ON}
           similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 589

 Score =  181 bits (460), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/394 (31%), Positives = 196/394 (49%), Gaps = 71/394 (18%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH------SSKVGARA 187
           + +PTPIQR TIP +L  RD VG+A TGSGKT AF++P + +L +       +   G  A
Sbjct: 207 YLEPTPIQRATIPNVLNGRDFVGVAATGSGKTLAFLIPPLCQLNNTPPLNDITKMDGPSA 266

Query: 188 VILSPSRELAMQ----THKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPG 243
           +IL+P+RELA Q     +KV K   R T +  V L GG S+EE    +    D++VATPG
Sbjct: 267 LILAPTRELAQQIEAEANKVVKFLHRPTKV--VSLVGGHSVEEISYSLSHGCDILVATPG 324

Query: 244 RFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS--NRQTLLFSATLPN 301
           R +       L L+ +   + DE+DR+ + GFE+QL  +LA   S   RQT++F+AT+ +
Sbjct: 325 RLIDCLESNILVLQQVRTLILDEADRMIDFGFEDQLTTILARTESVKGRQTMMFTATMSS 384

Query: 302 SLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEE 361
           ++   A   L  P  VR+  +   ++                     I++V+Q  L +EE
Sbjct: 385 TIERIANGYLNKPAYVRVGSQDTKAQ---------------------IKQVVQY-LPSEE 422

Query: 362 QIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTIL-FVPTRHH 420
           Q                                   R+   + LP  +S I+ F+  +  
Sbjct: 423 Q--------------------------------RFSRL-CRDVLPRFRSPIMIFINYKRT 449

Query: 421 VEYI-ANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLAN 479
            +++ A       Y V+ ++GS  Q  R   L   R+G   I++ TDVA RG+DIP ++ 
Sbjct: 450 ADWLAAKFSSETRYRVTTLHGSKSQEQREHSLNLLRSGKADIMIATDVAGRGIDIPNVSL 509

Query: 480 VINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           V+NF   +S + ++HR+GRT RAG  G A + ++
Sbjct: 510 VVNFQMCTSFEGYIHRIGRTGRAGKSGCALTFLT 543

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  177 bits (450), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/411 (29%), Positives = 185/411 (45%), Gaps = 66/411 (16%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F + G+SK +   +       PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ 
Sbjct: 4   TFSNLGVSKWLTEALRAMKIDHPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLT 63

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           K     S  G   V+L+P+RELAMQ  + F       ++R  L+ GG+S+ +Q   +   
Sbjct: 64  KWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRK 121

Query: 235 PDVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP--S 288
           P  I+ATPGR  H  +    D    LK +++ V DE+D L    F E L   +  LP   
Sbjct: 122 PHFIIATPGRLAHHVMNSGEDTIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKE 181

Query: 289 NRQTLLFSATLPNS--LVDFAKAGLTNPVLVRLDQES----KISENLEMLFLSTKHDERE 342
            RQ LLF+AT+ +   ++  A A    P L   + ES     I   L+  +L      +E
Sbjct: 182 RRQNLLFTATVTDQVKMLQNAPATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKE 241

Query: 343 AALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAA 402
           A L  ++     I                                               
Sbjct: 242 AYLYQILTSAAYI----------------------------------------------- 254

Query: 403 NQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSIL 462
                + S I+FV      E +   LK     V+ ++  + Q+ R   L+ FRA    +L
Sbjct: 255 -----DSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVL 309

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           + TDVA+RG+DIP +  V+N+   ++   F+HR GRTARAG +G +   ++
Sbjct: 310 IATDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICFVA 360

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  180 bits (456), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 126/400 (31%), Positives = 196/400 (49%), Gaps = 74/400 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK----- 175
           + K+I +++   G+ +PTPIQR TIP +  +RD +G+A TGSGKT AF++P+  K     
Sbjct: 173 IVKVITDDL---GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLP 229

Query: 176 -LKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHL-RSVLLT---GGDSLEEQFGM 230
            L   + + G +A+IL+P+RELA Q     K F    H  R  L+T   GG +LEE    
Sbjct: 230 PLNVITRQDGPQALILAPTRELAQQIEAEAKKFC--AHWKRPCLVTSIVGGHTLEEIIFN 287

Query: 231 MMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-- 288
           +    +++VATPGR +       L LK +   V DE+DR+ + GFE+QL  +LA      
Sbjct: 288 LQDGCNILVATPGRLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDIL 347

Query: 289 NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYL 348
            +QTL+F+AT+ +S+   A   L NP  V +       +                     
Sbjct: 348 EKQTLMFTATMSSSIERIANGYLRNPGFVTIGGSGSAPQ--------------------- 386

Query: 349 IQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSE 408
           IQ++I+  +AT+EQ                                   +M   + LP+ 
Sbjct: 387 IQQIIEY-VATDEQ---------------------------------RFKMLTQDILPNY 412

Query: 409 K-STILFVPTRHHVEYIA-NLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
           +   I+F+  +   +++     +   + V+ ++GS  Q  R   L  FR G   I+V TD
Sbjct: 413 RPPVIIFINYKVTADWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATD 472

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRG 506
           VA RG+DIP ++ V+NF  PS    ++HR+GRT RA  +G
Sbjct: 473 VAGRGIDIPNVSLVVNFQMPSKLDDYIHRIGRTGRANQKG 512

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  177 bits (448), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/405 (29%), Positives = 204/405 (50%), Gaps = 62/405 (15%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS+  L  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE
Sbjct: 35  TFKELNLSQPTLKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +M
Sbjct: 95  MLHSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 154

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              ++++ATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ +R
Sbjct: 155 KGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDR 214

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDEREAALLY 347
           Q++LFSAT    + D A+  L   P+ + +  +++S  ++ LE  ++  + D+R   L  
Sbjct: 215 QSMLFSATQTTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLLFS 274

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
            ++          ++ K+I                              V + + N +  
Sbjct: 275 FLKR--------NQKKKII------------------------------VFLSSCNSV-- 294

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
                     ++H E    LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 295 ----------KYHAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 155/257 (60%), Gaps = 6/257 (2%)

Query: 97  VNEYFS--TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDI 154
           V EYF+    A+  KK    +F +  LS+ +L  +S  GF +P+PIQ  TIP+ L  +DI
Sbjct: 195 VAEYFAPEEEAEDAKKQTHTTFNTLNLSRPVLKGLSSLGFTKPSPIQSATIPIALLGKDI 254

Query: 155 VGLARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH- 212
           V  A TGSGKTAAF++P+IE+L    +KV + R VIL+P+RELA+Q   V K      + 
Sbjct: 255 VAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVVILTPTRELAIQISDVAKKIGHFVNG 314

Query: 213 LRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLF 271
           L   L  GG +L +Q  ++ S PD+++ATPGRF+ H++   +  +  +E  V DE+DR+ 
Sbjct: 315 LTFGLAVGGLNLRQQEQILKSRPDIVIATPGRFIDHVRNSASFSVDRVEILVLDEADRML 374

Query: 272 EMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEM 331
           E GF+++L+E++  LP+ RQ LLFSAT+ + +       L  PV + +D   + ++ L  
Sbjct: 375 EEGFQDELSEIMTLLPTRRQNLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAADRLVQ 434

Query: 332 LFLST-KHDEREAALLY 347
            F+   K D  + ALLY
Sbjct: 435 EFVRIRKRDHLKPALLY 451

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 63/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G  V+ ++GSL Q  R   +  F++    +L+ TD+
Sbjct: 462 QKRIVVFVSRKEVAHRLRIILGLLGMGVAELHGSLSQEQRLDSVNKFKSLDVPVLICTDL 521

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + + +
Sbjct: 522 ASRGLDIPKIEIVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 566

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 152/249 (61%), Gaps = 4/249 (1%)

Query: 103 TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGS 162
           T     KK    +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 220 TEGDEAKKQMYENFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 279

Query: 163 GKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTG 220
           GKTAAF++P+IE+L    +K+ + R ++L P+RELA+Q   V K  +R  + +   L  G
Sbjct: 280 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVG 339

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           G +L +Q  M+ S PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++L
Sbjct: 340 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 399

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KH 338
           NE++  LPSNRQ LLFSAT+ + +       L  PV + +D   K +  L   F+   K 
Sbjct: 400 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKR 459

Query: 339 DEREAALLY 347
           D  + ALL+
Sbjct: 460 DHLKPALLF 468

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 83/176 (47%), Gaps = 26/176 (14%)

Query: 408 EKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
           +K  ++FV    T H +  I  LL   G  V  ++GSL Q  R   +  F+     +L+ 
Sbjct: 479 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLIC 535

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAY----------SIISX 514
           TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G +           SI+  
Sbjct: 536 TDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRA 595

Query: 515 XXXXXXXXXXXXXGKKI----------LTTPMYEAATDLLEKRWVEEGKEKILFKA 560
                        GK +           T  + E+  D +E   VEE +EK + +A
Sbjct: 596 AIKSVEENKSLTQGKALGRNVDWVQIEETNKLVESMNDTIEDILVEEKEEKEILRA 651

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  179 bits (454), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 152/249 (61%), Gaps = 4/249 (1%)

Query: 103 TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGS 162
           T A   KK    +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 212 TEANDAKKQMYDNFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 271

Query: 163 GKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTG 220
           GKTAAF++P+IE+L     K+ + R ++L P+RELA+Q   V K  +R  + +   L  G
Sbjct: 272 GKTAAFMIPIIERLLYKPGKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVG 331

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           G +L +Q  ++ S PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++L
Sbjct: 332 GLNLRQQEQLLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 391

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KH 338
           NE++  LPSNRQ LLFSAT+ + +       L  PV + +D   + +  L   F+   K 
Sbjct: 392 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKR 451

Query: 339 DEREAALLY 347
           D  + ALL+
Sbjct: 452 DHLKPALLF 460

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 83/176 (47%), Gaps = 26/176 (14%)

Query: 408 EKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
           +K  ++FV    T H +  I  LL   G  V  ++GSL Q  R   +  F+     +LV 
Sbjct: 471 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVC 527

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAY----------SIISX 514
           TD+A+RG+DIP +  V+N+  P S +I++HRVGRTARA   G +           SI+  
Sbjct: 528 TDLASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLVGESSHDRSIVRA 587

Query: 515 XXXXXXXXXXXXXGKKI----------LTTPMYEAATDLLEKRWVEEGKEKILFKA 560
                        GK +           T  + E+ +D +E+  VEE  EK + +A
Sbjct: 588 AIKSVEENKSLTQGKALGRNVDWIQIEETNKLVESMSDTVEEILVEEKDEKEILRA 643

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  174 bits (442), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 199/404 (49%), Gaps = 62/404 (15%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F   GLSK  L  I + GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P IE 
Sbjct: 38  FDELGLSKQTLKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEM 97

Query: 176 LKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +  
Sbjct: 98  LHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLSK 157

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQ 291
             ++I+ATPGR L HL+       K+++  + DE+DR+ E+GFE+++ +++  LP+ +RQ
Sbjct: 158 GVNLIIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQ 217

Query: 292 TLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAALLYL 348
           ++LFSAT    + D A+  L   P+ + +D E + S  + LE  ++  + D+R   L   
Sbjct: 218 SMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLFTF 277

Query: 349 IQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSE 408
           +++          Q K I                              V + + N +   
Sbjct: 278 LKKF---------QTKKI-----------------------------IVFLSSCNSV--- 296

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
                    R++ E    LL      V  ++G   Q+ R    + F      ILV TDVA
Sbjct: 297 ---------RYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVA 343

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           ARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 344 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 386

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 194/405 (47%), Gaps = 81/405 (20%)

Query: 134 FHQPTPIQRKTIPLIL---QSRDIVGLARTGSGKTAAFILPMIEKL-----KSHSSKV-- 183
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AFI+P++ ++     +  S K+  
Sbjct: 193 FFSPTPIQRITIPNVCNAKQHRDFLGVASTGSGKTLAFIIPILIRMSRSPPRPSSLKIMD 252

Query: 184 GARAVILSPSRELAMQ----THKVFKDFSRGTH--LRSVLLTGGDSLEEQFGMMMSNPDV 237
           G +A+IL+P+REL  Q    T KV K +SR  +   R + + GG S EE    +    D+
Sbjct: 253 GPKALILAPTRELVQQIQAETEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDI 312

Query: 238 IVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL------PSNRQ 291
           +VATPGR +       L +K +E  V DE+D++ ++GFE+Q+  +L  +       +NRQ
Sbjct: 313 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQ 372

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVL--VRLDQESKISENLEMLFLSTKHDEREAALLYLI 349
           TL+F+AT+   +   A   +  PV   + LD  S+                       LI
Sbjct: 373 TLMFTATMTPVIEKIAAGYMRKPVYATIGLDTGSE----------------------PLI 410

Query: 350 QEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEK 409
           ++V++     EE+ K +                                      +  E 
Sbjct: 411 RQVVEYADNEEEKFKKLKSVV----------------------------------IKYES 436

Query: 410 STILFVPTRHHVEYIANLLKN-CGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
             I+F+  +   +++A   +      V+ ++GS  Q  R   L  FR G   I++ T+VA
Sbjct: 437 PIIIFINYKQTADWLAERFQTETNMKVTILHGSKSQEQREHSLQLFRTGKVQIMIATNVA 496

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ARG+DIP ++ V+NF        +VHR+GRT RA   G A+S +S
Sbjct: 497 ARGLDIPNVSLVVNFQISKKIDDYVHRIGRTGRAQREGTAFSFVS 541

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  177 bits (449), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 151/245 (61%), Gaps = 8/245 (3%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           KK    +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF
Sbjct: 221 KKQTYANFNSLSLSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAF 280

Query: 169 ILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTHLRSV---LLTGGDSL 224
           ++P+IE+L   S+K+ A R ++L+P+RELA+Q   V K    G  +  +   L  GG +L
Sbjct: 281 MIPVIERLLFKSAKIAATRVIVLTPTRELAIQISDVGKKI--GKFINGITFGLAVGGLNL 338

Query: 225 EEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELL 283
            +Q   + + PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+E+LNE++
Sbjct: 339 RQQEQELKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIM 398

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTK-HDERE 342
             LP+ RQTLLFSAT+ + +       L  PV + +D   + +  L   F+  +  D  +
Sbjct: 399 QLLPNKRQTLLFSATMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRARDHLK 458

Query: 343 AALLY 347
            ALL+
Sbjct: 459 PALLF 463

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 63/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G  V+ ++GSL Q  R   +  F++    +L+ TD+
Sbjct: 474 QKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDL 533

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + S +
Sbjct: 534 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFV 578

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  177 bits (448), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 155/249 (62%), Gaps = 4/249 (1%)

Query: 103 TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGS 162
           + ++  KK    +F    LS+ ++  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 195 SESENAKKEVHKTFNDLALSRPVMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 254

Query: 163 GKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTG 220
           GKTAAF++P+IE+L    +KV + R ++L+P+RELA+Q   V K   +  ++L   L  G
Sbjct: 255 GKTAAFMIPIIERLLYKPAKVASTRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVG 314

Query: 221 GDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
           G +L +Q  M+ + PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+++L
Sbjct: 315 GLNLRQQEQMLKTRPDIVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDEL 374

Query: 280 NELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KH 338
           NE+++ LPS RQTLLFSAT+ + +       L  PV + +D   + +  L   F+   K 
Sbjct: 375 NEIMSLLPSKRQTLLFSATMNSRIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKR 434

Query: 339 DEREAALLY 347
           D  + +LL+
Sbjct: 435 DHLKPSLLF 443

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 63/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G  V+ ++GSL Q  R   +  F++    +L+ TD+
Sbjct: 454 QKRIVVFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDL 513

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + + +
Sbjct: 514 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFV 558

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  176 bits (445), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 155/255 (60%), Gaps = 6/255 (2%)

Query: 99  EYFSTTAQTN--KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           E++++  + +  KK    +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ LQ +D++ 
Sbjct: 222 EFYASDNEADDAKKQTHETFNSLSLSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDVIA 281

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVG-ARAVILSPSRELAMQTHKVFKDFSR-GTHLR 214
            A TGSGKTAAF++P+IE+L    SKV   R ++L+P+RELA+Q   V K   +  + L 
Sbjct: 282 GAVTGSGKTAAFMIPIIERLLFKPSKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSGLT 341

Query: 215 SVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEM 273
             L  GG +L +Q   + + PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E 
Sbjct: 342 FGLAVGGLNLRQQEQALKARPDIVIATPGRFIDHIRNSASFNVDSVEILVLDEADRMLEE 401

Query: 274 GFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF 333
           GF+++L E++  LPS RQ LLFSAT+ + +       L  PV + +D   + +  L   F
Sbjct: 402 GFQDELKEIMTMLPSKRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAASKLTQEF 461

Query: 334 LST-KHDEREAALLY 347
           +   K D  + ALL+
Sbjct: 462 VRIRKRDNLKPALLF 476

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 407 SEKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
           ++K  ++FV    T H +  I  LL   G  V+ ++GSL Q  R   +  F++    +L+
Sbjct: 486 AQKRIVVFVARKETAHRLRIILGLL---GMAVAELHGSLTQEQRLESVTRFKSLDVPVLI 542

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            TD+A+RG+DIP +  VIN+  P S +I++HRVGRTARAG  G + +++
Sbjct: 543 CTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLV 591

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  176 bits (445), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 160/260 (61%), Gaps = 7/260 (2%)

Query: 100 YFSTTAQTNKKHKK--GSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGL 157
           +++  A++ +  K+    F S  LS+ +L  +   G+ +P+PIQ  TIP+ L  +DI+  
Sbjct: 203 FYAPEAESEQATKQVHNDFNSLSLSRPVLKGLGDLGYTRPSPIQSATIPIALLGKDIIAG 262

Query: 158 ARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRS 215
           A TGSGKTAAF++P+IE+L    +K+ + R ++L+P+RELA+Q   V K   +  + L  
Sbjct: 263 AVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLTPTRELAIQVSDVAKKLGKYVSGLTF 322

Query: 216 VLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMG 274
            L  GG +L +Q   + + PD++VATPGRF+ H++   + ++ S+E  V DE+DR+ E G
Sbjct: 323 GLAVGGLNLRQQEQSLKARPDIVVATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEEG 382

Query: 275 FEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFL 334
           F+E+LNE+L+ LPS RQTLLFSAT+ + +       L  PV V +D   + +  L   F+
Sbjct: 383 FQEELNEILSLLPSKRQTLLFSATMNSKIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFV 442

Query: 335 STKHDE--REAALLYLIQEV 352
             +  +  + + L +LI+++
Sbjct: 443 RIRKRDHLKPSVLFHLIKKL 462

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G  V  ++GSL Q  R + +  F++    ILV TD+
Sbjct: 467 QKRMVVFVARKEMAHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDL 526

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VIN+  P + ++++HRVGRTARAG  G + S++
Sbjct: 527 ASRGLDIPKIEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLV 571

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  176 bits (446), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 160/246 (65%), Gaps = 12/246 (4%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+  I++ I+++  F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++ 
Sbjct: 252 WSQLGLTTDIMDLITKEFKFVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLR 311

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHKVFKDFSRGT-HLRSVLLTGGDSLEEQFG 229
           ++K+      ++ G   +IL+P+RELA+Q ++    F+ G+  +RS+  TGG  L++Q  
Sbjct: 312 QIKAQRPLSKTETGPMGLILAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQIN 371

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    +V+VATPGRF+ L + +N    L  + I + V DE+DRLF++GFE Q+ +++ A
Sbjct: 372 DLKKGVEVVVATPGRFIDL-LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKA 430

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEM-LFLSTKHDEREAA 344
           +  ++Q +LFSAT PN L +FA   L  P+ + ++ +S I+EN+E  L +    +E+ AA
Sbjct: 431 VRPDKQCVLFSATFPNKLKNFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAA 490

Query: 345 LLYLIQ 350
           +L +++
Sbjct: 491 MLEVLE 496

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           ++ TI+FV ++   + I N L   GY+   I+       R   L  F+     IL+ T+V
Sbjct: 519 DEKTIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEV 578

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            +RG+++P ++ VI ++   +   +VH  GRTAR  N+G A +++
Sbjct: 579 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTML 623

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  170 bits (431), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 197/407 (48%), Gaps = 62/407 (15%)

Query: 113 KGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPM 172
           K  F    LS   +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFAELNLSPPTMKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 173 IEKLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGM 230
           IE L S   K   G   ++++P+RELA+Q   V K           ++ GG +  ++   
Sbjct: 87  IEMLHSLKFKPRNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEADK 146

Query: 231 MMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS- 288
           +    ++++ATPGR L HL+   +   K+++  V DE+DR+ E+GFE+++ +++  LPS 
Sbjct: 147 LAKGVNLLIATPGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILPSE 206

Query: 289 NRQTLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAAL 345
            RQT+LFSAT    + D A+  L   P+ + +D E + S  + LE  ++    D+R   L
Sbjct: 207 ERQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFLLL 266

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
              ++          ++ K+I                              V + + N +
Sbjct: 267 FSFLKR--------NQKKKII------------------------------VFLSSCNSV 288

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                       R++ E    LL      V  ++G   Q+ R    + F       LV T
Sbjct: 289 ------------RYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCT 332

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G++G   S++
Sbjct: 333 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  170 bits (431), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 202/405 (49%), Gaps = 62/405 (15%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS   L  I + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 38  NFKDLKLSDPTLKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   ++
Sbjct: 98  MLHSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLI 157

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              +++VATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ +R
Sbjct: 158 KGVNMLVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDR 217

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDEREAALLY 347
           Q++LFSAT    + D A+  L   P+ + +  ++++  ++ LE  ++  + D+R   L  
Sbjct: 218 QSMLFSATQTTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCESDKRFLLLFS 277

Query: 348 LIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPS 407
            ++          ++ K+I                              V + + N +  
Sbjct: 278 FLKR--------NQKKKII------------------------------VFLSSCNSV-- 297

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
                     R++ E    LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 298 ----------RYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 153/243 (62%), Gaps = 5/243 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F S  LS+ +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 232 TFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 175 KLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTGGDSLEEQFGMMM 232
           +L    +KV + R ++L+P+RELA+Q   V K   +  + L   L  GG +L +Q   + 
Sbjct: 292 RLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELK 351

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           + PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ E GF+E+LNE+L  LPS RQ
Sbjct: 352 TRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQ 411

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KHDEREAALL-YLI 349
           TLLFSAT+ + +       L  PV + ++   + +  L   F+   K D  + ALL YLI
Sbjct: 412 TLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLI 471

Query: 350 QEV 352
           +++
Sbjct: 472 RKL 474

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G  V  ++GSL Q  R + + NF++    +L+ TD+
Sbjct: 479 QKRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDL 538

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VINF  P S +I++HRVGRTARAG  G + + +
Sbjct: 539 ASRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  175 bits (443), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 190/383 (49%), Gaps = 58/383 (15%)

Query: 138 TPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH----SSKVGARAVILSPS 193
           TPIQ +TIP I+  RD++G+++TGSGKT +++LPMI  +K+     + + G  AVI +P+
Sbjct: 276 TPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAVIFAPT 335

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMN 253
           RELA+Q ++  +       + S+  TGG  L++Q   + +  ++ +ATPGRF+ L     
Sbjct: 336 RELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDLLSLNG 395

Query: 254 LDLKS---IEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAG 310
            +L S   I + V DE+DRLF+ GFE Q+  +L  +  +RQ +LFSAT P+ + +FA   
Sbjct: 396 GNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSNFASRF 455

Query: 311 LTNPVLVRLDQESKISENLEMLF-LSTKHDEREAALLYLIQEVIQIPLATEEQIKLIXXX 369
           L +P+ + ++ E  ++E +   F + +   ++   LL L++                   
Sbjct: 456 LDSPLQITVNAEGMVNERINQKFTICSDESDKFKELLSLLK------------------- 496

Query: 370 XXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLK 429
                                            N    ++ TI+FV ++   + I   L 
Sbjct: 497 -------------------------------VFNSETVDEKTIIFVSSQQICDIIEKRLT 525

Query: 430 NCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSS 489
           +    +  I+       R + L  F+    SIL+ T+V +RG+++P ++ VI ++   + 
Sbjct: 526 DYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILYNSAKTF 585

Query: 490 KIFVHRVGRTARAGNRGWAYSII 512
             +VH  GRTAR    G + S++
Sbjct: 586 AQYVHSTGRTARGTREGTSISLL 608

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 159/257 (61%), Gaps = 6/257 (2%)

Query: 97  VNEYFSTTAQTN--KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDI 154
           V ++++  A+ +  KK    SF +  LS+ +L  ++  G+++P+PIQ  TIP+ L  +DI
Sbjct: 230 VAKFYAPEAEGDDAKKQTHTSFNTLSLSRPVLKGLANLGYNKPSPIQSATIPIALLGKDI 289

Query: 155 VGLARTGSGKTAAFILPMIEKLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH- 212
           +  A TGSGKTAAF++P+IE+L    +KV + R ++L+P+RELA+Q   V K   +  + 
Sbjct: 290 IAGAVTGSGKTAAFMIPIIERLLFKPAKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNG 349

Query: 213 LRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLF 271
           L   L  GG +L +Q  ++   PD+++ATPGRF+ H++   + ++ S+E  V DE+DR+ 
Sbjct: 350 LTFGLAVGGLNLRQQEQILKQRPDIVIATPGRFIDHVRNSASFNVDSVEILVMDEADRML 409

Query: 272 EMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEM 331
           E GF+E+LNE++  LP+ RQT+LFSAT+ + +       L  PV + ++   + +  L  
Sbjct: 410 EEGFQEELNEIMQLLPTKRQTMLFSATMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQ 469

Query: 332 LFLSTK-HDEREAALLY 347
            F+  +  D  + ALL+
Sbjct: 470 EFVRIRTRDHLKPALLF 486

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 407 SEKSTILFVP---TRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILV 463
           S+K  ++FV    T H +  I  LL   G  V+ ++GSL Q  R   +  F++    +L+
Sbjct: 496 SQKRMVVFVARKETAHKLRIILGLL---GMNVAELHGSLTQEQRLESVTKFKSLEIPVLI 552

Query: 464 VTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            TD+A+RG+DIP +  VIN+  P S  I++HRVGRTARAG  G + S++
Sbjct: 553 CTDLASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLV 601

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  167 bits (422), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 109/374 (29%), Positives = 179/374 (47%), Gaps = 59/374 (15%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 SFEEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    +   G   ++LSP+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H          I +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGS----------LELSASH---------TITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           V+++    E++ +L                                 +  A+Q   E  T
Sbjct: 335 VVEVVSDFEKRDRL------------------------------NKHLETASQ-DDEYKT 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + ++V TDVAARG
Sbjct: 364 LVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVAARG 423

Query: 472 VDIPMLANVINFSF 485
           +       ++NFSF
Sbjct: 424 I------GMLNFSF 431

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  172 bits (436), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 145/237 (61%), Gaps = 4/237 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F S  LS+ +L  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 234 TFNSLSLSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 293

Query: 175 KLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSRGTH-LRSVLLTGGDSLEEQFGMMM 232
           +L    + + + R V+L+P+RELA+Q   V K+  +  + L   L  GG +L +Q   + 
Sbjct: 294 RLLYKPAHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQEQALK 353

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           + PD+++ATPGRF+ HL+   +  + S+E  V DE+DR+ E GF+E+L E+++ +PS RQ
Sbjct: 354 TRPDIVIATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIPSKRQ 413

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-KHDEREAALLY 347
           TLLFSAT+ + +       L  PV + +D   + ++ L   F+   K D  + ALLY
Sbjct: 414 TLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKRDHLKPALLY 470

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%)

Query: 407 SEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
           S+K  ++FV  +     +  +L   G  V  ++GSL Q  R + + NF++    +L+ TD
Sbjct: 480 SQKRIVVFVARKETAHKLRIVLGLLGMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTD 539

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +A+RG+DIP +  VINF  P + +I++HRVGRTARAG  G + + +
Sbjct: 540 LASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVTFV 585

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 177/362 (48%), Gaps = 53/362 (14%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 175 KLKSHS---SKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + + +      G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 171 HINAQALLQPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 230

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 231 NRGSEIVIATPGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L++P+ V++        +LE+            A  + I +
Sbjct: 291 TLMWSATWPKEVKQLAADYLSDPIQVQIG-------SLEL------------AASHTITQ 331

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
            +++    E++ +L                                 +  A+Q P E   
Sbjct: 332 RVEVVSGFEKRDRLAK------------------------------HVETASQNP-ESKI 360

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 361 LVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARG 420

Query: 472 VD 473
           +D
Sbjct: 421 ID 422

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  166 bits (420), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 198/407 (48%), Gaps = 62/407 (15%)

Query: 113 KGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPM 172
           K  F    LS   +  + + GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFSELNLSSPTIKAVEKLGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 173 IEKLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGM 230
           +E L S   K   G   V+++P+RELA+Q   V K           ++ GG +  ++   
Sbjct: 87  VEMLHSLKFKPRNGTGVVVITPTRELALQIFGVAKSLMEFHSQTFGIVIGGANRRQEADK 146

Query: 231 MMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS- 288
           +    ++++ATPGR L HL+       K+++  + DE+DR+ E+GFE+++ +++  LP+ 
Sbjct: 147 LAKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIVKILPNE 206

Query: 289 NRQTLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAAL 345
           +RQT+LFSAT    + D A+  L   P+ + +D E + S  + LE  ++  + D+R   L
Sbjct: 207 DRQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKENSTVDGLEQGYVVCESDKRFLLL 266

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
              ++          ++ K+I                              V + + N +
Sbjct: 267 FSFLKR--------NQKKKVI------------------------------VFLSSCNSV 288

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                       R++ E    LL      V  ++G   Q+ R    + F       LV T
Sbjct: 289 ------------RYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCT 332

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G++G   S++
Sbjct: 333 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/361 (28%), Positives = 175/361 (48%), Gaps = 53/361 (14%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G    +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPDYVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIREL 233

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 234 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A   L +P+ V++            L LS  H+         I +
Sbjct: 294 TLMWSATWPKEVKQLAHDYLNDPIQVQIGS----------LELSASHN---------ITQ 334

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           ++++    E++ +L+                                +  A++    K  
Sbjct: 335 LVEVVSDFEKRDRLLK------------------------------HLETASEDKDSK-I 363

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + +   L+  G+    I+G  DQR R+  L  FR G + I+V TDVAARG
Sbjct: 364 LVFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARG 423

Query: 472 V 472
           +
Sbjct: 424 I 424

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  160 bits (405), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 174/361 (48%), Gaps = 53/361 (14%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF   G  + +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 113 SFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 172

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++LSP+RELA+Q       F + + +R+  + GG     Q   +
Sbjct: 173 HINAQPLLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 232

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 233 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 292

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           TL++SAT P  +   A+  L +P+ V          N+  L L+  H+         I++
Sbjct: 293 TLMWSATWPKEVQQLARDYLHDPIQV----------NVGSLELAASHN---------IKQ 333

Query: 352 VIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKST 411
           V+++    +++ +L+                                         +   
Sbjct: 334 VVEVVSEMDKRDRLLKHLETASED-------------------------------KDSKI 362

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F  T+   + +  +L+  G+    I+G   Q  R+  L  FR+G + I+V TDVAARG
Sbjct: 363 LIFASTKRTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAARG 422

Query: 472 V 472
           +
Sbjct: 423 I 423

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 146/237 (61%), Gaps = 4/237 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F S  LS+ +L  ++  G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+IE
Sbjct: 220 TFNSLSLSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIE 279

Query: 175 KLKSHSSKVGA-RAVILSPSRELAMQTHKVFKDFSR-GTHLRSVLLTGGDSLEEQFGMMM 232
           +L    +K+ + R ++L+P+RELA+Q   V K   +  + L   L  GG +L +Q   + 
Sbjct: 280 RLLYKPAKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALK 339

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
             PD+++ATPGR + H++   +  + S+E  V DE+DR+ E GF+++LNE+++ +PS RQ
Sbjct: 340 LRPDIVIATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQ 399

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDER-EAALLY 347
           TLLFSAT+ + +       L  PV + +D   + +  L   F+  +  E  + ALLY
Sbjct: 400 TLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLY 456

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  ++FV  +     +  +L   G     ++GSL Q  R + + NF++    +LV TD+
Sbjct: 467 QKRIVVFVARKEVAHRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDL 526

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           A+RG+DIP +  VIN+  P + +I++HRVGRTARAG  G + +++
Sbjct: 527 ASRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARAGREGKSVTLV 571

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 114/411 (27%), Positives = 189/411 (45%), Gaps = 68/411 (16%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    +S   L  +    F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEK
Sbjct: 43  FKDLPISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  +   G  A+I+SP+RELAMQ ++V       T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-S 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             ++++ TPGR L HL   + L+  +++  V DE+DR  +MGF++ L+ +++ L  +RQT
Sbjct: 162 RINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQT 221

Query: 293 LLFSATLPNS--------LVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
           LLFSAT   S        L D+   G  + +   +++E+   E L+  +           
Sbjct: 222 LLFSATQSQSVADLARLSLTDYKTVGTHDVMDGSVNKEASTPETLQQFY----------- 270

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
                   I++PLA +  I                                  +M     
Sbjct: 271 --------IEVPLADKLDILF-----------------------SFIKSHLKCKM----- 294

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSIL 462
                  I+F+ +   V ++    +    G  + +++G   QRAR   L  F       L
Sbjct: 295 -------IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCL 347

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
             TDV ARG+D P +  V+    P     ++HRVGR AR G +G +  +++
Sbjct: 348 FATDVVARGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLT 398

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  164 bits (415), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 212/411 (51%), Gaps = 63/411 (15%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTI-PLILQS-RDIVGLARTGSGKTAAFILPMIEKLKS 178
           +S+ + ++ISR GF Q TP+Q+KTI P+I  S  DI+  A+TG+GKT AF+LP+ + L +
Sbjct: 166 ISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLLN 225

Query: 179 H--SSKVGARAVILSPSRELAMQTH-KVFKDFSRGTHLRS---VLLTGGDSLEEQFGMMM 232
               S+   ++VI++P+R+LA+Q   +V K  S+   L++   V L GG + +     + 
Sbjct: 226 TKIDSQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRYIE 285

Query: 233 S-NPDVIVATPGRFLHLKVEM-NLDLKSIEYAVFDESDRLFEMGFEEQL---NELLAALP 287
             +P +++ TPGR + +  +  N   K +++ V DE+DRL E+GF+E L   N++L  L 
Sbjct: 286 KVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNTLN 345

Query: 288 SNR----QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +N     +TLLFSAT     +D     L+N ++   ++E       E L++ T  DE E 
Sbjct: 346 TNSTEHIRTLLFSAT-----LDHKVQSLSNDIM---NKE-------ECLYIDTI-DENEP 389

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
                I + + +     + +                                 +R     
Sbjct: 390 QAHEKIDQTLVVGETFADNL---------------------------YAAIEHIR-EFGT 421

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSY-IYGSLDQRARNRQLYNFRAGLTSIL 462
           + P+ KS ILF+PT    +++A +LK    L  Y  +G +DQ+ R R +  F+     +L
Sbjct: 422 KTPNYKS-ILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNEFKTMKKGLL 480

Query: 463 VVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           V TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G + + IS
Sbjct: 481 VCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTFIS 531

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score =  162 bits (410), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/411 (28%), Positives = 202/411 (49%), Gaps = 68/411 (16%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F   K +LNN+    F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 116 GSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSCAPTGSGKTLAFL 175

Query: 170 LPMIEKLKSHSSKVGARAVILSPSRELAMQT--------HKVFKDFSRGTHLRSVLLTGG 221
           +P+++++       G + +I+SP++ELA QT         K+F D  R   L+  +L+  
Sbjct: 176 IPLLQQIIDSKDVQGLKGLIISPTKELASQTFVECVKLSRKIFLDKKRP--LQVAILSKS 233

Query: 222 DSLEEQFGMMMSNP-DVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLN 280
            S + +  ++     D+I++TP R + L     LDL ++ + VFDE+D+LF+  F EQ +
Sbjct: 234 LSAKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEADKLFDKTFVEQTD 293

Query: 281 ELLAALPSNR-QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
           ++L+A    R +  +FSAT+P+++ + A++ +T+PV V +  +   + N+         D
Sbjct: 294 DILSACSDPRLRKSMFSATIPSNVEEIAQSIMTDPVRVIIGHKEGANANI---------D 344

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRM 399
           +R   L+Y             E+ KLI                               RM
Sbjct: 345 QR---LVY----------CGNEEGKLIAIR----------------------------RM 363

Query: 400 PAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLT 459
               +   +   I+F+ +    + + + L   G  V  ++    Q  R++ +  F+ G  
Sbjct: 364 VQEGEF--KPPVIIFLESITRAKALYHELMYDGLNVDVLHAERTQMQRDKIIERFKTGDL 421

Query: 460 SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYS 510
             L+ TDV ARG+D   +  V+N+  P +++ +VHR+GRT R   +G A +
Sbjct: 422 WCLICTDVLARGIDFKGINLVVNYDVPQTAQAYVHRIGRTGRNNRQGKAVT 472

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 194/410 (47%), Gaps = 71/410 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTI-PLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH 179
           +  ++  +I R GF   TP+Q+KTI P++  + D++  A+TG+GKT AF++PM E L ++
Sbjct: 127 IDNMLYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLAN 186

Query: 180 --SSKVGARAVILSPSRELAMQ----THKVFKDFSRGTHLRSVLLTGGDSLEEQF-GMMM 232
              S+   + V+++P+R+LA+Q      K+ K+       +SV L GG + +     M  
Sbjct: 187 RTDSQYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFK 246

Query: 233 SNPDVIVATPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFEE-------QLNELLA 284
             P++IVATPGR   +  + +    K +++ + DE+DRL E+GF++       QLN +  
Sbjct: 247 ERPNIIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINE 306

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENLEMLFLSTKHDE 340
             P + +TLLFSATL + + + A   +     + LD     E +  E ++   + +   E
Sbjct: 307 KGPEHIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVIS---E 363

Query: 341 REAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMP 400
           + A  LY   E I+  LA  E +K                                    
Sbjct: 364 KFAHNLYAPIEEIKSQLAENENLK------------------------------------ 387

Query: 401 AANQLPSEKSTILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGL 458
                      ILFVPT    ++    L+     + +   +G ++QR R R +  F+   
Sbjct: 388 ----------AILFVPTVKFAKFFCRSLEQILPDFPILEFHGKIEQRRRTRIVQEFKRAK 437

Query: 459 TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
             +LV TDV ARG+D P +  V     PS    ++HR+GRTAR G  G A
Sbjct: 438 RGLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 125/423 (29%), Positives = 204/423 (48%), Gaps = 46/423 (10%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKLKS 178
           + K +   + R GF   TP+Q+KTI  IL+    D++  A+TG+GKT AF+LP+ +KL  
Sbjct: 170 IDKKLFTAVHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIE 229

Query: 179 HSSKVGARAVILSPSRELAMQTH----KVFKDFSRGTHLRSVLLTGGDSLEEQFG-MMMS 233
             +    ++VI++P+R+LA+Q      K++K+ S       + + GG +       +   
Sbjct: 230 SPNSAMVKSVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRE 289

Query: 234 NPDVIVATPGRFLHLKVEMNLDLKS-IEYAVFDESDRLFEMGFEEQLNELLAALPS---- 288
            P++IVATPGR L +  +      S +++ V DE+DRL E+GF+E L  +  +L S    
Sbjct: 290 RPNIIVATPGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSN 349

Query: 289 ---NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENL-EMLFLSTKHDE 340
              + +TLLFSATL + +   A   +     + LD     E +  EN+ + L +S     
Sbjct: 350 GADHIRTLLFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVSDAFSH 409

Query: 341 REAALLYLIQEVI---QIPLA---TEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXX 394
              A++  I+  +   ++P+A   TEE+ K+                             
Sbjct: 410 SIYAVIEHIRSRLHPTELPIAEVTTEEETKV----------------EAGVESVEETEVI 453

Query: 395 XXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKN----CGYLVSYIYGSLDQRARNRQ 450
                P           ILF PT    ++++ L+K      G  +   +G +DQ  R R 
Sbjct: 454 TKATKPFDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRTRI 513

Query: 451 LYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYS 510
           +  F+   + ILV TDV ARG+D P +  V+    PS    +VHR+GRTARAG +G + +
Sbjct: 514 VEKFKRANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGISTA 573

Query: 511 IIS 513
            +S
Sbjct: 574 FLS 576

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 145/228 (63%), Gaps = 11/228 (4%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL   I+N I+++  + +PT IQ + IP I+  RD++G+++TGSGKT ++ILPM+ 
Sbjct: 278 WSQLGLPTDIMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLR 337

Query: 175 KLKSHSS----KVGARAVILSPSRELAMQTHKVFKDFSRGTH-LRSVLLTGGDSLEEQFG 229
           ++K+  +    + G   +IL+P+RELA+Q ++  + F++    +R++  TGG  +++Q  
Sbjct: 338 QIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQIN 397

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +    +++VATPGR + + + +N    +  K I + V DE+DRLF+MGFE Q+ +++  
Sbjct: 398 DLKRGVEIVVATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKT 456

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLF 333
           +  ++Q +LFSAT PN L  FA   LT+P+ V ++  + ++EN+   F
Sbjct: 457 VRPDKQCVLFSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSF 504

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 60/106 (56%)

Query: 407 SEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
           S+K  I+FV ++   + + + L+N GY    I+     + R   L  F+    SIL+ T+
Sbjct: 545 SDKKIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLCTE 604

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           V +RG+++P ++ VI ++   +   +VH  GRTAR  ++G A +++
Sbjct: 605 VLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  160 bits (404), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 125/444 (28%), Positives = 203/444 (45%), Gaps = 78/444 (17%)

Query: 128 NISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKL--KSHSSKV 183
           +ISR GF   T +Q+KTI  IL++  RD++  A+TG+GKT AF++P+ E L      S  
Sbjct: 129 SISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPD 188

Query: 184 GARAVILSPSRELAMQ----THKVFKDFSRGTHLRSVLLTGGDSLEEQ-FGMMMSNPDVI 238
             +AV+L+P+R+LA+Q     HK+  +         + + GG    +  F +  + P++I
Sbjct: 189 MVKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNII 248

Query: 239 VATPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFEEQLNELLAAL-------PSNR 290
           +ATPGRF+     +  +  K +++ V DE+DRL E+GF++ L  +  +L         + 
Sbjct: 249 IATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDHI 308

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST-------KHDEREA 343
           +TLLFSATL   +   A                 +    E LFL T        H++ E 
Sbjct: 309 RTLLFSATLDEKVQTLA---------------DDVMNKSECLFLDTVDKNEPESHEKIEQ 353

Query: 344 ALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAAN 403
           +L+ + Q   +   A  + +                                   +    
Sbjct: 354 SLV-VSQNFAESTYAVIDHL-----------------------------------LKQTK 377

Query: 404 QLPSEKSTILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSI 461
            +P+ K+ ILF PT    ++++NLLK     Y V   +G +DQ  R R + +F+     +
Sbjct: 378 NVPNYKA-ILFTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGL 436

Query: 462 LVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXX 521
           LV TDV ARG+D P +  V+    PS    +VHR+GRTAR G  G +   +S        
Sbjct: 437 LVCTDVGARGMDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGASVIFLSDSELGLIE 496

Query: 522 XXXXXXGKKILTTPMYEAATDLLE 545
                    I     YE +++++E
Sbjct: 497 NLEKEKNISIENKSNYEPSSEIME 520

>ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38112 Saccharomyces cerevisiae YBR142W MAK5
           Essential nucleolar protein putative DEAD-box RNA
           helicase required for maintenance of M1 dsRNA virus
           involved in biogenesis of large (60S) ribosomal subunits
          Length = 751

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 130/441 (29%), Positives = 210/441 (47%), Gaps = 101/441 (22%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKL---K 177
           LS  +LN +S++GF +PT IQ++ +PL L++ DI+G A TGSGKT A+ +P++E L    
Sbjct: 192 LSFTVLNGLSQQGFTKPTDIQKEVLPLALKNEDIMGKAATGSGKTLAYGIPLLESLVHEP 251

Query: 178 SHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRS----VLLTGGDSLEEQFGMMM- 232
            HS  +G   +I +P+RELA Q  +  K   +    +S    + LTGG S+++Q  ++  
Sbjct: 252 DHSKSIG---LIFTPTRELAQQVTQHLKKLGQLIIQKSKFAILPLTGGLSIQKQERILKY 308

Query: 233 -SNPDVIVATPGRFLHLKVEMNLDL----KSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
            ++  ++VATPGRFL L +E N+DL      I   V DE+DRL + G  ++  ++L  L 
Sbjct: 309 ENSARIVVATPGRFLEL-IEKNIDLIPRFARINTLVLDEADRLLQDGHFDEFEKILKLLG 367

Query: 288 SNR--------QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
             R        QT++FSAT   SL  F+K    +   ++ D+                 D
Sbjct: 368 GARKSFDKTGWQTMIFSATFSLSL--FSKLATASWKSLKKDE-----------------D 408

Query: 340 EREAALLYLIQEV------IQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXX 393
           E E  L +L+Q++      + +   +EE+IK                             
Sbjct: 409 EMEQVLKHLMQKIRFKSKPVIVDTNSEEKIK----------------------------- 439

Query: 394 XXXVRMPAANQLPSEK-------------STILFVPTRHHVEYIANLLKNCGYLVSYIYG 440
              +R       P E+             +T++F  +   V+ +     N       I+ 
Sbjct: 440 -SQIRESLIECGPMERDLYSYYFLAMYPGTTLIFCNSIDSVKKLCAYFNNLKIDAFQIHS 498

Query: 441 SLDQRARNRQL--------YNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIF 492
           S+ Q+ R R L         N      ++LV +DVAARG+DIP + +V+++  P ++  +
Sbjct: 499 SMTQKNRLRSLERYLQKSAQNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTY 558

Query: 493 VHRVGRTARAGNRGWAYSIIS 513
           +HR GRTARA N G +  I S
Sbjct: 559 IHRSGRTARADNEGVSVMICS 579

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  158 bits (399), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 191/418 (45%), Gaps = 77/418 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK--- 175
           + L   I   I   GF   TP+Q  TIP+   ++D+V  + TGSGKT AF +P++EK   
Sbjct: 12  YELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVK 71

Query: 176 --LKSHSSKVGA-RAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGDS--LE 225
             L     K G   ++I+SP+REL+ Q   V + F     S    ++S L+ G  S  + 
Sbjct: 72  EVLSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +     + N P +++ TPGR L       +   S    V DE+DRL ++ FE+ +  +L 
Sbjct: 132 DDVSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILG 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++     + G+ NPV + +  + +  E+L++ ++  K +E+   
Sbjct: 192 MLPKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHH 251

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           LL +I                                                     N 
Sbjct: 252 LLNII-----------------------------------------------------NN 258

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYL--------VSYIYGSLDQRARNRQLYNFRA 456
           +   K  + F PT   V Y  + LK+   +        V  ++G L   +R   L  F  
Sbjct: 259 MRYRKCIVYF-PTCQAVTYFYSFLKHLSDISKTRDDLEVYSLHGKLQTNSRIGTLAKFST 317

Query: 457 GL-TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            L  ++L+ TDVAARG+DIP +  V+ F  P+++++F+HR GRT RA   G A + I+
Sbjct: 318 SLNIAVLLTTDVAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFIN 375

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  156 bits (394), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 133/241 (55%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       F +PTPIQ K+IP  L+  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 76  SFNELDLVPELIQACHNLNFSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 135

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           KL          A IL+P+RELA Q  + F        +RSV + GG ++ +Q   +M  
Sbjct: 136 KLWEDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRK 193

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  +P+ +R T
Sbjct: 194 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTT 253

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  E L    +      +   L+YL+ E 
Sbjct: 254 YLFSATMTSKIEKLQRASLTNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEF 313

Query: 353 I 353
           I
Sbjct: 314 I 314

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 69/123 (56%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KS I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG   ILV  DVA
Sbjct: 316 KSIIVFTRTKANAERLSALSNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVA 375

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 376 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 435

Query: 529 KKI 531
           KK+
Sbjct: 436 KKL 438

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 197/407 (48%), Gaps = 71/407 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS-RDIVGLARTGSGKTAAFILPMIEKLKSH 179
           LS  +   +  +GF + TP+Q+KT+  ILQ+  D+V  A+TG+GKT AF++P+ ++L   
Sbjct: 133 LSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEG 192

Query: 180 SSKVGARAVILSPSRELAMQTHKVFKDFSRGT----HLRSVLLTGGDSLEEQF-GMMMSN 234
                 +AV+++P+R+LA Q      +            +V++ GG S  E F  +    
Sbjct: 193 PPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRR 252

Query: 235 PDVIVATPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFE---EQLNELLAAL---- 286
           P+++VATPGR + +           +++ V DE+D L E+GF+   EQ+N++L  L    
Sbjct: 253 PNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKG 312

Query: 287 PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENL-EMLFLSTKHDER 341
            ++ +TLL SATL + +   A + + +   + +D     E   +EN+ + + +S    + 
Sbjct: 313 TTHIRTLLVSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADN 372

Query: 342 EAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPA 401
             A LY I+E                                                  
Sbjct: 373 ITASLYKIRE-------------------------------------------------E 383

Query: 402 ANQLPSEKSTILFVPTRHHVEYIANLLKN-C-GYLVSYIYGSLDQRARNRQLYNFRAGLT 459
           A+  P  K+ I+F+PT   VEY   LL++ C G  V   +G L Q  RN  +  FRA  +
Sbjct: 384 ASANPKLKA-IVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDS 442

Query: 460 SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRG 506
            ILV TDVAARG+D+  + +V     P+S   ++HR+GRT RAG +G
Sbjct: 443 GILVCTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 188/402 (46%), Gaps = 70/402 (17%)

Query: 129 ISRKGFHQPTPIQRKTIPLILQS-RDIVGLARTGSGKTAAFILPMIEKL--KSHSSKVGA 185
           +SR  F   TP+Q+KTI  IL++  D++  A+TG+GKT AF++P+ E L      S    
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSMV 177

Query: 186 RAVILSPSRELAMQTHKVFKDFSRGTH----LRSVLLTGGDSLEEQFGMMMSN-PDVIVA 240
           + VI++P+R+LA+Q     +   +  H     +S+ L GG + +     M  + P+++VA
Sbjct: 178 KCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVVA 237

Query: 241 TPGRFLHLKVEMNLDL-KSIEYAVFDESDRLFEMGFEEQL-------NELLAALPSNRQT 292
           TPGR + +  + +    K +++ V DE+DRL E+GF+E L       N + A  P + +T
Sbjct: 238 TPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIRT 297

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENLEMLFLSTKHDEREAALLYL 348
           LLFSATL +++   A   +     + LD     E +  E ++   + +   E  A+ LY 
Sbjct: 298 LLFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVIS---ENFASNLYA 354

Query: 349 IQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSE 408
               I+  LAT                                           N  P +
Sbjct: 355 PISAIKNRLAT-------------------------------------------NNEPFK 371

Query: 409 KSTILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466
              ILFVPT    ++   +L+       V   +G +DQR R + +  F+     I V TD
Sbjct: 372 --AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTD 429

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
           V ARG+D P +  V+    PS    ++HR+GRTAR G  G A
Sbjct: 430 VGARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 131/209 (62%), Gaps = 10/209 (4%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH----SSKVGARAVI 189
           +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+I  +K+     +S+ G   +I
Sbjct: 302 YDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIRHVKAQRPLSNSETGPLGLI 361

Query: 190 LSPSRELAMQTHKVFKDFSRGT-HLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHL 248
           ++P+RELA+Q ++  + F +    +RS+  TGG  L+ Q        +++VATPGRF+ L
Sbjct: 362 IAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIYEFKRGIEIVVATPGRFIDL 421

Query: 249 KVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLV 304
            + +N    L+ K I   + DE+DRLF+MGFE Q+ +++  +  ++Q +LFSAT P  L 
Sbjct: 422 -LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPIKLQ 480

Query: 305 DFAKAGLTNPVLVRLDQESKISENLEMLF 333
            F K  L NP+ + +D ++ ++EN+   F
Sbjct: 481 AFVKRVLHNPLTITIDSKTMVNENVHQAF 509

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%)

Query: 414 FVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVD 473
           FV ++   + +A  L+   Y V  I+     + R   L  F+    SIL+ T+V +RG++
Sbjct: 556 FVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTEVLSRGLN 615

Query: 474 IPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           +P ++ VI ++  +    +VH  GRTAR   RG A +++
Sbjct: 616 VPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  153 bits (387), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 139/263 (52%), Gaps = 19/263 (7%)

Query: 108 NKKHKKG---------------SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSR 152
           +KKHKK                SF    L   ++       F +PTPIQ + IP  L+ R
Sbjct: 51  SKKHKKAKVQEEEPEYQGEDLQSFNDLNLVPELIEACKNLNFDKPTPIQARAIPPALEGR 110

Query: 153 DIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTH 212
           DI+GLA+TGSGKTAAF +P++ +L     K    A +L+P+RELA QT + F        
Sbjct: 111 DIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPTRELAQQTKETFDSLGALMG 168

Query: 213 LRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLF 271
           +RS  + GG ++ +Q   +M  P +I+ATPGR + HL+      L+ + + V DE+DRL 
Sbjct: 169 VRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTKGFSLRKLRFLVMDEADRLL 228

Query: 272 EMGFEEQLNELLAALPS-NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLE 330
           +M F   L+++L  +P+ +R T LFSAT+ + +    +A LT PV   +  + +  + L 
Sbjct: 229 DMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASLTEPVKCAVSNKYQTVDTLV 288

Query: 331 MLFLSTKHDEREAALLYLIQEVI 353
              +      +   L+YL+ E I
Sbjct: 289 QTLMVVPSGLKNTYLIYLLNENI 311

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 529 KKI 531
           KK+
Sbjct: 433 KKL 435

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  153 bits (387), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 131/239 (54%), Gaps = 4/239 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       + +PTPIQ K+IP  L  +DI+GLA+TGSGKTAAF +P++ 
Sbjct: 68  SFTELNLVPELIQACKNLNYEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILN 127

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L     ++   A ILSP+RELA Q  + F        +R+V + GG ++ +Q   +M  
Sbjct: 128 SL--WHDQLPYYACILSPTRELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRK 185

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      L+ + Y V DE+DRL +M F   L+ +L  LP+  R T
Sbjct: 186 PHIIIATPGRLMDHLENTRGFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTT 245

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E
Sbjct: 246 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 95.5 bits (236), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E IA L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 529 KKI 531
           KK+
Sbjct: 428 KKL 430

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 117/412 (28%), Positives = 189/412 (45%), Gaps = 77/412 (18%)

Query: 125 ILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK-----LKSH 179
           I   I   G+   TP+Q  TIPL   ++D+V  + TGSGKT AF++P++EK     +   
Sbjct: 18  IRTAIDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIINGV 77

Query: 180 SSKVGA-RAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTG--GDSLEEQFGMM 231
           S K G   ++I+SP+REL+ Q   VF  F     S    ++S LL G    S+ +     
Sbjct: 78  SLKKGHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNAF 137

Query: 232 MSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNR 290
             N P ++V TPGR         +   S    + DE+DRL ++ FE+++  +L  LP  R
Sbjct: 138 TENKPQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQR 197

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQ 350
           +T LFSAT+ ++     + G+ NPV + +  + +  E+L++ +L  K +++   LL ++ 
Sbjct: 198 RTGLFSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDKLQQLLNIL- 256

Query: 351 EVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKS 410
                                                               N     K 
Sbjct: 257 ----------------------------------------------------NNFRYRKC 264

Query: 411 TILFVPTRHHVEYIANLLKNCGYL--------VSYIYGSLDQRARNRQLYNFRAGL-TSI 461
            + F PT   V Y  + +K+   L        +  ++G L   +R   L  F   L +S+
Sbjct: 265 IVYF-PTCQAVTYFYSFIKHLCELGIIGASLQIFSLHGKLQTNSRLGTLTKFSQSLDSSV 323

Query: 462 LVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           L+ TDVAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + ++
Sbjct: 324 LLTTDVAARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVTFLN 375

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 117/398 (29%), Positives = 183/398 (45%), Gaps = 62/398 (15%)

Query: 129 ISRKGFHQPTPIQRKTI-PLILQSRDIVGLARTGSGKTAAFILPMIEKL--KSHSSKVGA 185
           +SR  F   TP+Q+KT+ P++    D++  A+TG+GKT AF++P+ E L      S    
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYMV 178

Query: 186 RAVILSPSRELAMQTH----KVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM-SNPDVIVA 240
           + VI++P+R+LA+Q      K+ K+       +S+ L GG + +     M    P+++VA
Sbjct: 179 KCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVVA 238

Query: 241 TPGRFLHLKVEMNLDL-KSIEYAVFDESDRLFEMGFEEQLNELL-------AALPSNRQT 292
           TPGR + +  + + +  K +++ V DE+DRL E+GF+E L E+        AA P + +T
Sbjct: 239 TPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIRT 298

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
           LLFSATL +++   A               S I +  + LFL T       A   + Q +
Sbjct: 299 LLFSATLGDNVQKLA---------------SGIMDRKQCLFLDTVDKNEPEAHERIEQSL 343

Query: 353 IQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTI 412
           +            I                                  A N  P +   I
Sbjct: 344 VISDTFAHNMYAPISAIKDRI---------------------------AENDKPFK--AI 374

Query: 413 LFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
           LFVPT    ++  ++L+       V   +G +DQR R + +  F+     I V TDV AR
Sbjct: 375 LFVPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCTDVGAR 434

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
           G+D P +  V     PS    ++HR+GRTAR G  G A
Sbjct: 435 GMDFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKA 472

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/407 (27%), Positives = 195/407 (47%), Gaps = 83/407 (20%)

Query: 133 GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKL---KSHSSKVGA---R 186
           GF   TP+Q  TIPL  +++D+V  + TGSGKT +F++P+ EK+   +++++K+      
Sbjct: 26  GFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANTTKMKKGHFH 85

Query: 187 AVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLEEQFGMMMSN-PDVI 238
           ++I+SP++ELA Q H VF+ F          +RS LL G +  ++ +     M N P ++
Sbjct: 86  SLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSDFMENKPQIL 145

Query: 239 VATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSAT 298
           + TPGR L      ++        + DE+DRL ++ F + +  ++  LP  R+T LFSAT
Sbjct: 146 IGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQRRTGLFSAT 205

Query: 299 LPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLA 358
           + ++  +  K GL NPV V ++ +S+   +L++     + D++       +++VI I   
Sbjct: 206 ITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK-------LEQVISI--- 255

Query: 359 TEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILFVPTR 418
                                                       N    +K    F PT 
Sbjct: 256 -------------------------------------------INNYKFKKCIAYF-PTC 271

Query: 419 HHVEYIANLLKNCGYL-----------VSYIYGSLDQRARNRQLYNFRAGLT-SILVVTD 466
           H V Y  + ++   YL           +  ++G L   AR + L  F   ++ ++L+ TD
Sbjct: 272 HSVTYFYSFMQ---YLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAVLLTTD 328

Query: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           VAARG+DIP +  V+    P+  ++F+HR GRT RA   G A + ++
Sbjct: 329 VAARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLT 375

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    L   ++       + +PTPIQ K+IP  L+  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 85  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 144

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L          A IL+P+RELA Q  + F        +RSV + GG ++ +Q   +M  
Sbjct: 145 SLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRK 202

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQT 292
           P VI+ATPGR + HL+      L+ ++Y V DE+DRL +M F   L+ +L  LP+  R T
Sbjct: 203 PHVIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 262

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 263 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEY 322

Query: 353 I 353
           I
Sbjct: 323 I 323

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KSTI+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 529 KKI 531
           KK+
Sbjct: 445 KKL 447

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPS 193
           + +PTPIQ ++IP  L+ +DI+GLA+TGSGKTAAF +P++  L          A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSLWHDQQPY--YACILSPT 151

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEM 252
           RELA Q  + F        +RSV + GG ++ +Q   +M  P +I+ TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 253 NLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQTLLFSATLPNSLVDFAKAGL 311
              L++++Y V DE+DRL +M F   L+ +L  +P+  R T LFSAT+ + +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 312 TNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVI 353
           TNPV   +  + +  + L    +      ++  L+YL+ E I
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFI 313

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KS I+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 315 KSMIIFTRTKANAERISGLANLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 374

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 375 ARGLDIPSVDVVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 434

Query: 529 KKI 531
           KK+
Sbjct: 435 KKL 437

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 194/418 (46%), Gaps = 77/418 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKL-- 176
           F L   I   +   GF   TP+Q  TIP++  ++D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 177 -KSHSSKVGA---RAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLE 225
            +++SSK       ++I++P+REL+ Q   V   F     S    +R  LL G +  ++ 
Sbjct: 72  EEANSSKFKKAQFHSLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +     + N P +++ TPGR L       +   +    V DE+DRL ++ F + +  +L 
Sbjct: 132 DDVSDFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILR 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++  D  K GL NPV + ++ +++   +L+M +      E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEKLQL 251

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           L+ ++                                                     N 
Sbjct: 252 LVSIL-----------------------------------------------------NN 258

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCG--------YLVSYIYGSLDQRARNRQLYNFRA 456
              +KS + F PT   V Y  + +++            V  ++G L   AR + L  F  
Sbjct: 259 YKFKKSIVYF-PTCVSVSYFYSFVQHLAKRKTLINEVEVFSLHGKLQTSARTKTLAAFTN 317

Query: 457 GLT-SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            L+ S+L  TDVAARG+DIP +  VI    P++S +F+HR GRT RA   G A + ++
Sbjct: 318 SLSNSVLFTTDVAARGIDIPQVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 102 STTAQTNKKHKKGSFPSFGLSKLI---LNNISRKGFHQPTPIQRKTIPLILQSRDIVGLA 158
           S TA+ +  ++  SF SF    L+   +       + +PTPIQ K+IP  L+  DI+GLA
Sbjct: 68  SATAENDNANEGESFESFNELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLA 127

Query: 159 RTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLL 218
           +TGSGKTAAF +P++ +L          A IL+P+RELA Q  + F        +RS  +
Sbjct: 128 QTGSGKTAAFAIPILNRLWHDQEPY--YACILAPTRELAQQIKEAFDSLGSLMGVRSTCI 185

Query: 219 TGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEE 277
            GG ++ +Q   +M  P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F  
Sbjct: 186 VGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGP 245

Query: 278 QLNELLAALPSN-RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
            L+ +L  +P+  R T LFSAT+ + +    +A LTNPV   +  + +  + L    +  
Sbjct: 246 VLDRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQALMVV 305

Query: 337 KHDEREAALLYLIQEVI 353
               +   L+YL+ E I
Sbjct: 306 PGGLKNTYLIYLLNESI 322

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 67/105 (63%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ARG+DIP +  V+N+  P  SK ++HRVGRTARAG  G + S++S
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPS 193
           +++PTPIQ K IP  L+  DI+GLA+TGSGKTAAF +P++ +L          A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQLWHDQQPY--YACILAPT 144

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEM 252
           RELA Q  + F        +RS  + GG S+ +Q   +M  P +I+ATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 253 NLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQTLLFSATLPNSLVDFAKAGL 311
             +L+ ++Y V DE+DRL +M F   L+ +L  +P+  R T LFSAT+ + +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 312 TNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVI 353
           TNPV   +  + +  + L    +      +   L+YL+ E I
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score =  101 bits (252), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KSTI+F  T+ + E I+NL     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 529 KKI 531
           KK+
Sbjct: 428 KKL 430

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  154 bits (388), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 193/418 (46%), Gaps = 77/418 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKS 178
           F L   I   +   GF   TP+Q  TIP++  ++D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 179 HSS------KVGARAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLE 225
             +      K    ++I++P+REL+ Q   V   F     S    ++  LL G +  S+ 
Sbjct: 72  EEANTFKFKKAHFHSLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +   + + N P ++V TPGR L       +   +    + DE+DRL +M F + +  +L 
Sbjct: 132 DDVSIFLENRPQILVGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILR 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++  D  K GL NPV + ++ + +   +L++ +           
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLDYCVVN------- 244

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
                      PL   E+++L+                                +   N 
Sbjct: 245 -----------PL---EKLQLL--------------------------------VSILNN 258

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCG---YLVS-----YIYGSLDQRARNRQLYNFRA 456
              +K  + F PT   V Y  + ++       L+S      ++G L   AR + L +F  
Sbjct: 259 YKFKKCIVYF-PTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFTE 317

Query: 457 GL-TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            L  S+L  TDVAARG+DIP +  VI    P++S +F+HR GRT RA   G A + ++
Sbjct: 318 SLNNSVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLN 375

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  151 bits (382), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   +L       + +PTPIQ ++IP  L+  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 83  SFSELDLVPELLQACKNLNYTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILN 142

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L          A IL+P+RELA Q  + F        +RS  + GG ++ +Q   +M  
Sbjct: 143 SLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 200

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQT 292
           P +I+ATPGR + HL+      L+ ++Y V DE+DRL +M F   L+ +L  LP+  R T
Sbjct: 201 PHIIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 260

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      ++  L+YL+ E 
Sbjct: 261 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEF 320

Query: 353 I 353
           I
Sbjct: 321 I 321

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+TI+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 529 KKI 531
           KK+
Sbjct: 443 KKL 445

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  151 bits (381), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       F +PTPIQ ++IP  LQ  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 87  SFSDLDLVPELIEACKNLNFAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILN 146

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A IL+P+RELA Q  + F        +RS  + GG ++ +Q   +M  
Sbjct: 147 RLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRK 204

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 264

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEF 324

Query: 353 I 353
           I
Sbjct: 325 I 325

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E I  L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 327 KTIIVFTRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVA 386

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 529 KKI 531
           KK+
Sbjct: 447 KKL 449

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  151 bits (381), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    +   +L       F +PTPIQ K IP  L+ +DI+GLA+TGSGKTAAF LP++ 
Sbjct: 82  SFSGLNIVPELLQACKNLNFTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILN 141

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L    S     A ILSP+RELA Q  + F         R+  + GG ++ +Q   +M  
Sbjct: 142 RLWHDQSPY--YACILSPTRELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRK 199

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 259

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LT+PV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 319

Query: 353 I 353
           I
Sbjct: 320 I 320

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+TI+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 529 KKI 531
           KK+
Sbjct: 442 KKL 444

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 140/225 (62%), Gaps = 11/225 (4%)

Query: 116 FPSFGLSKLILNNISRK-GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +   GL+   +N I++   +   TPIQ + IP I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 292 WSQLGLNTDTMNLITKNLRYETLTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLR 351

Query: 175 KLKSH----SSKVGARAVILSPSRELAMQTHKVFKDF-SRGTHLRSVLLTGGDSLEEQFG 229
            +K+      ++ G   +IL+P+RELA+Q H   + F     ++RS+  TGG  L++Q  
Sbjct: 352 HIKAQRPLSKNETGPLGLILAPTRELALQIHDEIERFIVHDENIRSICCTGGSELKKQIN 411

Query: 230 MMMSNPDVIVATPGRFLHLKVEMN----LDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
            +     ++VATPGRF+ L + +N    +  + I + + DE+DRLF++GFE Q+ +++  
Sbjct: 412 DLKRGVQIVVATPGRFIDL-LTLNTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKT 470

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLE 330
           +  ++Q +LFSAT PN L +FA   L +P+ + ++  + ++EN+E
Sbjct: 471 IRPDKQCVLFSATFPNKLRNFAMRILNSPLSITINSNNLVNENVE 515

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 58/105 (55%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K TI+FV ++   + + + L N GY +  I+     + R   L  F+    SIL+ T+V
Sbjct: 560 DKKTIIFVASQQICDLLYSQLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILICTEV 619

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
            +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++
Sbjct: 620 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGNLHGIAITLL 664

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  152 bits (385), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 187/413 (45%), Gaps = 75/413 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKS 178
           + L   I   I+  GF   TP+Q  TIP+  +++D+V  + TGSGKT AF++P++EK+ S
Sbjct: 12  YELQPWIKKAINVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIIS 71

Query: 179 HS------SKVGARAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLE 225
                    K    ++IL+P+REL+MQ   V   F          +RS L+ G +  S+ 
Sbjct: 72  EGINNSKFKKGHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +    ++   P +++ TPGR L      ++   S    V DE+DRL ++ F + + ++L 
Sbjct: 132 DDVNTLLDERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILN 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++     K GL NPV + ++ + K +     LF S    E +  
Sbjct: 192 VLPKQRRTGLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEK-- 249

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
               +Q +I I                                               N 
Sbjct: 250 ----LQNLIHI----------------------------------------------MNN 259

Query: 405 LPSEKSTILF---VPTRHHVEYIANLLKNCGYL-----VSYIYGSLDQRARNRQLYNFRA 456
           +  +K  + F   V      +Y+  L +    L     V  I+G L  ++R + L  F  
Sbjct: 260 IRFKKCIVYFSTCVSVTFFYQYLKYLQQTDKTLREDLQVISIHGKLTTQSRRKALSTFTE 319

Query: 457 GLT-SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
            L+  IL+ TDVAARG+DIP +  V+    P+ + IF+HR GRT RA   G A
Sbjct: 320 SLSDCILLTTDVAARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRA 372

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  150 bits (380), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++      GF +PTPIQ K IP  L+  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 86  SFSDLNLVPELIEACKNLGFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILN 145

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A IL+P+RELA Q  + F        +R+  + GG ++ +Q   +M  
Sbjct: 146 RLWHDQQPY--YACILAPTRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRK 203

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      L+ + + V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 204 PHIIIATPGRLMDHLENTRGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 263

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 264 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 323

Query: 353 I 353
           I
Sbjct: 324 I 324

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 326 KTVIVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 385

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  V+N+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 386 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 445

Query: 529 KKI 531
           KK+
Sbjct: 446 KKL 448

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  150 bits (380), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 133/249 (53%), Gaps = 4/249 (1%)

Query: 107 TNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTA 166
           TN+     SF    L   ++       + +PTPIQ K IP  L+  DI+GLA+TGSGKTA
Sbjct: 74  TNEDESFESFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTA 133

Query: 167 AFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEE 226
           AF +P++ +L          A IL+P+RELA Q  + F        +RS  + GG ++ +
Sbjct: 134 AFAIPILNRLWHDQEPY--YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMD 191

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           Q   +M  P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  
Sbjct: 192 QARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKI 251

Query: 286 LPSN-RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
           +P+  R T LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   
Sbjct: 252 IPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTY 311

Query: 345 LLYLIQEVI 353
           L+YL+ E I
Sbjct: 312 LIYLLNEFI 320

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  V+N+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 529 KKI 531
           KK+
Sbjct: 442 KKL 444

>KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa]
           {ON} Anc_8.402 YDR194C
          Length = 623

 Score =  152 bits (385), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 200/420 (47%), Gaps = 72/420 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTI-PLILQSR-DIVGLARTGSGKTAAFILPMIEKLKS 178
           + K++  +I R GF   TP+Q+KTI P I+ +  DI+  A+TG+GKT AF++P+ + L +
Sbjct: 84  IDKMLHKSIDRMGFPNLTPVQQKTIKPTIMNNENDIIARAKTGTGKTFAFLIPIFQHLIN 143

Query: 179 H--SSKVGARAVILSPSRELAMQTH----KVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
               S+   +++I++P+R+LA+Q      K++K+       + V L GG +L E    M 
Sbjct: 144 TKLDSQYMVKSIIITPTRDLALQIEDEAKKLYKNNYGLKKFQCVSLIGGTNLNESIRRMK 203

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL---- 286
              P++I+ATPGR +  L    N   + +++ V DE+DRL E+GF+E L E+   L    
Sbjct: 204 KLRPNIIIATPGRLIDVLNRYGNEFFRFVDFKVLDEADRLLEIGFKEDLREISNILNEIS 263

Query: 287 ---PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENLEMLFLSTKHD 339
               ++ +T+LFSATL  ++ + +   +     + +D     E +  E ++   + + H 
Sbjct: 264 ERDENHIRTMLFSATLDENVQNLSNDIMNKEKCLFIDTIDKNEPEAHEKIDQSMVLSDH- 322

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRM 399
              A  +Y     IQ  L+ + ++K                                   
Sbjct: 323 --FAHNIYAAANHIQSRLSQDSEMK----------------------------------- 345

Query: 400 PAANQLPSEKSTILFVPTRHHVEYIANLL------KNCGYLVSYIYGSLDQRARNRQLYN 453
                       ILF PT    ++I  +L      K     +   +G +DQ+ R R +  
Sbjct: 346 -------DNYKAILFTPTVKFTKFITGVLYDKLHSKYRDLPIIEFHGQIDQKKRTRLVEQ 398

Query: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           F+   + IL+ TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G +   IS
Sbjct: 399 FKRLKSGILICTDVGARGMDFPDVKEVLQIGVPSELSNYIHRIGRTARSGKDGISTLFIS 458

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  152 bits (385), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 188/410 (45%), Gaps = 73/410 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKL-- 176
           L K +  +ISR  F   T +Q+KTI  I+QS  +D++  A+TG+GKT AF++P+ + L  
Sbjct: 105 LDKTLHKSISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLIN 164

Query: 177 KSHSSKVGARAVILSPSRELAMQ----THKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
               S+   + VI++P+R+LA+Q     HK+ +          V L GG +       M 
Sbjct: 165 TRRDSQYMVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTNFGSAMRKMS 224

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQ-------LNELL 283
           S  P++++ATPGR +  L    +   K +++ + DE+DRL E+GF+E        LNE+ 
Sbjct: 225 SVRPNIVIATPGRLMAVLDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDTLNEIN 284

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENLEMLFLSTKHD 339
              P + +TLLFSATL + +   A   +     V LD     E +  E +E   + +   
Sbjct: 285 DKSPDHIRTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMVIS--- 341

Query: 340 EREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRM 399
           ER A  +Y   + I+  + +E   K                                   
Sbjct: 342 ERMAHSIYAAVDHIKQKMVSEPNYK----------------------------------- 366

Query: 400 PAANQLPSEKSTILFVPTRHHVEYIANLLK---NCGYLVSYIYGSLDQRARNRQLYNFRA 456
                       ILF PT     +++ +L+        V   +G +DQR R   +  F+ 
Sbjct: 367 -----------AILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVNQFKR 415

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRG 506
             + +LV TDV ARG+D P +  V+    PS    ++HR+GRTAR G  G
Sbjct: 416 DKSGLLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEG 465

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 135/244 (55%), Gaps = 7/244 (2%)

Query: 115 SFPSFGLSKLI---LNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           +F SF   KL+   +       + +PTPIQ + IP  L+ +DI+GLA+TGSGKTAAF +P
Sbjct: 84  TFSSFSELKLVPELVEACKNLNYEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIP 143

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
           ++ KL          A I++P+RELA Q  + F        +RSV + GG ++ +Q   +
Sbjct: 144 ILNKLWEDQQPY--YACIMAPTRELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDL 201

Query: 232 MSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-N 289
           M  P +I+ATPGR + HL+      L+ +++ V DE+DRL ++ F   L+ +L  LP+  
Sbjct: 202 MRKPHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQG 261

Query: 290 RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLI 349
           R T LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YLI
Sbjct: 262 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLI 321

Query: 350 QEVI 353
            E +
Sbjct: 322 NEFV 325

 Score = 93.2 bits (230), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 70/123 (56%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KS I+F  T+ + E ++ L     +    ++G L+Q  R   L  F+AG  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 529 KKI 531
           KK+
Sbjct: 447 KKL 449

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 124/222 (55%), Gaps = 4/222 (1%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPS 193
           F +PTPIQ K IP  LQ  DI+GLA+TGSGKTAAF +P++ +L          A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQLWHDQQPY--YACILAPT 143

Query: 194 RELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEM 252
           RELA Q  + F        +RS  + GG ++ +Q   +M  P +I+ATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 253 NLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQTLLFSATLPNSLVDFAKAGL 311
              L+ + + V DE+DRL +M F   L+ +L  +P+  R T LFSAT+ + +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 312 TNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVI 353
           TNPV   +  + +  + L    +      +   L+YL+ E I
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFI 305

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           KSTI+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 529 KKI 531
           KK+
Sbjct: 427 KKL 429

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  151 bits (381), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 191/418 (45%), Gaps = 77/418 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKL-- 176
           F L   I   +   GF   TP+Q  TIP++  ++D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVK 71

Query: 177 ----KSHSSKVGARAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLE 225
                S   K    ++I++P+REL+ Q   V   F     S    ++  LL G +  ++ 
Sbjct: 72  EEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +     + N P +++ TPGR L       +   +    V DE+DRL +M F +   ++L 
Sbjct: 132 DDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILR 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++  D  K GL NPV + ++ +++   +L++ +      E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCVVNPAEKLQL 251

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           L+ ++                                                     N 
Sbjct: 252 LVSIL-----------------------------------------------------NN 258

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCG---YLVSYI-----YGSLDQRARNRQLYNFRA 456
              +K  + F PT   V Y  + ++  G    LV+ +     +G L   AR + L  F  
Sbjct: 259 YKFKKCIVYF-PTCVSVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTD 317

Query: 457 GLT-SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
            L+ S+L  TDVAARG+DIP +  VI    P+++ +F+HR GRT RA   G A + ++
Sbjct: 318 SLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLN 375

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       F +PTPIQ + IP  L   D++GLA+TGSGKTAAF +P++ 
Sbjct: 74  SFAQLNLVPELIQACQNLNFTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILN 133

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           KL          A +L+P+RELA Q  + F        +R+  + GG ++ +Q   +M  
Sbjct: 134 KLWEDQQPY--YACVLAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 191

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
           P +I+ATPGR + HL+      LK++++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 192 PHIIIATPGRLMDHLENTKGFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTT 251

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 252 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 311

Query: 353 I 353
           I
Sbjct: 312 I 312

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 529 KKI 531
           KK+
Sbjct: 434 KKL 436

>YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON}
           TIF2Translation initiation factor eIF4A, identical to
           Tif1p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 179/389 (46%), Gaps = 56/389 (14%)

Query: 106 QTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKT 165
           QTN       F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT
Sbjct: 14  QTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKT 73

Query: 166 AAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLE 225
             F +  ++++   +S    +A++L+P+RELA+Q  KV    +    ++     GG S  
Sbjct: 74  GTFSIAALQRI--DTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFV 131

Query: 226 EQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           E     + +  ++V TPGR              I+  + DE+D +   GF+EQ+ ++   
Sbjct: 132 ED-AEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTL 190

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAAL 345
           LP   Q +L SAT+PN +++     + NPV + + ++    E ++  +++ + +E +   
Sbjct: 191 LPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYEC 250

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L  + + I +  A                                               
Sbjct: 251 LTDLYDSISVTQA----------------------------------------------- 263

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                 ++F  TR  VE +   L+N  + VS IY  L Q+ R+  +  FR+G + IL+ T
Sbjct: 264 ------VIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILIST 317

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVH 494
           D+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 318 DLLARGIDVQQVSLVINYDLPANKENYIH 346

>YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}
           TIF1Translation initiation factor eIF4A, identical to
           Tif2p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 179/389 (46%), Gaps = 56/389 (14%)

Query: 106 QTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKT 165
           QTN       F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT
Sbjct: 14  QTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKT 73

Query: 166 AAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLE 225
             F +  ++++   +S    +A++L+P+RELA+Q  KV    +    ++     GG S  
Sbjct: 74  GTFSIAALQRI--DTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFV 131

Query: 226 EQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           E     + +  ++V TPGR              I+  + DE+D +   GF+EQ+ ++   
Sbjct: 132 ED-AEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTL 190

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAAL 345
           LP   Q +L SAT+PN +++     + NPV + + ++    E ++  +++ + +E +   
Sbjct: 191 LPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYEC 250

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L  + + I +  A                                               
Sbjct: 251 LTDLYDSISVTQA----------------------------------------------- 263

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                 ++F  TR  VE +   L+N  + VS IY  L Q+ R+  +  FR+G + IL+ T
Sbjct: 264 ------VIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILIST 317

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVH 494
           D+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 318 DLLARGIDVQQVSLVINYDLPANKENYIH 346

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    L   ++       + +PTPIQ K+IP  L+  DI+GLA+TGSGKTAAF +P++ 
Sbjct: 82  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A IL+P+RELA Q  + F        +RS  + GG ++ +Q   +M  
Sbjct: 142 RLWHDQEPY--YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQT 292
           P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 353 I 353
           I
Sbjct: 320 I 320

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  V+N+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 529 KKI 531
           KK+
Sbjct: 442 KKL 444

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 188/412 (45%), Gaps = 88/412 (21%)

Query: 133 GFHQPTPIQRKTIPLIL--QSRDIVGLARTGSGKTAAFILPMIEKL--KSHSSKVGARAV 188
           GF   TP+Q+K I  IL  QS+D++  A+TG+GKT AF++PM + L      +    + V
Sbjct: 97  GFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRENPSAVKYV 156

Query: 189 ILSPSRELAMQ----------THKVFKDFSRGTHLRSVLLTGGDSLEEQF-GMMMSNPDV 237
           I++P+R+LA+Q           H V K F       S+ L GG +       ++   P V
Sbjct: 157 IVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTDLIRRKPQV 210

Query: 238 IVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-------PSNR 290
           ++ATPGR L +        K ++  V DE+DRL E+GF++ L ++ + L       P + 
Sbjct: 211 VIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKINETGPDHI 270

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST------KHDEREAA 344
           +TLLFSATL   + D +++               I    E LFL T      +  E+ + 
Sbjct: 271 RTLLFSATLDAKVQDLSQS---------------IMGKDECLFLDTVDKNEPQAHEKISQ 315

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
              + + +    LAT + +K                                 R   AN 
Sbjct: 316 SAVIAENLGHSILATMDHVK---------------------------------RQVLAN- 341

Query: 405 LPSEKSTILFVPTRHHVEYIANLL---KNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSI 461
            P+ K+ ILF PT      I+ LL   ++    +   +G   Q  R + +  F+   + I
Sbjct: 342 -PNYKA-ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKRDRSGI 399

Query: 462 LVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           LV TDVAARG+D P +  V+    P+    ++HR+GRTARAG  G A   +S
Sbjct: 400 LVCTDVAARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKAVLFMS 451

>NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87
          Length = 611

 Score =  150 bits (378), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/408 (27%), Positives = 187/408 (45%), Gaps = 77/408 (18%)

Query: 129 ISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSS------K 182
           I   GF Q TP+Q  TIPL  +++D+V  + TGSGKT +F++P++EK+ + ++      K
Sbjct: 22  IEVMGFDQMTPVQASTIPLFAKNKDVVVESVTGSGKTVSFVIPILEKVIAENANTKNFKK 81

Query: 183 VGARAVILSPSRELAMQTHKVFKDF-----SRGTHLRSVLLTGGD--SLEEQFGMMMSN- 234
                +I+SP+REL+ Q   V   F          +R+ LL G +  ++ +    ++ N 
Sbjct: 82  AHFHTLIVSPTRELSKQIKSVIDQFLEHYPEDQYPIRAQLLVGTNESTVRDDVNDLIENR 141

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLL 294
           P ++V TPGR L       +   S    + DE+DRL ++ F + +  +L+ LP  R+T L
Sbjct: 142 PQILVGTPGRILDFLQMPVVKTTSCSMVILDEADRLLDVSFVKDVERILSVLPKQRRTGL 201

Query: 295 FSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQ 354
           FSAT+ ++     K GL NPV + ++ ++    +L++ ++    + +   LL ++     
Sbjct: 202 FSATISSAGNTIFKTGLRNPVKITVNSKNHAPSSLKLNYIVVDPELKFQQLLSIV----- 256

Query: 355 IPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKSTILF 414
                                                           N    +K  + F
Sbjct: 257 ------------------------------------------------NNYRYKKCIVYF 268

Query: 415 VPTRHHVEYIANLLK--------NCGYLVSYIYGSLDQRARNRQLYNFRAGL-TSILVVT 465
            PT   V Y  + ++        N    +  ++G L   +R + L  F   L  S+L+ T
Sbjct: 269 -PTCISVTYFYSFIQFLQSKGIINENLSIFSLHGKLQTVSRMKTLEKFTETLDNSVLLTT 327

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           DVAARG+DIP +  VI    P+ S IF+HR GRT RA   G A + ++
Sbjct: 328 DVAARGIDIPDVDLVIQLDPPTDSDIFLHRCGRTGRANRIGKAITFLN 375

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    L   +L       + +PTPIQ K+IP  L   DI+GLA+TGSGKTAAF +P++ 
Sbjct: 84  TFNELNLVPELLQACKNLNYSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A IL+P+RELA Q  + F        +RS  + GG ++ +Q   +M  
Sbjct: 144 RLWHDQEPY--YACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQT 292
           P +I+ATPGR + HL+      L+ +++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 321

Query: 353 I 353
           I
Sbjct: 322 I 322

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 71/123 (57%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E ++ L     +  + ++G L+Q  R   L  F+AG  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  V+N+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 529 KKI 531
           KK+
Sbjct: 444 KKL 446

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  145 bits (365), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 95/398 (23%), Positives = 182/398 (45%), Gaps = 56/398 (14%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           + E   +  QTN      +F    L + +L  +   GF  P+ IQ++ I  I++S D++ 
Sbjct: 5   ITEVEESQIQTNYDKVVYTFDDMNLDEKLLRGVYGYGFENPSAIQQRAIMPIIESHDVLA 64

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
            A++G+GKT  F +  ++++ +  S    +A++L+P+RELA+Q  KV    S    ++  
Sbjct: 65  QAQSGTGKTGTFSIAALQRIDT--SIKAPQALMLAPTRELALQIQKVVMALSFHMDVKVH 122

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276
              GG S  E     + +  ++V TPGR             +I+  + DE+D +   GF+
Sbjct: 123 ACIGGTSFVED-AEGLRDAQIVVGTPGRVFDNIQRRKFKTDNIKMFILDEADEMLSSGFK 181

Query: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
           EQ+ ++   LP   Q +L SAT+P+ +++     + NPV + + ++    E ++  +++ 
Sbjct: 182 EQIYQIFTMLPPTTQVVLLSATMPSDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNV 241

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
           + ++ +   L  + + I +  A                                      
Sbjct: 242 EEEQYKYECLTDLYDSISVTQA-------------------------------------- 263

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRA 456
                          ++F  TR  VE +   L    + VS IY  L Q+ R+  +  FR+
Sbjct: 264 ---------------VIFCNTRRKVEELTQKLTADNFTVSSIYSDLPQQERDTIMKEFRS 308

Query: 457 GLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           G + IL+ TD+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 309 GSSRILISTDLLARGIDVQQVSLVINYDLPTNKENYIH 346

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  147 bits (371), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 32  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 91

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+KS  +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 92  TLEKVKSKHNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 149

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L  LP N Q
Sbjct: 150 NETVHILVGTPGRVLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQ 209

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P S+ +F    L  P  + L  E
Sbjct: 210 SLLFSATFPLSVKEFMVNHLHKPYEINLMDE 240

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 124/211 (58%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 41  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 100

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 101 TLEKIKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 158

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
             +  V+V TPGR L L      DL   +  + DE+D++    F+  + ++L  LP   Q
Sbjct: 159 NESVHVLVGTPGRVLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 218

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    LTNP  + L  E
Sbjct: 219 SLLFSATFPLTVKEFMVKHLTNPYEINLMDE 249

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +S+ ++HR+GR+ R G+ G A ++I+
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 385

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 127/201 (63%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    +S   L  ++   F Q T IQR +IP+ L+  D++G ARTGSGKT AF++P++EK
Sbjct: 43  FKDLPISAQTLKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  ++  G  A+I+SP+RELAMQ ++V     R T   + L+ GG  ++ +    +S
Sbjct: 103 LYREKWTAFDGLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERIS 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             ++++ TPGR L HL   + L   +++  V DE+DR  +MGF++ L+ +++ LP++RQT
Sbjct: 162 KINILIGTPGRVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT  NSL D A+  LT+
Sbjct: 222 LLFSATQSNSLADLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q+AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 354

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  VI    P     ++HRVGRT R G +G +  +++
Sbjct: 355 RGIDFPAVNWVIQVDCPEDVDTYIHRVGRTGRYGKKGKSLIMLT 398

>TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {ON}
           Anc_8.87 YFL002C
          Length = 604

 Score =  148 bits (374), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/418 (27%), Positives = 187/418 (44%), Gaps = 77/418 (18%)

Query: 119 FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKS 178
           + L   I   I   GF + TP+Q  TIP++  ++D+V  + TGSGKT AF++P++EK+ S
Sbjct: 12  YELQPWIRTAIDVMGFERMTPVQASTIPMLAGNKDVVVDSVTGSGKTIAFVIPVLEKIIS 71

Query: 179 HSS------KVGARAVILSPSRELAMQTHKVFKDF----SRGTH-LRSVLLTGGDS--LE 225
             +      K     +I++P+REL+ Q   V   F      G + +RS LL G ++  + 
Sbjct: 72  EQANNVKFKKGHFHTLIIAPTRELSKQIQAVIDSFLDHYPEGLYPIRSKLLVGTNTRTVR 131

Query: 226 EQFGMMMSN-PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           +     + + P ++V TPGR L       +   S    + DE+DRL +  F   +  +L 
Sbjct: 132 DDVAQFLDDRPQILVGTPGRILDFLGNPTVKTSSCSMVILDEADRLLDGSFLGDVENILG 191

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            LP  R+T LFSAT+ ++  +  K GL NP+ + ++ +    ++L + +   K +++   
Sbjct: 192 ILPKQRRTGLFSATINSAGENIFKTGLRNPIKITVNSKQSAPQSLNIDYAVVKLEKKLEY 251

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           LL L+                                                     N 
Sbjct: 252 LLTLL-----------------------------------------------------NN 258

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNC--------GYLVSYIYGSLDQRARNRQLYNFRA 456
              +K  + F PT   V YI N  ++            +  ++G L   +R + L +F  
Sbjct: 259 YKFKKCIVYF-PTCIFVNYIYNFFQHLQKSKVIESKLSIFSLHGKLQTSSRMKTLDSFTQ 317

Query: 457 GL-TSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
               +IL+ TDVAARG+DIP +  VI    P+ S +F+HR GRT RA   G A   +S
Sbjct: 318 TFDNAILLTTDVAARGIDIPDVDLVIQVDPPTDSDVFLHRCGRTGRANRIGKAIVFLS 375

>SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {ON}
           similar to uniprot|P38112 Saccharomyces cerevisiae
           YBR142W MAK5 Essential nucleolar protein putative
           DEAD-box RNA helicase required for maintenance of M1
           dsRNA virus involved in biogenesis of large (60S)
           ribosomal subunits
          Length = 812

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 205/444 (46%), Gaps = 93/444 (20%)

Query: 118 SFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKL- 176
           +  LS   L  +S+ GF +PT IQ KTIPL LQ+ DI+G A TGSGKT A+ +P++E L 
Sbjct: 239 AMDLSFTTLQGLSQLGFLRPTEIQAKTIPLALQNEDIMGKASTGSGKTLAYGIPILETLV 298

Query: 177 KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRS----VLLTGGDSLEEQFGMM- 231
           K  ++      +I +P+RELA Q  +  +  +   + ++    + LTGG S+++Q  ++ 
Sbjct: 299 KDRTASERPVGLIFTPTRELAHQVTQHLQKVAGAIYEKNQYSIISLTGGLSIQKQERLLG 358

Query: 232 -MSNPDVIVATPGRFLHL---KVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
              +  ++VATPGRFL L     E       I+  V DE+DRL + G  ++  ++L  L 
Sbjct: 359 YKGSARIVVATPGRFLELIEKSKEFIKRFSQIDTLVLDEADRLLQDGHFDEFEKILKHLG 418

Query: 288 SNR-----------QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336
             R           QT++FSAT   SL  F K  L+      L + +    N        
Sbjct: 419 RARNVKGGSKSDGWQTMVFSATF--SLELFNK--LSTASWKSLKKGAGEDSN-------- 466

Query: 337 KHDEREAALLYLIQEV------IQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXX 390
              E EA L YL+ ++      + I    E+++                           
Sbjct: 467 ---EMEAVLKYLMTKIHFKSKPVIIDTNPEQKV--------------------------- 496

Query: 391 XXXXXXVRMPAANQLPSEK-------------STILFVPTRHHVEYIANLLKNCGYLVSY 437
                 VR      LP+E+             +T++F      V+ + N L N       
Sbjct: 497 ---TSQVRESLIECLPTERDLYVYYFVSMYPGTTLVFCNAIDSVKKLNNYLNNLKISSFQ 553

Query: 438 IYGSLDQRARNRQLYNFRA--------GLTSILVVTDVAARGVDIPMLANVINFSFPSSS 489
           I+ S+ Q+ R R L  F+            ++L+ +DVAARG+DIP + +VI++  P S+
Sbjct: 554 IHSSMSQKNRLRNLEKFQQQAHNNDFLNKPTVLLASDVAARGLDIPGIKHVIHYHLPRSA 613

Query: 490 KIFVHRVGRTARAGNRGWAYSIIS 513
            +++HR GRTARA + G +  I S
Sbjct: 614 DVYIHRSGRTARADSEGVSVMICS 637

>Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 179/389 (46%), Gaps = 56/389 (14%)

Query: 106 QTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKT 165
           QTN       F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT
Sbjct: 14  QTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKT 73

Query: 166 AAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLE 225
             F +  ++++   +S    +A++L+P+RELA+Q  KV    +    ++     GG S  
Sbjct: 74  GTFSIAALQRI--DTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFV 131

Query: 226 EQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           E     + +  ++V TPGR              I+  + DE+D +   GF+EQ+ ++   
Sbjct: 132 ED-AEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTL 190

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAAL 345
           LP   Q +L SAT+PN +++     + NPV + + ++    E ++  +++ + ++ +   
Sbjct: 191 LPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYEC 250

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L  + + I +  A                                               
Sbjct: 251 LTDLYDSISVTQA----------------------------------------------- 263

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                 ++F  TR  VE +   L++  + VS IY  L Q+ R+  +  FR+G + IL+ T
Sbjct: 264 ------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILIST 317

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVH 494
           D+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 318 DLLARGIDVQQVSLVINYDLPANKENYIH 346

>Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059W
           (REAL)
          Length = 395

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 179/389 (46%), Gaps = 56/389 (14%)

Query: 106 QTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKT 165
           QTN       F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT
Sbjct: 14  QTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKT 73

Query: 166 AAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLE 225
             F +  ++++   +S    +A++L+P+RELA+Q  KV    +    ++     GG S  
Sbjct: 74  GTFSIAALQRI--DTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFV 131

Query: 226 EQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           E     + +  ++V TPGR              I+  + DE+D +   GF+EQ+ ++   
Sbjct: 132 ED-AEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTL 190

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAAL 345
           LP   Q +L SAT+PN +++     + NPV + + ++    E ++  +++ + ++ +   
Sbjct: 191 LPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYEC 250

Query: 346 LYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQL 405
           L  + + I +  A                                               
Sbjct: 251 LTDLYDSISVTQA----------------------------------------------- 263

Query: 406 PSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVT 465
                 ++F  TR  VE +   L++  + VS IY  L Q+ R+  +  FR+G + IL+ T
Sbjct: 264 ------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILIST 317

Query: 466 DVAARGVDIPMLANVINFSFPSSSKIFVH 494
           D+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 318 DLLARGIDVQQVSLVINYDLPANKENYIH 346

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 124/213 (58%), Gaps = 2/213 (0%)

Query: 110 KHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           K K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF+
Sbjct: 30  KTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFV 89

Query: 170 LPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFG 229
           +P +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +   
Sbjct: 90  IPTLEKVKPKLNKI--QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNLRDDIL 147

Query: 230 MMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN 289
            +     ++V TPGR L L      DL      V DE+D++    F+  + ++LA LP N
Sbjct: 148 RLNDTIHILVGTPGRVLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILAFLPKN 207

Query: 290 RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
            Q+LLFSAT P ++ +F +  L  P  + L +E
Sbjct: 208 HQSLLFSATFPLTVKEFMEKHLNKPYEINLMEE 240

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 121/208 (58%), Gaps = 3/208 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G    +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 NFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++LSP+RELA+Q  K    F + + +R+  + GG    +Q   +
Sbjct: 175 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDL 234

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           +   ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 235 IRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRL 319
           TL++SAT P  +   A+  L +P+ V++
Sbjct: 295 TLMWSATWPKEVQQLARDYLNDPIQVQI 322

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           E   ++F  T+   + I   L+  G+    I+G  DQR R+  L  FR G + I+V TDV
Sbjct: 361 ESKILIFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDV 420

Query: 468 AARGV 472
           AARG+
Sbjct: 421 AARGI 425

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  146 bits (368), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 126/217 (58%), Gaps = 6/217 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I + IS+  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I+
Sbjct: 129 SFSHLSLKPEIQSEISK--FPKPTPIQSVSWPYLLSGRDVIGVAETGSGKTFAFGVPAID 186

Query: 175 KLKSH--SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
           +L S+  + +   + +++SP+RELA QT+      +    L    + GG   +EQ   + 
Sbjct: 187 QLVSNGDAKRKSVKVLVISPTRELASQTYDNLIILTNKVGLECCCVYGGVPKQEQRNQL- 245

Query: 233 SNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQ 291
            N  V+VATPGR L L  E ++DL  ++Y V DE+DR+ E GFEE +  ++    S +RQ
Sbjct: 246 RNSQVVVATPGRLLDLINEQSVDLSQVQYLVLDEADRMLEKGFEEDIKNIINQTNSRDRQ 305

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           TL+F+AT P  + + A   + +PV V +    ++S N
Sbjct: 306 TLMFTATWPKEVRELASTFMRDPVKVSIGNRDELSAN 342

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 67/103 (65%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     + N LK  GY V+ I+G L Q+ R   L +F+AG +++L+ TDVAAR
Sbjct: 378 VLIFALYKKEASRVENNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAAR 437

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 438 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 480

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  145 bits (365), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIP 86

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+IL P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 87  TLEKIKPKVNKI--QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      V DE+D++    F+  + ++L+  P +RQ
Sbjct: 145 HEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQ 204

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 205 SLLFSATFPLTVKEFMVNHLNKPYEINLMDE 235

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii ACR040W
          Length = 775

 Score =  148 bits (374), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 134/221 (60%), Gaps = 12/221 (5%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           +N++ +T      K    SF    +S++ L  +   GF + T IQR +IP+ L+  DI+G
Sbjct: 30  INDFGAT------KCTASSFDELPISEVTLKGLKESGFIKLTDIQRDSIPMALKGHDILG 83

Query: 157 LARTGSGKTAAFILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLR 214
            A+TGSGKT AF++P+IEKL  +  +   G  A+I+SP+RELAMQ ++V     + T   
Sbjct: 84  AAKTGSGKTLAFLIPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLIKIGKHTSFS 143

Query: 215 SVLLTGGDSLEEQFGM-MMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFE 272
           + L+ GG  +  +F M  +S  ++++ TPGR L H+   + L   +++  V DE+DR  +
Sbjct: 144 AGLVIGGKDV--KFEMDRISKINILIGTPGRILQHMDQAVGLTSSNLQILVLDEADRCLD 201

Query: 273 MGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           MGF++ L+ +++ LP +RQTLLFSAT   SL D A+  L +
Sbjct: 202 MGFKKTLDAIVSNLPPDRQTLLFSATQSQSLADLARLSLVD 242

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 411 TILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           T++F+ +   V ++    +    G  + +++G   Q AR   L  F     + L  TDV 
Sbjct: 291 TVVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHACLFSTDVV 350

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+D P +  V+    P     ++HR GR+AR G  G    +++               
Sbjct: 351 ARGIDFPTVDWVVQVDCPEDVDTYIHRAGRSARYGKSGKCLIMLTPQEEPGFL------- 403

Query: 529 KKILTTPMYEAATDLL---EKRWVEEGKEKILFKAPKPSY 565
            K L T M E    ++   +++ +    + +LFK+P+  Y
Sbjct: 404 -KRLKTKMIEPKKSVIKQSKRKSIRNQLQSLLFKSPELKY 442

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  145 bits (365), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 133/243 (54%), Gaps = 7/243 (2%)

Query: 116 FPSFGLSKLI---LNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPM 172
           F SF   KL+   +       + +PTPIQ + IP  L+ +DI+GLA+TGSGKTAAF +P+
Sbjct: 78  FESFSELKLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPI 137

Query: 173 IEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
           + +L          A +L+P+RELA Q  + F        +R+  + GG ++ +Q   +M
Sbjct: 138 LNQLWHDQQPY--YACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLM 195

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-R 290
             P +I+ATPGR + HL+      ++ ++Y V DE+DRL +M F   L+ +L  +P+  R
Sbjct: 196 RKPHIIIATPGRLMDHLENTKGFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGR 255

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQ 350
            T LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ 
Sbjct: 256 TTYLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLN 315

Query: 351 EVI 353
           E +
Sbjct: 316 EFL 318

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 67/105 (63%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 320 KTVIIFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVA 379

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S
Sbjct: 380 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  144 bits (363), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       + +PTPIQ + IP  L+ +DI+GLA+TGSGKTAAF +P++ 
Sbjct: 106 SFSELNLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 165

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A +L+P+RELA Q  + F        +R+  + GG ++ +Q   +M  
Sbjct: 166 QLWHDQQPY--YACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 223

Query: 235 PDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQT 292
           P +I+ATPGR + HL+      ++ +++ V DE+DRL +M F   L+ +L  +P+  R T
Sbjct: 224 PHIIIATPGRLMDHLENTKGFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 283

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
            LFSAT+ + +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 284 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 343

Query: 353 I 353
           +
Sbjct: 344 L 344

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 67/105 (63%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+ I+F  T+ + E IA L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 450

>CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa]
           {ON} similar to uniprot|P24784 Saccharomyces cerevisiae
           YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
           YOR204w
          Length = 604

 Score =  145 bits (366), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 150/268 (55%), Gaps = 18/268 (6%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L +L+L N+    F +PTP+Q+ +IP++ ++RD++  A+TGSGKT  F+ P++ +
Sbjct: 140 FKSPPLDELLLENVELANFSKPTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSE 199

Query: 176 L-------------KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
           L              S+  K    A++L+P+RELA+Q     K ++  + ++  ++ GG 
Sbjct: 200 LFLNGPAPLPEHTRHSYMRKCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGA 259

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            + +Q   M    +++VATPGR   L     + L +++Y V DE+DR+ +MGFE Q+  +
Sbjct: 260 PIGQQMRDMDRGCNLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 319

Query: 283 L--AALPS--NRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +PS  +RQTL+FSAT P  +   A+  L + + + + +    SEN++   L  + 
Sbjct: 320 VEDCDMPSVNDRQTLMFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVED 379

Query: 339 DEREAALL-YLIQEVIQIPLATEEQIKL 365
            ++ +ALL  LI E+  + L   E  ++
Sbjct: 380 YDKNSALLDILINEIDGLTLVFVETKRM 407

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 63/103 (61%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
           T++FV T+   + + + L    +  + I+G   Q  R R L+ FR G+ +ILV T VAAR
Sbjct: 398 TLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVAAR 457

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP + NVIN+  P+    +VHR+GRT RAGN G A S  +
Sbjct: 458 GLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFN 500

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 43  KGNTFEDFHLKRELLMGIFEAGFEKPSPIQEESIPVAITGRDILARAKNGTGKTAAFVIP 102

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            ++K+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 103 TLQKIKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 160

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      + DE+D++    F+  + ++L  LP N Q
Sbjct: 161 NDTVHVLVGTPGRVLDLASRKIADLSECALFIMDEADKMLSRDFKTIIEQILIFLPKNHQ 220

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 221 SLLFSATFPLTVKEFMVKHLNKPYEINLMEE 251

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 286 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 345

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 346 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 387

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 123/201 (61%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   +  ++   F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSSATVKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  S   G  A+I+SP+RELAMQT++V       T   + L+ GG  ++ +    +S
Sbjct: 103 LYREKWSEFDGLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARIS 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             ++++ TPGR L H+   + L   +++  V DE+DR  +MGF++ L+ +++ LP  RQT
Sbjct: 162 KINILIGTPGRILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQT 221

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLTDLARLSLTD 242

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   QRAR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P     ++HRVGR+AR G +G +  +++
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQGKSLIMLT 398

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 130/242 (53%), Gaps = 5/242 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   ++       F +PTPIQ K IP  LQ +DI+GLA+TGSGKTAAF +P++ 
Sbjct: 67  SFRELDLVPELIEACDNLNFTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILN 126

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           +L          A IL+P+RELA Q  + F        +R+  + GG ++ +Q   +M  
Sbjct: 127 RLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 184

Query: 235 PDVIVATPGRFL-HLKV-EMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN-RQ 291
           P +I+ATPGR + HL+V +    L+  ++ V DE+DRL  M F   L+ +L  +P+  R 
Sbjct: 185 PHIIIATPGRLMDHLEVHKRGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRT 244

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQE 351
           T LFSAT+ + +    +A LTN V   +  + +  + L    +      +   L+YL+ E
Sbjct: 245 TYLFSATMTSKIDKLQRASLTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNE 304

Query: 352 VI 353
            I
Sbjct: 305 FI 306

 Score = 98.6 bits (244), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K+TI+F  T+ + E I+ L     +  + ++G L+Q  R   L  F+AG  SILV TDVA
Sbjct: 308 KTTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKKSILVATDVA 367

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXG 528
           ARG+DIP +  VIN+  P  SK ++HRVGRTARAG  G + S++S              G
Sbjct: 368 ARGLDIPSVDLVINYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 427

Query: 529 KKI 531
           KK+
Sbjct: 428 KKL 430

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 125/208 (60%), Gaps = 4/208 (1%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           K  +  +F    +S   L  +    F + T IQ+ +IP+ L+  D++G A+TGSGKT AF
Sbjct: 36  KTSRATTFDDLPISGNTLKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAF 95

Query: 169 ILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEE 226
           ++P+IEKL  +  +   G  A+I+SP+RELAMQT++V     R T   + L+ GG  ++ 
Sbjct: 96  LIPVIEKLYREKWTEHDGLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKF 155

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           +   + S  +V++ TPGR L H+   + L+   ++  V DE+DR  +MGF+  L+ +++ 
Sbjct: 156 ELERI-SKINVLIGTPGRILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSN 214

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           LP  RQTLLFSAT   SL D A+  LT+
Sbjct: 215 LPPTRQTLLFSATQSQSLADLARLSLTD 242

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDVVA 352

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P     ++HR GR+AR G +G +  +++
Sbjct: 353 RGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQGKSLIMLT 396

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 138/236 (58%), Gaps = 7/236 (2%)

Query: 113 KGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPM 172
           +GSF    LS   +  I + GF Q T +Q +TIP +L  +D++G A+TGSGKT AF++P 
Sbjct: 33  EGSFSDLKLSDGTMKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPA 92

Query: 173 IEKLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGM 230
           IE L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   
Sbjct: 93  IEMLHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADK 152

Query: 231 MMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS- 288
           +M   ++++ATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ 
Sbjct: 153 LMKGVNILIATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 212

Query: 289 NRQTLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDER 341
           +RQ++LFSAT    + D A+  L   P+ + +D E   S  + LE  ++  + D+R
Sbjct: 213 DRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKR 268

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 281 KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score =  145 bits (365), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 143/251 (56%), Gaps = 17/251 (6%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI-- 173
           F S  L +L+L NI    F +PTP+Q+ +IP++ ++RD++G A+TGSGKT  F+ P++  
Sbjct: 139 FTSPPLEELLLENIKLARFTKPTPVQKYSIPIVSKNRDLMGCAQTGSGKTGGFLFPILSE 198

Query: 174 ----------EKLKSHSSKVG-ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGD 222
                     +K ++H  + G   A++L+P+RELA Q  +  + F+  + +R  ++ GG 
Sbjct: 199 MFINGPLNVPDKSRNHYMRKGYPTALVLAPTRELATQIFEESRKFTYRSWVRPCVVYGGA 258

Query: 223 SLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNEL 282
            +  Q   +    D++VATPGR   L     + L ++ Y + DE+DR+ +MGFE Q+  +
Sbjct: 259 PIGNQMRELDRGCDLLVATPGRLNDLLERGKISLMNVRYLILDEADRMLDMGFEPQIRHI 318

Query: 283 L--AALP--SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH 338
           +    +P   +RQTL+FSAT P  +   A+  L N V + + +    SEN+    +  + 
Sbjct: 319 VEDCDMPEVQDRQTLMFSATFPRDIQHLARDFLKNYVFLSVGRVGSTSENITQKIIMVED 378

Query: 339 DEREAALLYLI 349
            ++++ALL L+
Sbjct: 379 MDKKSALLDLL 389

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (57%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           E  T++FV T+   + + + L    +  + I+G   Q  R R L  F+AG   ILV T V
Sbjct: 394 EGLTLIFVETKRMADQLTDFLIMQNFNATAIHGDRTQEERERALGAFKAGRADILVATAV 453

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           AARG+DIP +  VINF  PS    +VHR+GRT RAGN G A S  +
Sbjct: 454 AARGLDIPNVTLVINFDLPSDIDDYVHRIGRTGRAGNTGVAISFFN 499

>Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON}
           YDR194C (REAL)
          Length = 665

 Score =  145 bits (366), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 182/419 (43%), Gaps = 76/419 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKLKS 178
           L K I   I+R  F   TP+Q+KTI  IL S   D++  A+TG+GKT AF++P+ + L +
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLMN 172

Query: 179 --HSSKVGARAVILSPSRELAMQTH---KVFKDFSRG-THLRSVLLTGGDSLEEQFGMMM 232
               S+   +AVI++P+R+LA+Q     K   D + G      V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIESEVKKIHDMNYGLKKYGCVSLVGGTDFRAAMNKMN 232

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQ-------LNELL 283
              P++++ATPGR +  L+   N   + ++Y V DE+DRL E+GF +        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +    N +TLLFSATL + +   A               + I    E LFL T       
Sbjct: 293 SKSVDNIKTLLFSATLDDKVQKLA---------------NNIMNKKECLFLDTVDKNEPE 337

Query: 344 ALLYLIQEVI------QIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
           A   + Q V+          A  E IK                                 
Sbjct: 338 AHERIDQSVVISEKFANSIFAAVEHIK--------------------------------- 364

Query: 398 RMPAANQLPSEKSTILFVPTRHHVEYIANLLKN---CGYLVSYIYGSLDQRARNRQLYNF 454
                 +  S    I+F PT     ++ N+L+N       +   +G + Q  R   +  F
Sbjct: 365 --KQIKERESNYKAIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNKRTSLVKRF 422

Query: 455 RAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +   + ILV TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G +   I 
Sbjct: 423 KKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFIC 481

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 143/243 (58%), Gaps = 7/243 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF S  LS+  +  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE
Sbjct: 30  SFKSLNLSQPTMRAIEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPTIE 89

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S   K   G   +I++P+RELA+Q   V ++          ++ GG +  ++   +M
Sbjct: 90  LLHSLKFKPRNGTGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 149

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              +++VATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ +R
Sbjct: 150 KGVNLLVATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDR 209

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDEREAALLY 347
           Q++LFSAT    + D ++  L   P+ + +  + +S  ++ LE  ++  + D+R   L  
Sbjct: 210 QSMLFSATQTTKVEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVVCESDKRFLLLFS 269

Query: 348 LIQ 350
            ++
Sbjct: 270 FLK 272

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      IL+ TDV
Sbjct: 276 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDV 335

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGN 504
           AARG+DIP +  +I F  P   + ++HRVGRTAR  N
Sbjct: 336 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTN 372

>CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160c DHH1
          Length = 507

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  SF  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 88

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   R   +  ++ TGG +L +    +
Sbjct: 89  TLEKIKPKLNKI--QALIMVPTRELALQTSQVIRTLGRHCGVSCMVTTGGTNLRDDILRL 146

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      V DE+D++    F+  + ++L  LP   Q
Sbjct: 147 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQVLTFLPKAHQ 206

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 63/102 (61%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  ++FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQDRNKVFHDFRQGKVRTLVCSDLLTRG 331

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score =  142 bits (359), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALTRRDILARAKNGTGKTAAFVIP 87

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +E +K   +K+  +A+I+ P+RELA+QT +V +   +   L  ++ TGG +L +    +
Sbjct: 88  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGLSCMVTTGGTNLRDDIMRL 145

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      + DE+D++    F+  + ++L+ LPS+ Q
Sbjct: 146 NEPVHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKSLIEQILSFLPSSHQ 205

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 206 SLLFSATFPLTVKEFMVKHLNKPYEINLMDE 236

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 67/124 (54%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISXXXXXXXXXXXXXXGKKI 531
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+              G +I
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 390

Query: 532 LTTP 535
            + P
Sbjct: 391 ASIP 394

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  144 bits (362), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 120/208 (57%), Gaps = 3/208 (1%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F   G  + +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 175 KLKSH---SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + +    S   G   ++L+P+RELA+Q  K    F R + +R+  + GG    +Q   +
Sbjct: 175 HINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDL 234

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
               ++++ATPGR + +      +LK + Y V DE+DR+ +MGFE Q+ +++  +  +RQ
Sbjct: 235 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRL 319
           TL++SAT P  +   A+  L +P+ V +
Sbjct: 295 TLMWSATWPKEVQQLARDYLHDPIQVNI 322

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+   T+   + I + L+  G+    I+G    +  +  L ++R G + I+V TDV ARG
Sbjct: 365 IILHSTKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARG 424

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +D+  +  VIN+  P + + +VHR+GRT RAG  G A S  +
Sbjct: 425 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 466

>TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {ON}
           Anc_7.336 YDL160C
          Length = 479

 Score =  142 bits (358), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  SF  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 88

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L++    +
Sbjct: 89  ALEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDIMRL 146

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L  LP + Q
Sbjct: 147 NETVHILVGTPGRVLDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSHQ 206

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNRVFHEFRQGKVRTLVCSDLLTRG 331

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score =  142 bits (358), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLRRELLMGIFEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIP 86

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +E +K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 87  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      V DE+D++    F+  + ++L+ LP N Q
Sbjct: 145 NEPVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKSLVEQILSFLPQNHQ 204

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 205 SLLFSATFPLTVKEFMVKHLNKPYEINLMDE 235

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}
           YDL160C (REAL)
          Length = 506

 Score =  142 bits (358), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLRRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L+ LPS+ Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPSSHQ 221

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}
           MSS116DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns; non-polar RNA
           helicase that also facilities strand annealing
          Length = 664

 Score =  144 bits (364), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 181/419 (43%), Gaps = 76/419 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKL-- 176
           L K I   I+R  F   TP+Q+KTI  IL S   D++  A+TG+GKT AF++P+ + L  
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLIN 172

Query: 177 KSHSSKVGARAVILSPSRELAMQTH---KVFKDFSRGT-HLRSVLLTGGDSLEEQFGMMM 232
               S+   +AVI++P+R+LA+Q     K   D + G      V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMN 232

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQ-------LNELL 283
              P++++ATPGR +  L+   N   + ++Y V DE+DRL E+GF +        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +    N +TLLFSATL + +   A               + I    E LFL T       
Sbjct: 293 SKSADNIKTLLFSATLDDKVQKLA---------------NNIMNKKECLFLDTVDKNEPE 337

Query: 344 ALLYLIQEVI------QIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
           A   + Q V+          A  E IK                                 
Sbjct: 338 AHERIDQSVVISEKFANSIFAAVEHIK--------------------------------- 364

Query: 398 RMPAANQLPSEKSTILFVPTRHHVEYIANLLKN---CGYLVSYIYGSLDQRARNRQLYNF 454
                 +  S    I+F PT     ++ ++LKN       +   +G + Q  R   +  F
Sbjct: 365 --KQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRF 422

Query: 455 RAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +   + ILV TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G +   I 
Sbjct: 423 KKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFIC 481

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score =  142 bits (359), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 35  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 94

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +E++K + +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 95  TLERIKPNLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 152

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      + DE+D++    F+  + ++L  LP   Q
Sbjct: 153 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 212

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L NP  + L  E
Sbjct: 213 SLLFSATFPLTVKEFMVKHLNNPYEINLMDE 243

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +S+ ++HR+GR+ R G+ G A ++I+
Sbjct: 338 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 379

>KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {ON}
           Anc_1.211 YJL138C
          Length = 397

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 95/399 (23%), Positives = 181/399 (45%), Gaps = 58/399 (14%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           + E   +   TN      +F    L   +L  +   GF +P+ IQ++ I  I++  D++ 
Sbjct: 7   IQEVEESQIDTNYDKVVYNFDDMNLEPNLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLA 66

Query: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
            A++G+GKT  F +  ++++         +A++L+P+RELA+Q  KV    S   +L+  
Sbjct: 67  QAQSGTGKTGTFSIAALQRIDPAIK--NPQALMLAPTRELALQIQKVVMSLSFHMNLKVH 124

Query: 217 LLTGGDS-LEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGF 275
              GG S +E+  G+   +  ++V TPGR             +I+  + DE+D +   GF
Sbjct: 125 ACIGGTSFIEDAEGL--RDAQIVVGTPGRVFDNIQRRRFKTDNIKMFILDEADEMLSSGF 182

Query: 276 EEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLS 335
           +EQ+ E+   LP   Q +L SAT+P  +++     + +PV + + ++    E ++  +++
Sbjct: 183 KEQIYEIFTMLPPTTQVVLLSATMPRDVLEVTTKFMRSPVRILVKKDELTLEGIKQFYVN 242

Query: 336 TKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXX 395
            + ++ +   L  + E I +  A                                     
Sbjct: 243 VEQEQYKYECLTDLYESIAVTQA------------------------------------- 265

Query: 396 XVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455
                           ++F  TR  VE +   L    + VS IY  L Q+ R+  +  FR
Sbjct: 266 ----------------VIFCNTRRKVEELTQRLTADNFTVSAIYSDLPQQERDTIMKEFR 309

Query: 456 AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           +G + IL+ TD+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 310 SGSSRILISTDLLARGIDVQQVSLVINYDLPTNKENYIH 348

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  142 bits (359), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 124/216 (57%), Gaps = 5/216 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS  I + IS+  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P + 
Sbjct: 124 AFDHISLSPEIQHEISK--FPKPTPIQSVSWPYLLSGKDVVGVAETGSGKTFAFGVPAVN 181

Query: 175 KLKS-HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
            L S  + K G + +++SP+RELA QT+      ++   +    + GG   +EQ    + 
Sbjct: 182 NLMSADAKKKGIQVLVISPTRELASQTYDNLISLTKKAGVNCCCVYGGVPKDEQRA-QLK 240

Query: 234 NPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
              V+VATPGR L L  E +  L +++Y V DE+DR+ E GFEE +  ++ +  S  RQT
Sbjct: 241 KAHVVVATPGRLLDLIEEGSARLSNVDYLVLDEADRMLEKGFEEDIKRIIGSTKSAGRQT 300

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           L+F+AT P  + + A   + NPV V +    ++S N
Sbjct: 301 LMFTATWPKEVRELASTFMNNPVKVSIGNRDELSAN 336

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAAR
Sbjct: 372 VLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAAR 431

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 432 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 474

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  142 bits (359), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 127/216 (58%), Gaps = 5/216 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    L K + N I++  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 131 AFNQISLDKEVQNEIAK--FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIN 188

Query: 175 KLKSHSSKV-GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
            L + SSK  G + +++SP+RELA Q +      ++   +   ++ GG   ++Q    ++
Sbjct: 189 NLLTSSSKPKGIKVLVISPTRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQ-RRQIA 247

Query: 234 NPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQT 292
             +V+VATPGR L L  E ++DL  ++Y V DE+DR+ E GFEE +  ++    S +RQT
Sbjct: 248 KSNVVVATPGRLLDLIEEGSVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQT 307

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           L+F+AT P  + + A   +  PV V +    ++S N
Sbjct: 308 LMFTATWPKEVRELASTFMKEPVKVSIGNRDELSAN 343

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     +   L   GY V+ I+G L Q+ R + L  F++G +++L+ TDVAAR
Sbjct: 379 VLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAAR 438

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 439 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 481

>Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar to
           Ashbya gossypii AGL112C
          Length = 658

 Score =  144 bits (363), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 192/409 (46%), Gaps = 70/409 (17%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTI-PLILQSRDIVGLARTGSGKTAAFILPMIEKL--- 176
           L + + + +  + F   TP+Q++TI P+++ S D+V  A+TG+GKT AF++PM ++L   
Sbjct: 122 LHEQLYDAVKMQNFESLTPVQQRTIKPILMTSNDVVARAKTGTGKTMAFLIPMFQRLFMT 181

Query: 177 -KSHSSKVGARAVILSPSRELAMQTH-KVFKDFSRGTHLR---SVLLTGGDSLEEQFGMM 231
              +S KV  + V+++P+R+LA Q   +V K       LR   S+ L GG SL      M
Sbjct: 182 QNEYSDKV--KCVVVAPTRDLAEQIQFEVLKLQKANKALRKFSSICLIGGTSLVNSMRRM 239

Query: 232 MSN-PDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN 289
             + P +++ATPGR L  +    +    ++++ V DE+D L ++GF+  L  + + L S 
Sbjct: 240 DRHAPSIVIATPGRLLDVMGNSGDKYFNAVDFKVLDEADTLLDIGFKADLQRISSTLNSL 299

Query: 290 RQ-------TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKH-DER 341
            Q       TLLFSAT+ +++ + A               + I      LF+ T H DE 
Sbjct: 300 NQKGAEHIRTLLFSATISSNVQELA---------------NNIMNGDTCLFIDTVHKDEP 344

Query: 342 EAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPA 401
           EA      +++ Q  + +E                    +                +  A
Sbjct: 345 EAH-----EKITQNLIVSES-----------------YAHNLVAPVETIEKHLKKRKFKA 382

Query: 402 ANQLPSEKSTILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLT 459
              LP+ KS          VE+  NLLK       +S  +G + Q+ R+R +  F+A   
Sbjct: 383 ILFLPTVKS----------VEFYGNLLKKLFRSLPISLFHGKVSQQRRSRLVKEFKASKH 432

Query: 460 SILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
            + + TDV ARG+D P + +V     PS    +VHR+GRTAR G  G A
Sbjct: 433 GLFICTDVGARGMDFPEVDHVYQLGVPSGLSNYVHRIGRTARGGREGEA 481

>TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.336
           YDL160C
          Length = 502

 Score =  142 bits (357), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 30  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 89

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+KS  +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 90  TLEKVKSKINKI--QALIMVPTRELALQTSQVVRTLGKRCEISCMVTTGGTNLRDDIIRL 147

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L  LP   Q
Sbjct: 148 NETVHILVGTPGRVLDLASRGIADLSGCGLFIMDEADKMLSRDFKSIIEQILTFLPEQHQ 207

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 208 SLLFSATFPLTVKEFMVKHLHKPYEINLMDE 238

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + G+   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 273 IIFCNSTNRVELLAKKITDLGFSCYYSHARMKQQERNRVFHEFRHGKVRTLVCSDLLTRG 332

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 333 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 374

>TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON}
           Anc_1.211 YJL138C
          Length = 401

 Score =  139 bits (350), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 92/390 (23%), Positives = 179/390 (45%), Gaps = 58/390 (14%)

Query: 106 QTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKT 165
           +TN      +F    L K +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT
Sbjct: 15  ETNYDKVVYTFDDMKLKKELLRGVFAYGFEEPSAIQQRAILPIVEGNDVLAQAQSGTGKT 74

Query: 166 AAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDS-L 224
             F +  ++++         +A+IL+P+RELA+Q  KV    +    ++     GG S +
Sbjct: 75  GTFSIAALQRINPEIK--APQALILAPTRELALQIQKVVISLALYLDIKVHACIGGTSFV 132

Query: 225 EEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLA 284
           E+  G+   +  ++V TPGR         L    I+  + DE+D +   GF+EQ+ ++  
Sbjct: 133 EDTEGL--RDAQIVVGTPGRVFDNIQRHRLRTDKIKMFISDEADEMLSSGFKEQIYQIFT 190

Query: 285 ALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAA 344
            +P   Q +L SAT+P  +++     + +PV + + ++    E ++  +++ + ++ +  
Sbjct: 191 MMPPTTQVVLLSATMPRDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYINVEEEDYKYD 250

Query: 345 LLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQ 404
           +L  + + I +  A                                              
Sbjct: 251 VLTDLYDSISVTQA---------------------------------------------- 264

Query: 405 LPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVV 464
                  ++F  TR  VE +   L    + VS IY  L Q+ R   +  FR+G + IL+ 
Sbjct: 265 -------VIFCNTRRKVEELTKKLTEADFTVSAIYSDLPQQERETIMKEFRSGSSRILIS 317

Query: 465 TDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           TD+ ARG+D+  ++ VIN+  P++ + ++H
Sbjct: 318 TDLLARGIDVQQVSLVINYDLPTNKENYIH 347

>ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL171W
           (ROK1)
          Length = 569

 Score =  142 bits (358), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 148/252 (58%), Gaps = 14/252 (5%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F L K +L+N+    F +PTPIQ + IP+ LQ+RDIV  A TGSGKT AF+
Sbjct: 119 GSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQNRDIVACAPTGSGKTLAFL 178

Query: 170 LPMIEKLKSHSS-KVGARAVILSPSRELAMQTHKVFKDFSRGTHLR-----SVLLTGGDS 223
           +P+++++ S  +   G + +I+SP++ELA Q        ++   L      SV L     
Sbjct: 179 IPLLQQVISDKAVGTGVKGLIISPTKELANQIFDECSKLAQRIFLEKKRPLSVALLSKSL 238

Query: 224 LEEQFGMMMSNP--DVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNE 281
             +    ++S+   D+I++TP R + +    +LDL +++Y +FDE+D+LF+  F EQ ++
Sbjct: 239 AAKLKNQIVSDKKYDIIISTPLRLIDIVKSESLDLSAVKYLIFDEADKLFDKTFVEQTDD 298

Query: 282 LLAALP-SNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDE 340
           +L+A    N   +LFSATLP+S+ + A++ +T+PV V +  +   + N+E   +   ++E
Sbjct: 299 ILSACSHPNISKVLFSATLPSSVEELAQSIMTDPVRVIIGHKEAANTNIEQKLVFCGNEE 358

Query: 341 -REAALLYLIQE 351
            +  A+  LIQE
Sbjct: 359 GKLVAIRQLIQE 370

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 435 VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           V  I+    Q  R + +  F++G    L+ TDV ARG+D   +  VIN+  P S++ +VH
Sbjct: 401 VDVIHAERTQVQREKIIERFKSGDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAYVH 460

Query: 495 RVGR 498
           R+GR
Sbjct: 461 RIGR 464

>NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402
          Length = 684

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/422 (27%), Positives = 191/422 (45%), Gaps = 82/422 (19%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQ---SRDIVGLARTGSGKTAAFILPMIEKLK 177
           +  ++  +ISR  F   TP+Q++TI  IL    S D++  A+TG+GKT AF++PM + L 
Sbjct: 126 IDTMLHKSISRMNFPGLTPVQQRTIKPILTTSTSDDVIARAKTGTGKTFAFLIPMFQHLI 185

Query: 178 SH--SSKVGARAVILSPSRELAMQTHKVFKDFSRGTH----LRSVLLTGGDSLEEQFGMM 231
           +    S+   + VI++P+R+LA+Q     K      +       V L GG +    FGM 
Sbjct: 186 NTKLDSQNMVKCVIVAPTRDLALQIEAEVKKIHDNNYGLKKFGCVSLVGGTN----FGMA 241

Query: 232 MS-----NPDVIVATPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFEEQ------- 278
           M       P++I+ TPGR + +  + +    K +++ + DE+DRL E+GF+E        
Sbjct: 242 MRKMDQLRPNIIIGTPGRLIDVMDKYSDKFFKYVDFKILDEADRLLEIGFKEDLEYISST 301

Query: 279 LNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLD----QESKISENLEMLFL 334
           LN + A    + +TLLFSATL   +   A   +     + LD     E +  E ++   +
Sbjct: 302 LNRINAVGKDHIRTLLFSATLDEKVQVLANNIMNKEQCLFLDTVDKNEPEAHEKIDQAVV 361

Query: 335 STKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXX 394
            T H    A  +Y   E +++ +  + + K                              
Sbjct: 362 LTDH---FAHNIYAAIEHLRLKIKEDPEYK------------------------------ 388

Query: 395 XXVRMPAANQLPSEKSTILFVPTRHHVEYIANLLK---NCGYLVSYIYGSLDQRARNRQL 451
                           TI+F PT    ++ + LLK        +   +G ++QR R R +
Sbjct: 389 ----------------TIVFTPTVKFTKFFSQLLKKEFGSQLPIYEFHGQIEQRRRTRIV 432

Query: 452 YNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSI 511
            +F+     +LV TDV ARG+D P +  VI    PS    ++HR+GRTAR+G  G +   
Sbjct: 433 GDFKRVKAGLLVCTDVGARGMDFPNVKEVIQVGVPSELANYIHRIGRTARSGKEGSSTLF 492

Query: 512 IS 513
           I 
Sbjct: 493 IC 494

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 87

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 88  TLEKVKPKINKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRL 145

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      V DE+D++    F+  + ++L  LP   Q
Sbjct: 146 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQ 205

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 206 SLLFSATFPITVKEFMVKHLHKPYEINLMEE 236

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.336
           YDL160C
          Length = 585

 Score =  142 bits (358), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  SF  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 35  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAIAGRDILARAKNGTGKTAAFVIP 94

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 95  TLEKVKPKINKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 152

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      + DE+D++    F+  + ++L  LP + Q
Sbjct: 153 NETIHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPKHHQ 212

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    LT P  + L  E
Sbjct: 213 SLLFSATFPLTVKEFMVKHLTKPYEINLMDE 243

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RNR  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 338 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 379

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 142/243 (58%), Gaps = 7/243 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    LS+  +  I + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF+LP IE
Sbjct: 35  SFADLKLSEPTMKAIEKMGFENMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 175 KLKS--HSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S  +  + G   ++++P+RELA+Q   V ++          ++ GG +  ++   ++
Sbjct: 95  MLHSLKYKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLV 154

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP-SNR 290
              ++++ATPGR L HL+       K+++  + DE+DR+ E+GFE+++ +++  LP  +R
Sbjct: 155 KGVNMLIATPGRLLDHLQNTKGFVYKNLKALIIDEADRILEIGFEDEMKQIIRILPKEDR 214

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDEREAALLY 347
           Q++LFSAT    + D A+  L   P+ + +  D+++  ++ LE  ++  + D+R   L  
Sbjct: 215 QSMLFSATQTTKVEDLARMSLRKGPLFINVVTDKDTSTADGLEQGYVVCESDKRFLLLFS 274

Query: 348 LIQ 350
            ++
Sbjct: 275 FLK 277

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 281 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 341 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L+ LP   Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {ON}
           Anc_8.402 YDR194C
          Length = 676

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 122/414 (29%), Positives = 194/414 (46%), Gaps = 80/414 (19%)

Query: 125 ILNN-----ISRKGFHQPTPIQRKTIPLILQSR--DIVGLARTGSGKTAAFILPMIEKLK 177
           ILN+     ++  GF   TP+Q+KTI  IL++   D++  A+TG+GKT AF+LP++E L 
Sbjct: 139 ILNDDLYEAVNAMGFPSLTPVQQKTIKPILENDKVDVITRAKTGTGKTFAFLLPIMEHLM 198

Query: 178 SHSSKVGA---RAVILSPSRELAMQT-HKVFKDFSRGTHLR---SVLLTGGDSLEEQFGM 230
             S+  G+   R+VI++P+R+LA+Q   ++ K +S+   LR   S+ L GG        +
Sbjct: 199 -RSNVAGSDSVRSVIVAPTRDLALQIEEELRKIYSKNRELRKFGSLSLVGGTDYRRAIRI 257

Query: 231 MMS-NPDVIVATPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFE-------EQLNE 281
           ++   P +++ TPGR +    E      K +++ V DE+DRL E+GF+         LN+
Sbjct: 258 LLDKQPSIVIGTPGRLIQTLDEYGEQCFKDVDFKVLDEADRLLEIGFKTDLEYISSTLNK 317

Query: 282 LLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESK----ISENLEMLFLSTK 337
           L +   ++ +TLLFSATL + +   A   +     + LD   K      EN++   + T 
Sbjct: 318 LNSKGEAHIRTLLFSATLDDKVQILANDIMNKDECLFLDTVDKNAPEAHENIDQSVVMT- 376

Query: 338 HDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
            D    +L   IQ  I+  + TE + K                                 
Sbjct: 377 -DSYADSLFATIQH-IKNKVDTEPEYK--------------------------------- 401

Query: 398 RMPAANQLPSEKSTILFVPTRHHVEYIANLLKNC---GYLVSYIYGSLDQRARNRQLYNF 454
                         ILF PT     YI N L       + +   +G + Q  R   + +F
Sbjct: 402 -------------AILFSPTVKLTTYICNRLYKVFGRSFPILEFHGKISQARRTYLVKDF 448

Query: 455 RAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
           +   + +LV TDV ARG+D P +  V+    P+    +VHR+GRTARAG  G +
Sbjct: 449 KKIKSGLLVCTDVGARGMDFPNVGEVLQLGVPTELANYVHRIGRTARAGKEGAS 502

>Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}
           YDL160C (REAL)
          Length = 507

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +E++K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLERVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+  + ++L+ LP+  Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPTTHQ 221

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      + DE+D++    F+  + ++L+ LP   Q
Sbjct: 162 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L +E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (60%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q+ RN+  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 120/419 (28%), Positives = 181/419 (43%), Gaps = 76/419 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLIL--QSRDIVGLARTGSGKTAAFILPMIEKLKS 178
           L K +   I+R  F   TP+Q+KTI  IL  Q  D++  A+TG+GKT AF++P+ + L +
Sbjct: 112 LDKELHKAITRMEFPGLTPVQQKTIKPILSSQEHDVIARAKTGTGKTFAFLIPIFQHLIN 171

Query: 179 H--SSKVGARAVILSPSRELAMQTH---KVFKDFSRG-THLRSVLLTGGDSLEEQFGMMM 232
               S+   +AVI++P+R+LA+Q     K   D + G      V L GG         M 
Sbjct: 172 TKLDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMN 231

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQ-------LNELL 283
              P++++ TPGR +  L+   N   + ++Y V DE+DRL E+GF +        LNE  
Sbjct: 232 KLRPNIVIGTPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGLLNEKN 291

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +    N +TL+FSATL + +   A               + I    E LFL T       
Sbjct: 292 SKSADNIKTLMFSATLDDKVQKLA---------------NNIMNKSECLFLDTVDKNEPE 336

Query: 344 ALLYLIQEVI------QIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXV 397
           A   + Q V+          A  E IK                                 
Sbjct: 337 AHERIDQSVVISEKFANSIFAAVEHIK--------------------------------- 363

Query: 398 RMPAANQLPSEKSTILFVPTRHHVEYIANLLKN---CGYLVSYIYGSLDQRARNRQLYNF 454
                 +  S    I+F PT     ++ N+L+N       +   +G + Q  R   +  F
Sbjct: 364 --KQVKERESNYKAIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNRRTSLVKKF 421

Query: 455 RAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +   + ILV TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G +   I 
Sbjct: 422 KKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFIC 480

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 126/208 (60%), Gaps = 4/208 (1%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           K  K   F    +S   L  +S   F + T IQR++IP+ L+  D++G A+TGSGKT AF
Sbjct: 36  KTAKTTFFKDLPISNATLKGLSEAAFLKLTDIQRESIPVSLKGYDVLGSAKTGSGKTLAF 95

Query: 169 ILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEE 226
           ++P++EKL  +  +   G  A+I+SP+RELAMQ ++V       T   + L+ GG  ++ 
Sbjct: 96  LIPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLIKIGSHTSFSAGLVIGGKDVKF 155

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           +   + S  ++++ TPGR L HL   + L+  +++  V DE+DR  +MGF++ L+ ++  
Sbjct: 156 ELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVGN 214

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           LP +RQTLLFSAT   SL D A+  LT+
Sbjct: 215 LPPSRQTLLFSATQSQSLADLARLSLTD 242

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q+AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  VI    P  +  ++HRVGR+AR G +G +  +++
Sbjct: 355 RGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKGKSLIMLT 398

>Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}
           YJL033W (HCA4) - putative RNA helicase [contig 246] FULL
          Length = 764

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 132/220 (60%), Gaps = 10/220 (4%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           + EY   TA+ N       F +  LS+     +    F + T IQ+K+IP+ L+  D++ 
Sbjct: 30  IEEYDPETAKGN------LFKNLPLSQHTQKGLRDSAFVKMTEIQQKSIPVSLKGHDLLA 83

Query: 157 LARTGSGKTAAFILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLR 214
            A+TGSGKT AF++P+IEKL  +  +   G  A+I+SP+RELAMQT++V     R +   
Sbjct: 84  AAKTGSGKTLAFLIPVIEKLYREKWTEFDGLGALIISPTRELAMQTYEVLTKIGRYSSFS 143

Query: 215 SVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEM 273
           + L+ GG  ++ +   + S  +++V TPGR L H+   + L+  +++  V DE+DR  +M
Sbjct: 144 AGLVIGGKDVKFELERI-SKINILVGTPGRILQHMDQAVGLNTSNVQVLVLDEADRCLDM 202

Query: 274 GFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           GF++ L+ +++ LP  RQTLLFSAT   SL D A+  LT+
Sbjct: 203 GFKKTLDAIVSNLPPVRQTLLFSATQSQSLADLARLSLTD 242

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P S   ++HRVGR+AR G +G +  +++
Sbjct: 353 RGIDFPAVDWVVQADCPESVDTYIHRVGRSARYGKQGKSLIMLT 396

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 131/222 (59%), Gaps = 14/222 (6%)

Query: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156
           V EY    A+ N       F    +S+  L  +    F + T IQR++IPL L+  D++G
Sbjct: 30  VEEYNPKIAKAN------LFQDLPISEQTLKGLKEAAFIKLTEIQRESIPLSLKGHDVLG 83

Query: 157 LARTGSGKTAAFILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLR 214
            A+TGSGKT AF++P+IEKL  +  +   G  A+I+SP+RELAMQ ++V     + T   
Sbjct: 84  AAKTGSGKTLAFLIPVIEKLYREKWTDMDGLGALIISPTRELAMQIYEVLSKIGKHTTFS 143

Query: 215 SVLLTGGD--SLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLF 271
           + L+ GG   + E++    +S  ++++ TPGR L H+   +  +  +++  V DE+DR  
Sbjct: 144 AGLVIGGKDVTFEKE---RISRINILIGTPGRILQHMDQAVGFNTSNLQLLVLDEADRCL 200

Query: 272 EMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           +MGF+  L+ ++  LP++RQTLLFSAT   SL D A+  LT+
Sbjct: 201 DMGFKRTLDAIINNLPASRQTLLFSATQSQSLDDLARLSLTD 242

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVA 352

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  VI    P     ++HRVGR AR G  G +  +++
Sbjct: 353 RGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEGKSLIMLT 396

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 191/413 (46%), Gaps = 78/413 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQSR--DIVGLARTGSGKTAAFILPMIEKL-- 176
           + K++  +ISR GF + T +Q+KTI  IL+ +  D++  A+TG+GKT AF++P+ + L  
Sbjct: 139 IDKMLHKSISRMGFPELTSVQQKTIKPILEDKENDVIARAKTGTGKTFAFLIPIFQHLIN 198

Query: 177 KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTH----LRSVLLTGGDSLEEQFGMMM 232
               S+   ++VI++P+R+LA+Q     +      +     + + L GG         M 
Sbjct: 199 TQFDSQYMVKSVIVAPTRDLALQIEAEVRKIHDNNYGLKKFQCISLVGGTDFRRAMDKMH 258

Query: 233 S-NPDVIVATPGRFLHLKVEMNLDLKS-IEYAVFDESDRLFEMGFEE---QLNELLAALP 287
              P++++ATPGR + +  +        +++ V DE+DRL E+GF+E   Q++E+L +L 
Sbjct: 259 KLRPNIVIATPGRLIDVMEKFGKKFFGWVDFKVLDEADRLLEIGFKEDLEQISEMLNSLN 318

Query: 288 SNRQ----TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST------- 336
            + +    TLLFSATL     D    GL N          +I    + LF+ T       
Sbjct: 319 GHSKDHIRTLLFSATL-----DEKVQGLAN----------QIMNKPKCLFIDTVDKNEPE 363

Query: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
            H++ E +L+ + +E      A  E IK                                
Sbjct: 364 THEKIEQSLV-VTKEFGHNIYAAIEHIK-------------------------------- 390

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKN--CGYL-VSYIYGSLDQRARNRQLYN 453
                  + P     ILF PT    ++I+ +L     G L V   +G + Q  R   +  
Sbjct: 391 ---AELLEDPKNYKAILFTPTVKFTKFISRILDRELRGKLRVLEFHGQISQSRRTNLVKE 447

Query: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRG 506
           F+     +LV TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G
Sbjct: 448 FKQDRPGLLVCTDVGARGMDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSG 500

>KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} similar
           to uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 514

 Score =  139 bits (350), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  SF  F L + +L  I   GF +P+PIQ + IP+ +  +DI+  A+ G+GKTAAF++P
Sbjct: 34  KGRSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIP 93

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 94  TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 151

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                ++V TPGR L L      DL      + DE+D++    F+    ++L  LP  RQ
Sbjct: 152 NEPVHILVGTPGRVLDLASRRVTDLSECHLFIMDEADKMLSRDFKVLAEQILGFLPERRQ 211

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
            LLFSAT P ++ +F    L NP  + L  E
Sbjct: 212 LLLFSATFPVTVKEFMVKHLKNPHEINLMDE 242

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 60/102 (58%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  +   G+   Y +  + Q  RN+  + FR G    LV +D+  RG
Sbjct: 277 IIFCNSTNRVELLAKKITELGFSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 336

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 337 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 378

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 127/201 (63%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   L  ++   F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSPPTLKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  +   G  A+++SP+RELAMQ ++V       T L + L+ GG  ++ +    +S
Sbjct: 103 LYREKWTEFDGLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLS 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             ++++ TPGR L HL   + L+  +++  V DE+DR  +MGF++ L+ +++ LP++RQT
Sbjct: 162 KINILIGTPGRILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLGDLARLSLTD 242

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q+AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  VI    P  +  ++HRVGR AR G +G +  +++
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKGKSLIMLT 398

>KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {ON}
           Anc_6.204 YGL078C
          Length = 511

 Score =  139 bits (349), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 121/217 (55%), Gaps = 6/217 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS+  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 101 SFSHVSLEGTIQKEISK--FPKPTPIQAASWPYLLAGKDVIGVAETGSGKTFAFGVPAIH 158

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
            L S S+K     +++SP+RELA Q +      +    L    + GG   +EQ   +  +
Sbjct: 159 SLVSSSNKKDISVLVISPTRELASQIYDNLIILTDKVGLECCCIYGGVPKDEQRKQLRRS 218

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP---SNRQ 291
             V+VATPGR L L  E +++L  ++Y V DE+DR+ E GFEE +  ++       +NRQ
Sbjct: 219 -QVVVATPGRLLDLIQEGSVNLSKVQYLVLDEADRMLEKGFEEDIKNIIKETNGNRANRQ 277

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           TL+F+AT P  + + A   + +PV V +    +++ N
Sbjct: 278 TLMFTATWPKEVRELASTFMRDPVKVSIGNRDELTAN 314

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     +   L+  GY V+ I+G L Q+ R + L +F+ G +S+L+ TDVAAR
Sbjct: 350 VLIFALYKKEAARVERNLRYNGYDVAAIHGDLSQQQRTQALNDFKQGKSSLLLATDVAAR 409

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 410 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGVAHTLFT 452

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  137 bits (345), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 109/198 (55%), Gaps = 8/198 (4%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K  +F S GLS+ +   +     +QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 5   KNATFKSLGLSRWLQEALQAMKINQPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAP 64

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
           M+ K     S  G   V+L+P+RELAMQ  + F       ++R  L+ GG+S+ +Q   +
Sbjct: 65  MLTKWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQL 122

Query: 232 MSNPDVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
              P  I+ATPGR  H  +    D    LK  ++ V DE+D L    F   L   + ALP
Sbjct: 123 QKKPHFIIATPGRLAHHIMSSGEDTIGGLKRAKFLVLDEADSLLTDTFASDLATCIGALP 182

Query: 288 S--NRQTLLFSATLPNSL 303
           S   RQTLLF+AT+ + +
Sbjct: 183 SKDKRQTLLFTATITDQV 200

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           + S I+FV      E +   L +    V+ ++  + Q+ R   L+ FRA +  +L+ TDV
Sbjct: 259 DSSAIIFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDV 318

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           A+RG+DIP +  VIN+  P+    F+HR GRTARAG  G A S ++
Sbjct: 319 ASRGLDIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAISFVT 364

>KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 553

 Score =  139 bits (351), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 124/216 (57%), Gaps = 5/216 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    LS  I   IS+  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 144 SFDQISLSSEIQEEISK--FPKPTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIH 201

Query: 175 KLKSHSSKV-GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
            LK+  +K  G + +++SP+RELA Q +      ++   +    + GG   +EQ   +  
Sbjct: 202 NLKTADAKSQGVQVLVISPTRELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKK 261

Query: 234 NPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQT 292
           +  V+VATPGR L L  E +  L +++Y V DE+DR+ E GFEE +  ++ +   + RQT
Sbjct: 262 S-QVVVATPGRLLDLIEEGSARLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQT 320

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           L+F+AT P  + + A   + +PV + +    ++S N
Sbjct: 321 LMFTATWPKEVRELANTFMDSPVKISIGNRDELSAN 356

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 66/102 (64%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 393 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAARG 452

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 453 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 494

>KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 764

 Score =  141 bits (356), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 122/201 (60%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   L  +    F + T IQ+ +IP+ L+  D++  A+TGSGKT AF++P+IEK
Sbjct: 43  FKDLPLSHQTLKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  +   G  A+I+SP+RELAMQT++V     R T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGKEVKFELDRI-S 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             +++V TPGR L H+   + L+  +++  V DE+DR  +MGF++ L+ ++  LP  RQT
Sbjct: 162 KINILVGTPGRILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPVRQT 221

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLADLARLSLTD 242

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P +   ++HRVGR+AR G +G +  +++
Sbjct: 353 RGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQGKSLVMLT 396

>Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  140 bits (354), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 183/420 (43%), Gaps = 78/420 (18%)

Query: 121 LSKLILNNISRKGFHQPTPIQRKTIPLILQS--RDIVGLARTGSGKTAAFILPMIEKLKS 178
           L K +   I+R  F   TP+Q+KTI  IL S   D++  A+TG+GKT AF++P+ + L +
Sbjct: 113 LDKELHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLIN 172

Query: 179 H--SSKVGARAVILSPSRELAMQTH---KVFKDFSRG-THLRSVLLTGGDSLEEQFGMMM 232
               S+   +AVI++P+R+LA+Q     K   D + G      V L GG         M 
Sbjct: 173 TKLDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYGCVSLVGGTDFRGAMDKMN 232

Query: 233 S-NPDVIVATPGRFLH-LKVEMNLDLKSIEYAVFDESDRLFEMGFEEQ-------LNELL 283
              P++I+ATPGR +  L+   N   + ++Y V DE+DRL E+GF +        LNE  
Sbjct: 233 KLRPNIIIATPGRLIDVLERYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 284 AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREA 343
           +    N +TLLFSATL + +   A               + I    E LFL T  D+ E 
Sbjct: 293 SKSTDNIKTLLFSATLDDKVQKLA---------------NNIMNKKECLFLDTV-DKNEP 336

Query: 344 ALLYLIQEVIQIP-------LATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXX 396
                I + + I         A  E IK                                
Sbjct: 337 EAHERIDQSVVISKKFADNIFAAVEHIK-------------------------------- 364

Query: 397 VRMPAANQLPSEKSTILFVPTRHHVEYIANLLKN---CGYLVSYIYGSLDQRARNRQLYN 453
                  +  S    I+F PT     ++  +L+N       +   +G + Q  R   +  
Sbjct: 365 ---KQITERESNYKAIIFAPTVKFTSFLCGILQNEFKKKLPILEFHGKITQNKRTSLVKR 421

Query: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           F+   + ILV TDV ARG+D P +  V+    PS    ++HR+GRTAR+G  G +   I 
Sbjct: 422 FKKEESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGASVLFIC 481

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  141 bits (356), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    +S   L  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FRDLPISDATLKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  +  +   G  A+I+SP+RELAMQ ++V       T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-S 161

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             +++V TPGR L H+   + L+  +++  V DE+DR  +MGF++ L+ +++ LP +RQT
Sbjct: 162 RINILVGTPGRILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQT 221

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLADLARLSLTD 242

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q AR   L  F       L+ TDV A
Sbjct: 294 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATDVVA 353

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P     ++HRVGR+AR G +G +  +++
Sbjct: 354 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRSARYGKQGKSLIMLT 397

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 124/202 (61%), Gaps = 6/202 (2%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    +S   L  ++   F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPISNSTLKGLNDSAFLKLTDIQRDSIPMSLKGYDILGAAKTGSGKTLAFLIPVLEK 102

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGM-MM 232
           L  +  +   G  A+I+SP+RELAMQ ++V       T   + L+ GG  +  +F M  +
Sbjct: 103 LYRERWTEFDGLGALIISPTRELAMQIYEVLLKIGTSTSFSAGLVIGGKDV--KFEMERI 160

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
           S  ++++ TPGR L H+   + L+  +++  V DE+DR  +MGF++ L+ +++ LP  RQ
Sbjct: 161 SKINILIGTPGRILQHMDQAIGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPTRQ 220

Query: 292 TLLFSATLPNSLVDFAKAGLTN 313
           TLLFSAT   SL D A+  LT+
Sbjct: 221 TLLFSATQSQSLEDLARLSLTD 242

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q+AR   L  F       L  TDV A
Sbjct: 297 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 356

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P     ++HRVGR AR G +G +  +++
Sbjct: 357 RGIDFPAIDWVVQVDCPEDVDTYIHRVGRCARYGKQGKSMIMLT 400

>Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  139 bits (349), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 148/253 (58%), Gaps = 17/253 (6%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F   K +LNN+   GF +PTPIQ + IP+ L +RDI+    TGSGKT AF+
Sbjct: 119 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQNECIPVALNNRDILACGPTGSGKTLAFL 178

Query: 170 LPMIEKLKSHSSKVGARAVILSPSRELAMQ--------THKVFKDFSRGTHLRSVLLTGG 221
           +P+++++       G + +I+SP++ELA Q        +HK+F +  R   +  +  + G
Sbjct: 179 IPLVQQIIDDKHTSGLKGLIISPTKELASQIFIECFKLSHKIFLEKKRPLQVALLSKSLG 238

Query: 222 DSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNE 281
             L+ +  +     D+I++TP R + +  +  LDL  +++ +FDE+D+LF+  F EQ ++
Sbjct: 239 AKLKNKV-ISDKKYDIIISTPLRLIDVVKKEALDLSRVKHLIFDEADKLFDKTFVEQSDD 297

Query: 282 LLAAL--PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHD 339
           +L+A   P+ R+  +FSAT+P+S+ + A++ + +P+ V +  +   + N+E   +   ++
Sbjct: 298 ILSACKEPALRKA-MFSATIPSSVEEIAQSIMMDPIRVIIGHKEAANTNIEQKLIFCGNE 356

Query: 340 E-REAALLYLIQE 351
           E +  A+  L+QE
Sbjct: 357 EGKLIAIRQLVQE 369

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%)

Query: 435 VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           V  I+       R+R +  F++G    L+ TDV ARG+D   +  VIN+  P SS+ +VH
Sbjct: 400 VDVIHAERTVLQRDRIIERFKSGELWCLICTDVLARGIDFKGVNLVINYDVPESSQAYVH 459

Query: 495 RVGRTARAGNRGWAYS 510
           R+GRT RAG  G A +
Sbjct: 460 RIGRTGRAGRSGKAVT 475

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 127/218 (58%), Gaps = 4/218 (1%)

Query: 99  EYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLA 158
           E   T  Q     K   F    LS  +L  +    + + T IQR +IP+ L+  D++G A
Sbjct: 24  EELHTKTQEFNNPKATYFQDLPLSNAVLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAA 83

Query: 159 RTGSGKTAAFILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216
           +TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ ++V           + 
Sbjct: 84  KTGSGKTLAFLIPVLEKLYRERWTEYDGVGALIISPTRELAMQIYEVLIKIGTHCSFSAG 143

Query: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGF 275
           L+ GG  ++ +    +S  ++++ TPGR L HL   + L++ +++  V DE+DR  +MGF
Sbjct: 144 LVIGGKDVKFE-AERISKINILIGTPGRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGF 202

Query: 276 EEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           ++ L+ +++ LP  RQTLLFSAT   SL D A+  LT+
Sbjct: 203 KKTLDAIVSNLPPIRQTLLFSATQSQSLNDLARLSLTD 240

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F  +   V ++    +    G  + +++G   QRAR   L  F       L+ TDV +
Sbjct: 290 IVFFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVS 349

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P +   ++HRVGR+AR G +G +  +++
Sbjct: 350 RGIDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQGKSLIMLT 393

>KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {ON}
           Anc_5.241 YJL033W
          Length = 762

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 132/224 (58%), Gaps = 9/224 (4%)

Query: 98  NEYFST----TAQTNKKHKKGSF-PSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSR 152
           NEY       T + + K ++ +F     L + +L  +S   F + T IQR++IP+ LQ  
Sbjct: 20  NEYIEELNKRTQEYDPKLQRATFFKDLPLCRNVLKGLSASAFVKLTAIQRESIPVSLQGH 79

Query: 153 DIVGLARTGSGKTAAFILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRG 210
           D++  A+TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ ++V       
Sbjct: 80  DVLAAAKTGSGKTLAFLVPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLVKVGSQ 139

Query: 211 THLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDR 269
               + L+ GG  ++ +    +S  ++++ TPGR L HL   + L+  +++  V DE+DR
Sbjct: 140 CSFSAGLVIGGKDVKYE-SERISKINILIGTPGRILQHLDQAVGLNASNLQMLVLDEADR 198

Query: 270 LFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTN 313
             +MGF++ L+ ++  LP  RQTLLFSAT   SL D A+  LT+
Sbjct: 199 CLDMGFKKTLDAIVGNLPPMRQTLLFSATQSASLADLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V +I    +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 IVFLSSGKQVHFIYETFRKMQPGISLMHLHGRQKQTARTDTLDKFVRAQQVCLFATDVVA 356

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P  +  ++HRVGR+AR G +G A  +++
Sbjct: 357 RGIDFPAVDWVVQVDCPEDADTYIHRVGRSARYGKKGKALIMLT 400

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 138/243 (56%), Gaps = 7/243 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS   +  I + GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 52  NFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 111

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +M
Sbjct: 112 LLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 171

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              ++++ATPGR L HL+       K+++  + DE+DR+ E+GFE+++ +++  LP+ +R
Sbjct: 172 KGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDR 231

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAALLY 347
           Q++LFSAT    + D A+  L   P+ + ++ E   S  + LE  ++    D+R   L  
Sbjct: 232 QSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFS 291

Query: 348 LIQ 350
            ++
Sbjct: 292 FLK 294

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           ++ ++ F  + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 298 KRKSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDV 357

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 358 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 401

>TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.124
           YGL171W
          Length = 551

 Score =  138 bits (348), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 194/407 (47%), Gaps = 83/407 (20%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F   K +LNN+    F +PTPIQ + IPL L +RDIV  A TGSGKT AF+
Sbjct: 111 GSFEDLITRFQFDKRLLNNLIENHFTEPTPIQSEGIPLALNNRDIVACAPTGSGKTLAFL 170

Query: 170 LPMIEKLKSHSSKV-GARAVILSPSRELAMQ--------THKVFKDFSRGTHLRSVLLTG 220
           +P+++ + S      G + +I+SP++ELA Q          KVF D  R   L+  LL+ 
Sbjct: 171 IPLLQLIISDGKDSNGLKGLIISPTKELANQIFIECSKLAQKVFLD--RKRPLQVALLSK 228

Query: 221 GDSLEEQF---GMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEE 277
             SL  +     +     D++V TP R + +     LDL  +++ +FDE+D+LF+  F E
Sbjct: 229 --SLNAKLKNKAVSDKKYDILVTTPLRLIDVVKNEALDLSGVKHIIFDEADKLFDKTFVE 286

Query: 278 QLNELLAAL--PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLS 335
           Q +++L++   P  R+++ FSAT+P+++ + A + + +PV V +  +   + N++     
Sbjct: 287 QTDDILSSCNNPKLRKSM-FSATIPSNVEEIANSIMMDPVRVIIGHKDAANANIK----- 340

Query: 336 TKHDEREAALLYLIQEVIQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXX 395
                         Q+VI       E+ KLI                             
Sbjct: 341 --------------QDVI---YCGNEEGKLI----------------------------- 354

Query: 396 XVRMPAANQLPSEKS----TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQL 451
                A  QL  E       I+F+ +    + + + L   G  V  I+    Q  R + +
Sbjct: 355 -----AIRQLVQEGEFRPPVIIFLESITRAKALYHELMYDGLNVDVIHAERTQIQREKII 409

Query: 452 YNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGR 498
            +F++G    L+ TDV ARGVD   +  VIN+  P +++ +VHR+GR
Sbjct: 410 ESFKSGELWCLICTDVLARGVDFKGVNLVINYDVPRTAQAYVHRIGR 456

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score =  138 bits (348), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 150/255 (58%), Gaps = 21/255 (8%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F   K +LNN+    F +PTPIQ + IP+ L  RDIV  A TGSGKT AF+
Sbjct: 125 GSFDDLITRFSFDKRLLNNLIDNHFTEPTPIQSEAIPIALLDRDIVACAPTGSGKTMAFL 184

Query: 170 LPMIEKLKSHSSKVGARAVILSPSRELAMQ--------THKVFKDFSRGTHLRSVLLTGG 221
           +P+++++      VG + +I+SP++ELA Q        +  +F  F +   L+  LL+  
Sbjct: 185 IPLLQQIIDEKKVVGLKGLIISPTKELANQIFLECVKLSRSIF--FEKKRPLQVALLSKS 242

Query: 222 DSLEEQFGMMMSNP--DVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
            S + +   ++SN   D+I++TP R + +    +LDL  +++ +FDE+D+LF+  F EQ 
Sbjct: 243 LSAKLK-NKVISNSKYDIIISTPLRLIDVVRNESLDLSKVKHLIFDEADKLFDKTFVEQT 301

Query: 280 NELLAAL--PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTK 337
           +++L++   P+ R++ +FSAT+P+S+ D A++ + +PV V +  +   + N+E   +   
Sbjct: 302 DDILSSCTDPALRKS-MFSATIPSSVEDIAQSLMNDPVRVVIGHKEAANSNIEQKLIFCG 360

Query: 338 HDE-REAALLYLIQE 351
           ++E +  A+  L QE
Sbjct: 361 NEEGKLIAIKQLTQE 375

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 46/77 (59%)

Query: 435 VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           V  I+       RN+ +  F++G    L+ TDV ARGVD   +  VIN+  P SS+ +VH
Sbjct: 406 VDVIHAERTTIQRNKIIERFKSGELWCLICTDVLARGVDFKGVNLVINYDVPRSSQAYVH 465

Query: 495 RVGRTARAGNRGWAYSI 511
           R+GRT RAG +G A ++
Sbjct: 466 RIGRTGRAGRKGKAITL 482

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 137/234 (58%), Gaps = 7/234 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS+  +  I + GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 38  TFKELNLSQQTVKAIEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
            L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   ++
Sbjct: 98  MLHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLV 157

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              ++++ATPGR L HL+       K+++    DE+DR+ E+GFE+++ +++  LP+ +R
Sbjct: 158 KGVNLLIATPGRLLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNEDR 217

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRLD--QESKISENLEMLFLSTKHDER 341
           Q++LFSAT    + D A+  L   P+ + +D  +E+   E LE  ++  + D+R
Sbjct: 218 QSMLFSATQTTKVEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCESDKR 271

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 284 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]
           {ON} similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 685

 Score =  139 bits (351), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/401 (27%), Positives = 185/401 (46%), Gaps = 68/401 (16%)

Query: 129 ISRKGFHQPTPIQRKTI-PLILQSRDIVGLARTGSGKTAAFILPMIEKLKSH--SSKVGA 185
           IS   F   TP+Q++TI P++    D+V  A+TG+GKT AF+ P+ + L S    + +  
Sbjct: 153 ISAMKFESLTPVQQRTIKPILTTENDVVAKAKTGTGKTLAFLAPLFQHLISTKLQNPLAV 212

Query: 186 RAVILSPSRELAMQTHKVFKDFSRGT----HLRSVLLTGGDSLEEQFGMMMS-NPDVIVA 240
           +AVI++P+R+LA+Q     K   +        RS+ L GG +L++    + + NP++IV 
Sbjct: 213 KAVIVTPTRDLAIQIASEVKKLQQCNPSLKSYRSLTLIGGTNLDKSLKDLHTLNPNIIVG 272

Query: 241 TPGRFLHLKVEMNLD-LKSIEYAVFDESDRLFEMGFEEQ-------LNELLAALPSNRQT 292
           TPGR   +   +     K +++ V DE+D L ++GF+ +       LNE       + +T
Sbjct: 273 TPGRINDILDRVGAKYFKDVDFKVLDEADTLLQIGFQTELSLISRKLNEFNTQGEEHIRT 332

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEV 352
           LLFSAT+ +++ + A               + I    + LF+ T       A   + Q++
Sbjct: 333 LLFSATMDHNVQELA---------------ATIMNKKDCLFIDTVDKNDSEAHDSIDQKL 377

Query: 353 IQIPLATEEQIKLIXXXXXXXXXXXXXXNGXXXXXXXXXXXXXXVRMPAANQLPSEKS-- 410
           +      E  + LI                                    ++L  +K+  
Sbjct: 378 VITKSFAESMVALI--------------------------------QSIESELLQKKNFK 405

Query: 411 TILFVPTRHHVEYIANLLKNC---GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
            ILF+PT   V++ +  L         +   +G +DQ+ R + +  F+     I V TDV
Sbjct: 406 AILFLPTVKFVDFFSETLSESLTKRIDIIKFHGKIDQKKRTKLVDRFKKTNHGIFVCTDV 465

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA 508
            ARG+  P + +V     P+S   ++HR+GRTARAG  G A
Sbjct: 466 GARGMHFPSVEHVYQLCVPTSLPNYIHRIGRTARAGESGAA 506

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 120/216 (55%), Gaps = 5/216 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS   F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 103 SFDELSLDSKIQAAISV--FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 160

Query: 175 KLKSHSSKV-GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           KL +   K  G + +++SP+RELA Q +           L    + GG    EQ    + 
Sbjct: 161 KLVTEDGKKKGVQVLVISPTRELASQIYDNMILLIEKADLECCCVYGGVPKYEQ-REKLK 219

Query: 234 NPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL-PSNRQT 292
              V+VATPGR L L  E ++DL ++ Y V DE+DR+ E GFEE +  ++ +   S+RQT
Sbjct: 220 KAQVVVATPGRLLDLMQEGSVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSSRQT 279

Query: 293 LLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           L+F+AT P  + + A   +++PV V +    ++S N
Sbjct: 280 LMFTATWPKEVRELASTFMSDPVKVSIGNRDELSAN 315

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 68/106 (64%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           ++  ++F   +     +   LK  GY V+ I+G L Q+ R++ L  F+ G +++L+ TDV
Sbjct: 348 DEKVLIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRSQALNEFKTGASNLLLATDV 407

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           AARG+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 408 AARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 453

>KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {ON}
           similar to uniprot|P39517 Saccharomyces cerevisiae
           YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
           mRNA decapping coordinates distinct steps in mRNA
           function and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 491

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 118/208 (56%), Gaps = 2/208 (0%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F  F L + +L  I   GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P +E
Sbjct: 30  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLE 89

Query: 175 KLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSN 234
           K+K   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +   
Sbjct: 90  KVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEP 147

Query: 235 PDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLL 294
             ++V TPGR L L      DL      V DE+D++    F+  + ++L  LP   Q+LL
Sbjct: 148 VHILVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLL 207

Query: 295 FSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           FSAT P ++ +F    L  P  + L  E
Sbjct: 208 FSATFPLTVKEFMVKHLHKPYEINLMDE 235

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (59%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q  RN+  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL078C (DBP3)
          Length = 535

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 119/219 (54%), Gaps = 11/219 (5%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L   I   IS+  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 126 SFSHLNLHSAIQKEISK--FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 183

Query: 175 KLKSH-SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGG---DSLEEQFGM 230
            L S  S+  G + +++SP+RELA Q +      +    L    + GG   DS  EQ   
Sbjct: 184 SLMSEKSTPRGVKCLVISPTRELASQIYDNLVQLTDKVGLNCCCVYGGVQKDSQREQ--- 240

Query: 231 MMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSN- 289
            +    V+VATPGR L L  E +  L  ++Y V DE+DR+ E GFEE +  ++    S+ 
Sbjct: 241 -LKKAQVVVATPGRLLDLIEEGSAKLAGVQYLVLDEADRMLEKGFEEDIKRIIKETKSDV 299

Query: 290 RQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           RQTL+F+AT P  + + A   +  PV V +    ++S N
Sbjct: 300 RQTLMFTATWPKEVRELASTFMRAPVKVSIGNRDELSAN 338

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 65/103 (63%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     +   LK  GY V+ I+G L Q+ R + L  F+AG  ++L+ TDVAAR
Sbjct: 374 VLIFALYKKEASRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTANLLLATDVAAR 433

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 434 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGATGVAHTLFT 476

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 139/242 (57%), Gaps = 7/242 (2%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   +  + + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE+
Sbjct: 23  FSGLNLSDATMKAVEKMGFSSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIER 82

Query: 176 LKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +  
Sbjct: 83  LHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKLAK 142

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQ 291
             ++++ATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ +RQ
Sbjct: 143 GVNMLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDDRQ 202

Query: 292 TLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDEREAALLYL 348
           ++LFSAT    + D A+  L   P+ + +  ++++  ++ LE  ++    D+R   L   
Sbjct: 203 SMLFSATQTTKVEDLARISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLFSF 262

Query: 349 IQ 350
           ++
Sbjct: 263 LK 264

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      IL+ TDV
Sbjct: 268 KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDV 327

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 328 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 371

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 143/262 (54%), Gaps = 28/262 (10%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F S  L  L++ NI    F++PTPIQ+ +IP++ Q RD++  A+TGSGKT AF+ P++ K
Sbjct: 359 FTSPPLDNLLVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSK 418

Query: 176 LKSHS-------------------SKVGARAV-----ILSPSRELAMQTHKVFKDFSRGT 211
             S                     SK  A+ +     IL+P+RELA Q  +  + FS  +
Sbjct: 419 AFSLGPSINNNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRS 478

Query: 212 HLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLF 271
            +R  ++ GG ++  Q   + +   ++VATPGR   L     + L +I+Y + DE+DR+ 
Sbjct: 479 WIRPCVVYGGTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRML 538

Query: 272 EMGFEEQLNELL----AALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISE 327
           +MGFE Q+ +++      + ++RQTL+FSAT P+++ + A   L + + + + +    ++
Sbjct: 539 DMGFELQIRQIVEHYDMPIATSRQTLMFSATFPSNIQNLAGDFLNDYIFLSVGKIGSTTD 598

Query: 328 NLEMLFLSTKHDEREAALLYLI 349
           N+       + +E++  LL L+
Sbjct: 599 NIIQHIYYVRQEEKDNTLLDLL 620

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 65/106 (61%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K T++FV T+   + + +LL   GY  + I+G   Q  R R L  F+    ++LV T V
Sbjct: 627 KKQTLIFVETKRSADALTDLLIIEGYKATAIHGDRTQLERERALTAFKTKRANVLVATSV 686

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           AARG+DIP +A+V+N+  P++   +VHR+GRT R GN G A S  +
Sbjct: 687 AARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIGMATSFFN 732

>Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar to
           Ashbya gossypii AFL080W
          Length = 554

 Score =  137 bits (345), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 121/218 (55%), Gaps = 7/218 (3%)

Query: 117 PSFGLSKLILNNISRK---GFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMI 173
           P    S + LNN  +K    F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +
Sbjct: 141 PLLSFSHISLNNEVQKVVAKFPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAV 200

Query: 174 EKLKSH--SSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
             + S   +S    + +I+SP+RELA Q +    + +    L    L GG   + Q  + 
Sbjct: 201 NNIVSSGDASNKNVQCLIISPTRELASQIYDNLVELTNKVSLNCCCLYGGVPKDAQ-RLQ 259

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALP-SNR 290
           + N  ++VATPGR L L  E   DL  ++Y V DE+DR+ E GFEE + +++     + R
Sbjct: 260 LKNSQIVVATPGRLLDLIQEGYADLSQVQYLVLDEADRMLEKGFEEDIKKIIKETDVTRR 319

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           QTL+F+AT P  + + A   + +PV + +    ++S N
Sbjct: 320 QTLMFTATWPKEVRELASTFMKHPVKISIGNRDELSAN 357

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 67/103 (65%)

Query: 411 TILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAAR 470
            ++F   +     +   L+  GY V+ I+G L Q+ R + L +F++G T++L+ TDVAAR
Sbjct: 393 VLIFALYKKEASRVERNLQYNGYNVAAIHGDLSQQQRTQALDDFKSGKTNLLLATDVAAR 452

Query: 471 GVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           G+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 453 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGASGTAHTLFT 495

>KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.204
           YGL078C
          Length = 533

 Score =  137 bits (344), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 112/197 (56%), Gaps = 3/197 (1%)

Query: 134 FHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKV-GARAVILSP 192
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   S  V G +A+I+SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVIGVAETGSGKTLAFGVPAVNHIIETSKTVSGIQALIISP 200

Query: 193 SRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEM 252
           +RELA Q +      +    L    + GG   +EQ  M +    ++VATPGR L L  E 
Sbjct: 201 TRELASQIYDNLIPLTDKVGLECCCVYGGVPKDEQ-RMKLRKCHIVVATPGRLLDLLQEG 259

Query: 253 NLDLKSIEYAVFDESDRLFEMGFEEQLNELL-AALPSNRQTLLFSATLPNSLVDFAKAGL 311
           +++L  + Y V DE+DR+ E GFEE +  ++    P  RQTL+F+AT P  + + A   +
Sbjct: 260 SVNLSKVNYLVLDEADRMLEKGFEEDIKNIIRETAPHGRQTLMFTATWPKEVRELAATFM 319

Query: 312 TNPVLVRLDQESKISEN 328
             PV V +    ++S N
Sbjct: 320 NQPVKVSIGNRDELSAN 336

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 65/106 (61%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           ++  ++F   +     +   LK  GY V  I+G L Q+ R   L  F+ G +++L+ TDV
Sbjct: 369 DEKVLIFALYKKEAARVERNLKYNGYNVVAIHGDLTQQQRTHALNEFKTGSSNLLLATDV 428

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           AARG+DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 429 AARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGVAHTLFT 474

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  135 bits (339), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 108/198 (54%), Gaps = 8/198 (4%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           K+ +F S GLSK +  ++S     QPT IQ   IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 5   KQETFKSLGLSKWLYESLSAMKITQPTAIQSACIPEILKGRDCIGGAKTGSGKTIAFAGP 64

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
           M+ K        G   V+L+P+RELAMQ  + F       ++R  ++ GG S+ EQ   +
Sbjct: 65  MLTKWS--EDPCGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQAIQL 122

Query: 232 MSNPDVIVATPGRFLHLKVEMNLD----LKSIEYAVFDESDRLFEMGFEEQLNELLAALP 287
            + P  I+ATPGR  H  +    D    LK  ++ V DE+D L    F   L   + ALP
Sbjct: 123 QNKPHFIIATPGRLAHHIMNSGEDTVGGLKRTKFLVLDEADSLLTDSFAGDLATCIGALP 182

Query: 288 --SNRQTLLFSATLPNSL 303
               RQTLLF+AT+ + +
Sbjct: 183 PKHKRQTLLFTATITDQV 200

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 61/106 (57%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           + S I+FV      E +   L +    V+ ++  + Q+ R   L+ FRA    +LV TDV
Sbjct: 259 DSSAIIFVNRAMTAEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDV 318

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           AARG+DIP++  VIN+  PS    F+HR GRTARAG  G A S ++
Sbjct: 319 AARGLDIPIVELVINYDIPSDPDTFIHRAGRTARAGRSGDAISFVT 364

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  136 bits (342), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 138/243 (56%), Gaps = 7/243 (2%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   L  I + GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP IE 
Sbjct: 41  FDELNLSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEM 100

Query: 176 LKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +  
Sbjct: 101 LHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLAK 160

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQ 291
             ++++ATPGR L HL+       K+++  V DE+DR+ E+GFE+++ +++  LP+ +RQ
Sbjct: 161 GVNLLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDRQ 220

Query: 292 TLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAALLYL 348
           ++LFSAT    + D A+  L   P+ + +D E + S  + LE  ++    D+R   L   
Sbjct: 221 SMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLFTF 280

Query: 349 IQE 351
           +++
Sbjct: 281 LKK 283

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 409 KSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVA 468
           K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDVA
Sbjct: 287 KKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVA 346

Query: 469 ARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           ARG+DIP +  +I F  P   + ++HRVGRTA+ G +G   S++
Sbjct: 347 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLM 389

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  135 bits (341), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 137/234 (58%), Gaps = 7/234 (2%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           +F    LS+  L  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 31  TFGELELSQPTLKAIDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 90

Query: 175 KLKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMM 232
           +L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   ++
Sbjct: 91  RLHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLV 150

Query: 233 SNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
              ++++ATPGR L HL+       K+++  + DE+DR+ E+GFEE++ +++  LP+ +R
Sbjct: 151 KGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQIIKILPNEDR 210

Query: 291 QTLLFSATLPNSLVDFAKAGL-TNPVLVRL--DQESKISENLEMLFLSTKHDER 341
           Q++LFSAT    + D A+  L   P+ + +  ++++   E LE  ++    D+R
Sbjct: 211 QSMLFSATQTTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCDSDKR 264

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      ILV TDV
Sbjct: 277 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVSTDV 336

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 337 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GAKGKGKSLM 380

>CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highly
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033w HCA4
          Length = 765

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 123/208 (59%), Gaps = 4/208 (1%)

Query: 109 KKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAF 168
           K +K   F    +SK  L  ++   F + T IQR +I   LQ  D+ G A+TGSGKT AF
Sbjct: 36  KNNKAVFFKDLPISKSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAF 95

Query: 169 ILPMIEKL--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEE 226
           ++P++EKL  +  +   G  A+I+SP+RELAMQ ++V       T   + L+ GG  +  
Sbjct: 96  LVPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNF 155

Query: 227 QFGMMMSNPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAA 285
           +   + +  ++++ TPGR L H+   + L+  +++  V DE+DR  +MGF++ L+ ++  
Sbjct: 156 ELERI-AKINILIGTPGRILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGN 214

Query: 286 LPSNRQTLLFSATLPNSLVDFAKAGLTN 313
           LP +RQTLLFSAT   S+ D A+  LT+
Sbjct: 215 LPPDRQTLLFSATQSQSISDLARLSLTD 242

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F  +   V ++    +    G  + +++G   QRAR   L  F       L  TDV A
Sbjct: 291 IVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQVCLFATDVVA 350

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  VI    P     ++HRVGR AR G +G +  I++
Sbjct: 351 RGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSLIILT 394

>SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 549

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 121/218 (55%), Gaps = 7/218 (3%)

Query: 115 SFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIE 174
           SF    L+  I   IS+  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 138 SFEHISLTSEIQQEISK--FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 195

Query: 175 KLKSHSS---KVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            + + S        + +++SP+RELA QT+      +    L+S  + GG   +EQ    
Sbjct: 196 NIVTSSEGRKTKNVQVLVVSPTRELASQTYDNLVLLTDKVGLQSCCVYGGVPKDEQ-RYQ 254

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NR 290
           +    V+VATPGR L L  E ++DL  + Y V DE+DR+ E GFEE +  ++    + NR
Sbjct: 255 LKRSQVVVATPGRLLDLIQEGSVDLSHVNYLVLDEADRMLEKGFEEDIKRIIRETDARNR 314

Query: 291 QTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISEN 328
           QTL+F+AT P  + + A   +  PV V +    +++ N
Sbjct: 315 QTLMFTATWPKEVRELASTFMNQPVKVSIGNRDELTAN 352

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 66/102 (64%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           ++F   +     +   LK  GY V+ I+G L Q+ R + L  F++G +++L+ TDVAARG
Sbjct: 389 LIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 448

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DIP +  VIN +FP + + +VHR+GRT RAG  G A+++ +
Sbjct: 449 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 490

>Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL160C
           (DHH1) - (putative) DEAD box RNA helicase [contig 161]
           FULL
          Length = 513

 Score =  135 bits (340), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 112 KKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILP 171
           +  +F  F L + +L  I   GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P
Sbjct: 27  RGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVIP 86

Query: 172 MIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMM 231
            +EK++   +K+  +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +
Sbjct: 87  TLEKVRPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRL 144

Query: 232 MSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQ 291
                V+V TPGR L L      DL      V DE+D++    F+  + ++L  LP   Q
Sbjct: 145 NEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQ 204

Query: 292 TLLFSATLPNSLVDFAKAGLTNPVLVRLDQE 322
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 205 SLLFSATFPLTVKEFMVKHLHKPYEINLMDE 235

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (59%)

Query: 412 ILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARG 471
           I+F  + + VE +A  + + GY   Y +  + Q  RN+  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 472 VDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           +DI  +  VINF FP +++ ++HR+GR+ R G+ G A ++I+
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}
           ROK1RNA-dependent ATPase; involved in pre-rRNA
           processing at sites A0, A1, and A2, and in control of
           cell cycle progression; contains two upstream open
           reading frames (uORFs) in 5' untranslated region which
           regulate translation
          Length = 564

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 150/255 (58%), Gaps = 21/255 (8%)

Query: 114 GSFPS----FGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFI 169
           GSF      F   K +LNN+   GF +PTPIQ + IP+ L +RD++    TGSGKT AF+
Sbjct: 118 GSFEDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFL 177

Query: 170 LPMIEKLKSHSSKVGARAVILSPSRELAMQ--------THKVFKDFSRGTHLRSVLLTGG 221
           +P+++++       G + +I+SP++ELA Q        ++K+F +  R   +  +  + G
Sbjct: 178 IPLVQQIIDDKQTAGLKGLIISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLG 237

Query: 222 DSLEEQFGMMMSNP--DVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQL 279
             L+ +   ++S+   D+I++TP R + +     LDL  +++ +FDE+D+LF+  F EQ 
Sbjct: 238 AKLKNK---VVSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQS 294

Query: 280 NELLAAL--PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTK 337
           +++L+A   PS R+  +FSAT+P+++ + A++ + +PV V +  +   + N+E   +   
Sbjct: 295 DDILSACREPSLRKA-MFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFCG 353

Query: 338 HDE-REAALLYLIQE 351
           ++E +  A+  L+QE
Sbjct: 354 NEEGKLIAIRQLVQE 368

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 435 VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494
           V  I+       R+R +  F+ G    L+ TDV ARG+D   +  VIN+  P SS+ +VH
Sbjct: 399 VDVIHAERTALQRDRIIERFKTGELWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 458

Query: 495 RVGR 498
           R+GR
Sbjct: 459 RIGR 462

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 136/242 (56%), Gaps = 7/242 (2%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    LS   L  I + GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE 
Sbjct: 46  FQDLTLSPPTLKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEL 105

Query: 176 LKSHSSKV--GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L S   K   G   ++++P+RELA+Q   V ++          ++ GG +  ++   +M 
Sbjct: 106 LHSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMK 165

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPS-NRQ 291
             ++++ATPGR L HL+       K+++  + DE+DR+ E+GFE+++ +++  LP+ +RQ
Sbjct: 166 GVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQ 225

Query: 292 TLLFSATLPNSLVDFAKAGL-TNPVLVRLDQESKIS--ENLEMLFLSTKHDEREAALLYL 348
           ++LFSAT    + D A+  L   P+ + +  E   S  + LE  ++    D+R   L   
Sbjct: 226 SMLFSATQTTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVCDSDKRFLLLFSF 285

Query: 349 IQ 350
           ++
Sbjct: 286 LK 287

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 408 EKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDV 467
           +K  I+F+ + + V+Y A LL      V  ++G   Q+ R    + F      IL+ TDV
Sbjct: 291 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICTDV 350

Query: 468 AARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSII 512
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 351 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 394

>TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.241
           YJL033W
          Length = 775

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 116 FPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEK 175
           F    +S   L  +    F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 44  FKDLPISNATLRGLKEASFVKLTEIQKNSIPISLKGYDVLGAAKTGSGKTLAFLIPVLEK 103

Query: 176 L--KSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMS 233
           L  ++ +   G  A+I+SP+RELA+Q ++V       T   + L+ GG  ++ +    +S
Sbjct: 104 LYRENWTEFDGLGALIISPTRELAIQIYEVLLKIGSRTSFSAGLVIGGKDVKFE-SERIS 162

Query: 234 NPDVIVATPGRFL-HLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQT 292
             ++++ TPGR L H+   + L+L +++  V DE+DR  +MGF++ L+ ++  LP +RQT
Sbjct: 163 RINILIGTPGRILQHMDQAVGLNLNNLQMLVLDEADRCLDMGFKKTLDAIVNNLPISRQT 222

Query: 293 LLFSATLPNSLVDFAKAGLTN 313
           LLFSAT   SL D A+  LT+
Sbjct: 223 LLFSATQSQSLDDLARLSLTD 243

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 412 ILFVPTRHHVEYIANLLKNC--GYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAA 469
           I+F+ +   V ++    +    G  + +++G   Q+AR   L  F       L  TDV A
Sbjct: 296 IIFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 355

Query: 470 RGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513
           RG+D P +  V+    P     ++HRVGR AR G +G +  +++
Sbjct: 356 RGIDFPSVDWVVQVDCPEDVDTYIHRVGRCARYGKQGKSLIMLT 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,228,459
Number of extensions: 3752339
Number of successful extensions: 16518
Number of sequences better than 10.0: 641
Number of HSP's gapped: 15540
Number of HSP's successfully gapped: 1130
Length of query: 968
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 849
Effective length of database: 39,836,145
Effective search space: 33820887105
Effective search space used: 33820887105
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)