Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D045903.164ON37637618090.0
ZYRO0B04862g3.164ON4082855532e-66
Kwal_33.141793.164ON3742774195e-47
SAKL0C07392g3.164ON3613674002e-44
KLTH0F06512g3.164ON3702813574e-38
NCAS0I020703.164ON4232953333e-34
Suva_4.2223.164ON4163022964e-29
Skud_4.2243.164ON4082542902e-28
Smik_4.2083.164ON4172542762e-26
YDL027C3.164ON4202462603e-24
KAFR0F022103.164ON3572812213e-19
TPHA0P006703.164ON3802812118e-18
Kpol_1045.433.164ON3822491824e-14
KLLA0C03872g3.164ON3762881584e-11
KNAG0K017303.164ON329267870.023
CAGL0K01639g3.164ON403205760.71
KNAG0B063604.291ON1453109751.0
TBLA0E027305.599ON37058741.1
Smik_8.1695.393ON64365712.9
Ecym_26457.80ON1089110713.4
TDEL0C044902.232ON250669695.7
Suva_7.958.111ON42681677.6
KAFR0L018207.403ON53575679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04590
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   701   0.0  
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   217   2e-66
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...   166   5e-47
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   158   2e-44
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   142   4e-38
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...   132   3e-34
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   118   4e-29
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   116   2e-28
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   110   2e-26
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   104   3e-24
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...    90   3e-19
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    86   8e-18
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    75   4e-14
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    65   4e-11
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    38   0.023
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    34   0.71 
KNAG0B06360 Chr2 (1253588..1257949) [4362 bp, 1453 aa] {ON} Anc_...    33   1.0  
TBLA0E02730 Chr5 complement(682336..683400,683535..683582) [1113...    33   1.1  
Smik_8.169 Chr8 complement(261548..263479) [1932 bp, 643 aa] {ON...    32   2.9  
Ecym_2645 Chr2 complement(1247120..1250389) [3270 bp, 1089 aa] {...    32   3.4  
TDEL0C04490 Chr3 complement(801727..809247) [7521 bp, 2506 aa] {...    31   5.7  
Suva_7.95 Chr7 (182109..183389) [1281 bp, 426 aa] {ON} YGL169W (...    30   7.6  
KAFR0L01820 Chr12 (334399..336006) [1608 bp, 535 aa] {ON} Anc_7....    30   9.7  

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/376 (92%), Positives = 346/376 (92%)

Query: 1   MNANLQLRIRLGLNVLSPSRHSRAFSLLARPTLLDSPAKTTNPPWVQRYRQVSACRSLTL 60
           MNANLQLRIRLGLNVLSPSRHSRAFSLLARPTLLDSPAKTTNPPWVQRYRQVSACRSLTL
Sbjct: 1   MNANLQLRIRLGLNVLSPSRHSRAFSLLARPTLLDSPAKTTNPPWVQRYRQVSACRSLTL 60

Query: 61  TRHSPYVRPLSFVGNRLFHTTTXXXXXXXXXXXXFKVYRISPIVAVLTGIGFLMLXXXXX 120
           TRHSPYVRPLSFVGNRLFHTTT            FKVYRISPIVAVLTGIGFLML     
Sbjct: 61  TRHSPYVRPLSFVGNRLFHTTTPRYMPPYPNQPPFKVYRISPIVAVLTGIGFLMLLFAVL 120

Query: 121 XXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIV 180
                        GICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIV
Sbjct: 121 PFIFTFFFPLIIAGICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIV 180

Query: 181 RLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFL 240
           RLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFL
Sbjct: 181 RLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFL 240

Query: 241 GDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALL 300
           GDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALL
Sbjct: 241 GDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALL 300

Query: 301 QGLFEGTNGANYLEFLSSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDS 360
           QGLFEGTNGANYLEFLSSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDS
Sbjct: 301 QGLFEGTNGANYLEFLSSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDS 360

Query: 361 KEDSDGHTEYTVKSNN 376
           KEDSDGHTEYTVKSNN
Sbjct: 361 KEDSDGHTEYTVKSNN 376

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  217 bits (553), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 175/285 (61%), Gaps = 4/285 (1%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRH 155
           +V++ISP+V  L  IG L +                  GI  YQF KWK   LF  +L  
Sbjct: 124 RVFKISPLVIFLASIGALTVFFLILPFMLTFFLPLFVVGISVYQFRKWKNNTLFDQLLNG 183

Query: 156 LKTSTMKVNYNTVKALHVKSLDKIVRLEQQ-NAKVFEDLLKSFDADLRAR---LDKFSSA 211
           LK S M++N  T+ A++VKS+ K     Q  NA VFE++ K  DA ++      +  + +
Sbjct: 184 LKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVS 243

Query: 212 KADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGE 271
           +AD+LL F+  R++EAI+++EQGIR YFLGDDV  W+++ Y  EL ++  ++  +    E
Sbjct: 244 EADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGFKNE 303

Query: 272 LIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIA 331
           +I  +V+P+YLKS+++P++HLA+VS+A+LQG     N  ++    +++   +A+C M I+
Sbjct: 304 IIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAIS 363

Query: 332 VQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTVKSNN 376
           V+  ++   K FVI   G SGD+++KYD  E+SDGHTEYT+++ +
Sbjct: 364 VKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIRNTD 408

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score =  166 bits (419), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 148/277 (53%), Gaps = 6/277 (2%)

Query: 95  FKVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILR 154
           FK  RISPI  +L  +G + L                  G+  +QF KWK   L Q + R
Sbjct: 99  FKTVRISPIFGILAFLGSISLVFIVVPFVFTFFFPLIIAGVAVFQFKKWKSATLMQQLHR 158

Query: 155 HLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKAD 214
            L TS M+++ +T+  L  +  + ++  E+ +A  F   +   D   R   D    + AD
Sbjct: 159 RLLTSKMRIDRHTILGLQARMFESLLGSERNSAIFFRRAMD--DMSARQMDDTSFKSGAD 216

Query: 215 KLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIM 274
            ++ F+D R+LEA ++NEQGIR+YFLG DV  WVE+ Y+L LD+   +T  +  +G  +M
Sbjct: 217 DMISFLDSRILEAFKSNEQGIRDYFLGADVKTWVENGYELSLDSDSPRTIGKSIEGTFVM 276

Query: 275 LLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETD-AECQMVIAVQ 333
            + +PLYL S++  +K LA+V++A+L    + T G     FL   +  D  +C MVI+++
Sbjct: 277 TITYPLYLLSSNQRKKLLADVTVAVLG---DSTPGKPSPFFLMQENFADNKDCPMVISIK 333

Query: 334 PVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEY 370
           P    +T  F++     +G+  S+Y  K  SDGH E+
Sbjct: 334 PARALNTNQFILDETDDNGNHPSRYTVKTTSDGHREF 370

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 174/367 (47%), Gaps = 17/367 (4%)

Query: 10  RLGLNVLSPSRHSRAFSLLARPTLLDSPAKTTNPPWVQRYRQVSACRSLTLTR-HSPY-- 66
           RLGLNV   S   R  + L+R   L SP         +R + V       + R H P   
Sbjct: 5   RLGLNVFKSSLTPRPAAPLSR--TLVSPLVAIG----RRLQMVPQTAGAGVIRYHDPRAP 58

Query: 67  VRPLSFVGNRLFHT-TTXXXXXXXXXXXXFKVYRISPIVAVLTGIGFLMLXXXXXXXXXX 125
           +R L+ + +R  HT                  +R SP V    G+G L            
Sbjct: 59  IRNLNMLLSRNLHTHPPRRTPFRPGPRPTIAPFRTSPWVMFFAGVGLLSALFVVLPLVFT 118

Query: 126 XXXXXXXXGICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQ 185
                   G+ AYQF +W+   L+  + R L+T+ + V Y +++ L+  +L  I+  ++ 
Sbjct: 119 LFFPLVVAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRA 178

Query: 186 NAKVFEDLLKSFDA-DLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDV 244
            A++F+ ++      D+    D+    ++ +LL F++ R+LE+I  NE G+R +FLG DV
Sbjct: 179 GAELFDTVVNGRKMRDMWG--DENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDV 236

Query: 245 GRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLF 304
             W+ D Y L+LDT    T  +   G+L M + +PLYL S++N R+ LA+VS+  L    
Sbjct: 237 DSWIRDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTN-RRKLADVSIVFLDERL 295

Query: 305 EGTNGANYLEFLSSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDS 364
              +G         ++  D  C MVI++ PV     + F+IST G SG+  S+   +   
Sbjct: 296 AAGSG---FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTR 352

Query: 365 DGHTEYT 371
           DGH EYT
Sbjct: 353 DGHREYT 359

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  142 bits (357), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 140/281 (49%), Gaps = 7/281 (2%)

Query: 95  FKVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILR 154
           FK+Y   P++ ++  IG + L                  GI  +QF +W+   L   + R
Sbjct: 89  FKLYTFPPLLGIVALIGTIALLLVVLPLVFTFLFPLIIAGIAVFQFKRWQNTTLLGQLHR 148

Query: 155 HLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAK-A 213
            L  + M +NY TV  L  +  + ++  +   A  F  ++   D     ++D  +S + A
Sbjct: 149 CLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSFRGVM---DEIRSQKIDAANSKRRA 205

Query: 214 DKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELI 273
           D+ L F+D R+LEA + NE G+R++FLG D   WV+  Y L L T   +   Q  +  L+
Sbjct: 206 DEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLV 265

Query: 274 MLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIAVQ 333
           M + +PLYL S+S  RK +A V++ +L     G  G+   +F+  ++  + EC MVI+++
Sbjct: 266 MTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQTGS--FKFVEELASQNKECPMVISIR 323

Query: 334 PVTNFSTKLFVISTDGRS-GDWYSKYDSKEDSDGHTEYTVK 373
           P  +   K FV+   G + G   S Y  +   DGH E+T +
Sbjct: 324 PARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYR 364

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score =  132 bits (333), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 152/295 (51%), Gaps = 32/295 (10%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRH 155
           K+ RI  I+ + + +G L++                  GI  +QF KWK+  L++ +L H
Sbjct: 143 KIIRIPSILLIFSSLGILIITLMILPLLISAFFPFLILGIALFQFRKWKQNTLYKQLLAH 202

Query: 156 LKTST---MKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDAD-LRARLDKFSSA 211
           LK  +   M + Y+T+ +L  K L+ I  ++           + F  D L  +++ F ++
Sbjct: 203 LKNKSKGHMSIKYSTLNSLQYKILNDISFMKNS---------QGFKPDILNMKMNDFINS 253

Query: 212 KA---DKLLRFIDDRLLEAIETNEQGIRNYFLG-----DDVGRWVEDNYQLELDTTQYKT 263
            A   + LL  +  R++EAIET+E GIR YFLG     ++V  WV +    ELDT    +
Sbjct: 254 NARDSEALLNLLQSRIMEAIETDELGIRTYFLGAADNINNVTHWVNEGLDFELDTKNSIS 313

Query: 264 NAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETD 323
             ++ +GE+I+ + + LYLKS  +P++ +A VS+ +L    E     +    ++ +++T+
Sbjct: 314 KGKLVNGEMILSVTYALYLKSLKSPKRRIAEVSIVVLD---ESVEKNHVFISINDLAKTN 370

Query: 324 AECQMVIAVQPV-TNFSTKL----FVISTDGRSGDWYSKYDSKEDSDGHTEYTVK 373
             C MV A++PV  + S  L    F++   GRSG  Y  Y++K    G+ E+ ++
Sbjct: 371 KSCPMVFAIKPVKIDLSLLLQPFQFILDDYGRSGSNYDVYNTK---SGNREFRLR 422

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  118 bits (296), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 145/302 (48%), Gaps = 30/302 (9%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAY----QFSKWKRKVLFQD 151
           K+Y++SP++ + T +                        +  +    QF +W++ V ++D
Sbjct: 120 KIYKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQFKRWQKNVFYKD 179

Query: 152 ILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSA 211
           IL  L  + +K+   T+++L ++ + +  +       +  +  K  + DL  +       
Sbjct: 180 ILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQ-----DE 234

Query: 212 KADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGE 271
              + L F++ R+LE+   NE GIR+YFLGD+V +W++++Y LELD    ++  +     
Sbjct: 235 TRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDS 294

Query: 272 LIMLLVFPLYLKSNS----NP------RKHLANVSLALLQGLFE-------GTNGANYLE 314
           +   + + LYL S      NP      +KHLA+V + +L   F        G + A++ +
Sbjct: 295 IFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFK 354

Query: 315 FLSSISETDAECQM---VIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYT 371
            L   SET    +M   +IAV+ V    +  F+I+  G SGD++SKY   +    HTEYT
Sbjct: 355 ILQE-SETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYT 413

Query: 372 VK 373
           ++
Sbjct: 414 LR 415

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  116 bits (290), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 129/254 (50%), Gaps = 24/254 (9%)

Query: 139 QFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFD 198
           QF KW++ + ++DIL  L  + +K+   T+++L ++ + +  +       +  +  K  +
Sbjct: 159 QFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLN 218

Query: 199 ADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDT 258
            DL  +     +    + L F+  R+LE+   NE G+R+YFLGD+V +W+E++Y LELD 
Sbjct: 219 VDLVKQ-----NETRKQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDI 273

Query: 259 TQYKTNAQVGDGELIMLLVFPLYLKSNSNP----------RKHLANVSLALLQGLFE--- 305
              ++  +     +   + + LYL S  N           ++H+A+V + +L   F    
Sbjct: 274 DSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIM 333

Query: 306 ----GTNGANYLEFL--SSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYD 359
               G + A++ + L  S  + +     M+IA++ V    +K FVI+  G SGD++SKY 
Sbjct: 334 FNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQ 393

Query: 360 SKEDSDGHTEYTVK 373
                  HTEYT++
Sbjct: 394 ISNVDGSHTEYTLR 407

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 129/254 (50%), Gaps = 25/254 (9%)

Query: 139 QFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFD 198
           QF KW+    ++DIL  L  + +K+   T+++L ++ + +  R       +  +  K  +
Sbjct: 169 QFKKWQNNTFYKDILISLPKTELKITVPTMRSLQLQPMIQSWREISSRMGIPNEFAKGLN 228

Query: 199 ADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDT 258
            DL  +          + L F+  R+LE+   NE GIR+YFLGD V +W+E++Y LELD 
Sbjct: 229 VDLEKQ-----DETRKQFLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLELDI 283

Query: 259 TQYKTNAQVGDGELIMLLVFPLYLKSNS----NP------RKHLANVSLALLQGLF---- 304
              ++  +     +   + + LYL S      NP      +KH+A+V + +L   F    
Sbjct: 284 DNCRSELRKFQNFVFSSVRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFPEIM 343

Query: 305 ---EGTNGANYLEFL--SSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYD 359
              EG + A++ + L  S  + +     M+IA++ V   S+  FVI+ +G SG+++SKY 
Sbjct: 344 FSGEGYSKADFFKILRESETANSSKMLNMIIAIKSVNPLSSH-FVITANGDSGNFFSKYH 402

Query: 360 SKEDSDGHTEYTVK 373
             +    +TEYT++
Sbjct: 403 ITKIDGKNTEYTLR 416

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 126/246 (51%), Gaps = 24/246 (9%)

Query: 147 VLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLD 206
           + ++D+L  L  + +K+   T+++L ++ + +  +       +  +  K  + DL  + +
Sbjct: 179 IFYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEE 238

Query: 207 KFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQ 266
                   + L F+  R+LE+   NE GIR+YFLGD V +W++++Y LELD    ++  +
Sbjct: 239 T-----RKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELR 293

Query: 267 VGDGELIMLLVFPLYLKSNSN----------PRKHLANVSLALLQGLFEGT--NGANY-- 312
                +   + + LYL S  N           +KH+A+V + +L   F     NG  Y  
Sbjct: 294 KFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSK 353

Query: 313 LEFLSSISETDAE-----CQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGH 367
            +F   + E++          +IA++ V    +K FVI+T+G SG+++SKY+  + +D +
Sbjct: 354 ADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKN 413

Query: 368 TEYTVK 373
           TEYT+K
Sbjct: 414 TEYTLK 419

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 131/281 (46%), Gaps = 32/281 (11%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRH 155
           ++YRI+ +  +L     L+L                  GI  YQ+  WKR  LF  I R 
Sbjct: 102 RIYRITTLNLLLGSAVVLLLSTMILPILLKLIFPMIILGIFIYQYRIWKRTKLFDQIFRG 161

Query: 156 LKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSF--DADLRARLDKFSSAKA 213
           L  + + + Y T+ +L    + KI++         + + KS+  + D+         + A
Sbjct: 162 LGRTNLSIKYKTLNSLQYNYVPKILK---------KSVPKSWYTNEDI---------SDA 203

Query: 214 DKLLRFIDDRLLEAIETNEQGIRNYFL--GDDVGRWVEDNYQLELDTTQYKTNAQVGDGE 271
           + LL FI  R++EA + NE GI +YFL  G +      D+  L +D    +   +   G 
Sbjct: 204 EILLSFIKLRVIEAFKKNEMGISDYFLRRGQNF-----DDLSLLIDKENSQFLIRRLAGN 258

Query: 272 LIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIA 331
            I+ +   L LK N N   +LA+V +++L    + ++       L  +++++  C+MVI+
Sbjct: 259 FIVTMRHQLLLK-NENVDIYLADVMISVL----DDSSQTGIFMPLKELAKSNKSCKMVIS 313

Query: 332 VQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTV 372
           V   ++   + FVI+ +G +G +Y K+      DGH E+ +
Sbjct: 314 VVSNSDILPRQFVITDEGETGKFYGKFTVSHGKDGHREFRI 354

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 123/281 (43%), Gaps = 18/281 (6%)

Query: 97  VYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRHL 156
           ++R++P+   L  + F ++                  G   +Q+ KW+     +  +  L
Sbjct: 113 IFRLTPMKIFLFALTFYVMIFLLVPFILSILLPAAILGYAFFQYRKWRLNCALKLWVNSL 172

Query: 157 KTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLD---KFSSAKA 213
             + M   ++T   L    ++ + +     ++VF           RA  D     S+  +
Sbjct: 173 MKTQMHTKFSTFNGLRYSIINSVEK--DARSQVFGFTNTPNGPIFRAMNDMTRDLSTEAS 230

Query: 214 DKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRW-VEDNYQLELDTTQYKTNAQVGDGEL 272
           DK  +FI+ R+LEA  ++E G+R+    D   +  ++ +  L ++  +    + V   + 
Sbjct: 231 DKFKKFIEARVLEAFVSDEDGVRSALASDHTWKQAIKTSRPLGIEFGRMVERSFVARDKK 290

Query: 273 IMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIAV 332
            M   FPL + S S  + HL  VS+     L  G N  +               ++++ +
Sbjct: 291 YMTYAFPLSINSPSGSQSHLGRVSIVACHPLSAGFNPPD-----------KTNLKLILCI 339

Query: 333 QPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTVK 373
           +  +  S  LF+I T+G +G+++SKYD ++  D HTEYTVK
Sbjct: 340 ESNSKLSPDLFIIDTNGMTGEFFSKYDVQKFKD-HTEYTVK 379

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 112/249 (44%), Gaps = 19/249 (7%)

Query: 135 ICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQN----AKVF 190
           I  +QF +W+   +       LK S ++   +T+ A+H K+L++++  E +       +F
Sbjct: 140 IGFHQFKRWRANRMINKWFDGLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSYGGIF 199

Query: 191 EDLLKSFDADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIR-----NYFLGDDVG 245
            + L +   +   +     +   +KL  FI+ R++EAI  NE+GIR     NY    D  
Sbjct: 200 NETLNAMKMNPMYKNSIEFNESGEKLRNFIEYRVIEAIYKNEEGIRTTLFHNYEKALDPN 259

Query: 246 RWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFE 305
             ++  ++L+ +        +  DG LI  + +PLY      P   +  VS+  +     
Sbjct: 260 --IDKPFRLDFNNVNSFQRFE-KDGSLISSVTYPLYTNLKDKPAVVVGYVSIVTMNDHPL 316

Query: 306 GTNGANYLEFLSSISETD--AECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKED 363
             N  +       I + D   + + +I+++  +      F+I T G +G  +S Y   + 
Sbjct: 317 RINLGS-----GDIPKVDLSKKLKFIISIRSPSEMIPNYFIIDTVGETGKIFSHYSVGKT 371

Query: 364 SDGHTEYTV 372
           +DGH EYT+
Sbjct: 372 TDGHNEYTL 380

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 117/288 (40%), Gaps = 26/288 (9%)

Query: 97  VYRISP---IVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDIL 153
           ++ ISP   I++ L   GF+ +                  GI  YQF  ++ + L Q + 
Sbjct: 106 IFSISPFSFILSTLLFAGFITMIVFVLPFLLALLFPMVIFGIGWYQFKAFRTRKLMQLLD 165

Query: 154 RHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDL--LKSFDADL-RARLDKFSS 210
                + MK++  T + L +K +           K F  L     F   L +A  DKF S
Sbjct: 166 HAFNQTKMKLSSTTRRELIMKQM-------VPKFKSFTQLKDFSGFPFKLSQAFTDKFQS 218

Query: 211 AK---ADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQV 267
            +   AD+ L F+  RL E+   NE  I++  LG D   +V  +  +EL T  Y   + V
Sbjct: 219 GEFPNADRFLSFVKSRLDESFYKNEHNIKSIVLGSDTA-YVPGH--MELVTNSYSFVSSV 275

Query: 268 GDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQ 327
            + E I    F L    +   RK +A V +       +   G   L F     +      
Sbjct: 276 RNNENIQAFSFMLLNMGSEGVRKPVALVYIVT-----KANPGDELLMFTGDYIDDSKLSP 330

Query: 328 MVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTVKSN 375
           MVI V+ ++ FS   F+  TD       ++Y  K   DG  EYT +S+
Sbjct: 331 MVIYVRALSPFSKCCFI--TDVGETGANAQYSVKRKKDGSKEYTYESD 376

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 102/267 (38%), Gaps = 44/267 (16%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRH 155
           + YRIS +  ++     LM+                   I  YQF KW+R  L+  ++++
Sbjct: 89  RYYRISMVPLLIFSTVTLMVFVIVLPVLLKLFFPVILVAIIVYQFKKWQRNQLYSRLMKY 148

Query: 156 LKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADK 215
           L  S +   Y T       SL +   L    A V                      K+ +
Sbjct: 149 LPKSDL---YTTKSQFM--SLRRSFGLLSNEAVV---------------------GKSVE 182

Query: 216 LLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDN-----YQLELDTTQYKTNAQV--G 268
              F+  R++EA+  +   IR+  +      W+  N     YQL +   + K  A+   G
Sbjct: 183 FTNFVKTRIMEALAKDTMKIRSTLIKPS---WIPKNAAVEEYQLTIGLNRVKMFAKALQG 239

Query: 269 DGELIMLLVFPLYLKSNSNPRKHLAN-VSLALLQGLFEGT----NGANYLE---FLSSIS 320
             + +  + +PL+  +    R   ++ +    L  L++ +    N A   +       ++
Sbjct: 240 QSKAVFSVEYPLFFVTKLEDRTKQSHLMGKVCLHFLYDYSSILKNSAKSFDPETLFKQMN 299

Query: 321 ETDAECQMVIAVQPVTNFSTKLFVIST 347
           +T+++ Q VI+V      S K F++ T
Sbjct: 300 DTESKVQYVISVIQTGTLSPKPFILYT 326

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 85/205 (41%), Gaps = 24/205 (11%)

Query: 96  KVYRISPIVAVLTGIGFLMLXXXXXXXXXXXXXXXXXXGICAYQFSKWKRKVLFQDILRH 155
           K Y I   V +L+ IG  +L                   I  +QF +WK   L++ +   
Sbjct: 126 KYYSIPTPVVILSTIGGFVLLFTILPFLFTFGFPFLIGMIVFFQFRRWKTHQLYKKMAEV 185

Query: 156 LKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADK 215
           L+ S + +  N + +L         RL +Q       +L +F      +L    S++ + 
Sbjct: 186 LQDSQINMKNNQLMSLK-------YRLIEQGL----PMLTNFSNKTTKQL----SSRGET 230

Query: 216 LLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKT-NAQVGDGELIM 274
           L+  +  R+ E+   N+  I N F+    G  + + Y+L L    +K+   ++   + I 
Sbjct: 231 LINQLQQRIKESFANNDNNIANVFVPQ--GHKLSE-YELLLPHHTFKSYTKKLPHDQDIG 287

Query: 275 LLVFPLYLKSNSNPRKHLANVSLAL 299
           LL   LY++     R+   N+ +A+
Sbjct: 288 LLSLSLYMR-----RRQHRNIKVAM 307

>KNAG0B06360 Chr2 (1253588..1257949) [4362 bp, 1453 aa] {ON}
           Anc_4.291 YLR419W
          Length = 1453

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 228 IETNEQGIRNYFLGDDVGRW---VEDNYQLEL----DTTQYKTNAQVGDGELIMLLVFPL 280
           IE     I++YFL D +      ++ N + +L    DT      +Q GD   I       
Sbjct: 788 IEGRTFPIKDYFLDDILEALDFKIKKNEKPQLYRYEDTDDLDNGSQGGDDGYIRPGPDSN 847

Query: 281 YLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMV 329
           + KS       L  V+L + Q L  G+N  + + FL  ++E D  C+M+
Sbjct: 848 FFKSGQINYDLLCQVALHVDQELKSGSNDGSIIIFLPGVAEIDKSCRML 896

>TBLA0E02730 Chr5 complement(682336..683400,683535..683582) [1113
           bp, 370 aa] {ON} Anc_5.599 YHR012W
          Length = 370

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%)

Query: 178 KIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGI 235
           KI R EQ  +K  ED  + FD + +  L+K    K+D      +D + + ++ N+Q I
Sbjct: 260 KINRKEQDTSKEIEDTSQDFDQNQKEELEKEPKMKSDSEQDEKEDEITQEVKDNKQPI 317

>Smik_8.169 Chr8 complement(261548..263479) [1932 bp, 643 aa] {ON}
           YHR091C (REAL)
          Length = 643

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 239 FLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLA 298
           +L  DVG  +E    L+ D   Y  ++Q    +L M  +F +  K N    KHL +V+  
Sbjct: 383 YLTRDVGAAIERKKDLQFDEMVYVISSQ---QDLYMSQLFMILKKMNFEWAKHLKHVNFG 439

Query: 299 LLQGL 303
           ++QG+
Sbjct: 440 MVQGM 444

>Ecym_2645 Chr2 complement(1247120..1250389) [3270 bp, 1089 aa] {ON}
           similar to Ashbya gossypii ACR286C
          Length = 1089

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 19/110 (17%)

Query: 152 ILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSA 211
           +L+HL     ++NY  + A+     +K +RL  ++ ++ ++ L   DA  RA +   +S 
Sbjct: 768 VLKHLPAKINRINYCDMNAVQKFIYNKEIRLVMEHKRMLKEGLLPADAKERAVVTHSTSK 827

Query: 212 -------KA------------DKLLRFIDDRLLEAIETNEQGIRNYFLGD 242
                  KA            DK++  + DR+L+  E  E G R Y   D
Sbjct: 828 NLIMALRKASLHPLLFRHIYNDKMIHDMSDRILDEPEYAETGNREYIRED 877

>TDEL0C04490 Chr3 complement(801727..809247) [7521 bp, 2506 aa] {ON}
            Anc_2.232 YIL129C
          Length = 2506

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 168  VKALHVKSLDKIVRLEQQNAKVFEDL-LKSFDADLRARLDKFSSAKADKLLRFIDDRLLE 226
            ++A+ V++L+ ++   ++NAK+F D+ L+      R  + KF      K++  +DD +LE
Sbjct: 1360 IRAIGVRALENLLEKNRENAKIFRDVALQCVSIHSRPDVGKFYFTTLCKVVLKMDDLILE 1419

Query: 227  AIETNEQGI 235
              E    G+
Sbjct: 1420 ENELVSLGL 1428

>Suva_7.95 Chr7 (182109..183389) [1281 bp, 426 aa] {ON} YGL169W
           (REAL)
          Length = 426

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 273 IMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIAV 332
           ++LLV      +N+N  K + +++  +++   +     N +  L+S+   D++ Q  I  
Sbjct: 298 VILLVPDTSDANNNNKEKQMESLN-RMIKNEIQADKTVNKIAILTSLKLQDSDLQSKIVK 356

Query: 333 QPVTNFSTKLFVISTDGRSGD 353
            P  +FS+K F+I   GR+G+
Sbjct: 357 DP--DFSSKSFIIERLGRTGE 375

>KAFR0L01820 Chr12 (334399..336006) [1608 bp, 535 aa] {ON} Anc_7.403
           YBL080C
          Length = 535

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%)

Query: 149 FQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKF 208
           +QDI+R LK ST  +   +V+     ++++  R+E +N      ++ +   + + +++  
Sbjct: 200 YQDIVRQLKISTGDLETGSVRVDVNINVNEYPRVELKNLPNTSSIINAIKYEYKRQVNII 259

Query: 209 SSAKADKLLRFIDDR 223
            S KA+  LR ++ R
Sbjct: 260 QSGKAESELREVETR 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,023,342
Number of extensions: 1451001
Number of successful extensions: 4421
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4543
Number of HSP's successfully gapped: 35
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)