Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D045803.165ON48248225470.0
ZYRO0B04840g3.165ON47648419950.0
YOL062C (APM4)3.165ON49149617080.0
Kpol_1045.443.165ON46948216890.0
Smik_15.963.165ON49149616800.0
Suva_15.1033.165ON49149316760.0
Skud_15.913.165ON49149516660.0
CAGL0C05203g3.165ON47548916400.0
KLTH0F06534g3.165ON46648516270.0
Kwal_33.141823.165ON46748516250.0
SAKL0C07414g3.165ON48249316240.0
NCAS0C035803.165ON49151316240.0
NDAI0G029203.165ON48649616040.0
TBLA0F008403.165ON48148515370.0
TPHA0P006603.165ON47349214480.0
KNAG0K011503.165ON47449314220.0
Ecym_52393.165ON46449013880.0
KLLA0C03894g3.165ON47549212631e-171
ADR315W3.165ON49245511421e-152
KAFR0C010203.165ON42848910921e-145
SAKL0F05346g7.127ON4474895267e-61
KLLA0D14311g7.127ON4434935242e-60
NDAI0E036807.127ON4444895153e-59
KLTH0F12584g7.127ON4414955144e-59
Kwal_55.208437.127ON4414935102e-58
NCAS0E021407.127ON4814915026e-57
Ecym_83507.127ON4454984997e-57
YPL259C (APM1)7.127ON4755124973e-56
Suva_16.457.127ON4785164931e-55
TPHA0C043207.127ON4544964911e-55
Smik_6.4667.127ON4765134922e-55
TBLA0A009507.127ON4695124903e-55
KAFR0L004707.127ON4655114893e-55
CAGL0K00539g7.127ON4564954841e-54
KNAG0L009507.127ON4615024798e-54
Skud_16.197.127ON4765134781e-53
ADL017C7.127ON4434894752e-53
Kpol_1062.567.127ON4504944752e-53
TDEL0H028907.127ON4424924673e-52
ZYRO0C05236g7.127ON4474914664e-52
SAKL0D13090g2.555ON4994832576e-23
KLTH0D07502g2.555ON5044912495e-22
Ecym_45912.555ON5015322415e-21
Kwal_26.81462.555ON5055382328e-20
KLLA0F25432g2.555ON5074462265e-19
KAFR0A020602.555ON5403412088e-17
ZYRO0E05874g2.555ON5493311982e-15
ABR047W2.555ON4983301962e-15
NCAS0A126502.555ON5883681928e-15
TPHA0I023902.555ON5593511883e-14
TDEL0B064302.555ON5255461874e-14
Skud_8.262.555ON5963761849e-14
KNAG0C055502.555ON5823511803e-13
Suva_8.332.555ON5963791803e-13
Kpol_1056.132.555ON5413381784e-13
TBLA0B067602.555ON6572341777e-13
YHL019C (APM2)2.555ON6053801751e-12
CAGL0K03223g2.555ON5982431688e-12
Smik_8.232.555ON6033801633e-11
NDAI0B016102.555ON6722991625e-11
KLLA0E18789g2.522ON4971721553e-10
KAFR0D035602.522ON4553151501e-09
KLTH0D06556g2.522ON4563111454e-09
Kwal_26.79572.522ON4563101322e-07
TBLA0I006202.522ON6091491232e-06
TDEL0A029702.522ON4963421188e-06
AGL061W2.522ON4113131133e-05
Kpol_1018.422.522ON5751511116e-05
SAKL0A09218g2.522ON4733311116e-05
NDAI0K019302.522ON6122311116e-05
NCAS0A048702.522ON4891551035e-04
TPHA0C041302.522ON5331531010.001
ZYRO0B01738g2.522ON492143970.003
Smik_2.4302.522ON484134930.009
CAGL0L02145g2.522ON543246880.040
NCAS0F040103.575ON54753810.24
Kpol_507.73.575ON53361800.28
KNAG0F010602.44ON42859800.34
Ecym_72662.522ON517179790.44
YBR288C (APM3)2.522ON483132780.49
NDAI0B063203.575ON54083780.52
Suva_4.5482.522ON484174770.74
TDEL0D064303.575ON53679751.3
Kpol_380.133.575ON53564741.7
TPHA0G037003.575ON53985722.9
KAFR0G012401.31ON558147713.8
TBLA0D002002.92ON111550714.0
Smik_7.553.517ON415150705.0
CAGL0A04741g3.575ON53661705.7
Ecym_60073.575ON53737696.3
KAFR0J001303.575ON54355697.1
KLTH0G09570g2.250ON298105687.4
Smik_7.3713.575ON598187689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04580
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   985   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   773   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   662   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   655   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   651   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   650   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   646   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   636   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   631   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   630   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   630   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   630   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   622   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   596   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   562   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   552   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   539   0.0  
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   491   e-171
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   444   e-152
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   425   e-145
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   207   7e-61
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   206   2e-60
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   202   3e-59
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   202   4e-59
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   201   2e-58
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   197   6e-57
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   196   7e-57
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   196   3e-56
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   194   1e-55
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   193   1e-55
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   194   2e-55
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   193   3e-55
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   192   3e-55
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   191   1e-54
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   189   8e-54
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   188   1e-53
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   187   2e-53
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   187   2e-53
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   184   3e-52
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   184   4e-52
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   103   6e-23
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   100   5e-22
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    97   5e-21
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    94   8e-20
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    92   5e-19
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    85   8e-17
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    81   2e-15
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    80   2e-15
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    79   8e-15
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    77   3e-14
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    77   4e-14
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    75   9e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    74   3e-13
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    74   3e-13
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    73   4e-13
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    73   7e-13
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    72   1e-12
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    69   8e-12
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    67   3e-11
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    67   5e-11
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    64   3e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    62   1e-09
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    60   4e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    55   2e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    52   2e-06
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    50   8e-06
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    48   3e-05
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    47   6e-05
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    47   6e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    47   6e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    44   5e-04
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    44   0.001
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    42   0.003
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    40   0.009
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.040
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    36   0.24 
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    35   0.28 
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    35   0.34 
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    35   0.44 
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    35   0.49 
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    35   0.52 
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    34   0.74 
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    33   1.3  
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    33   1.7  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    32   2.9  
KAFR0G01240 Chr7 complement(280112..281788) [1677 bp, 558 aa] {O...    32   3.8  
TBLA0D00200 Chr4 complement(47585..50932) [3348 bp, 1115 aa] {ON...    32   4.0  
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    32   5.0  
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    32   5.7  
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    31   6.3  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    31   7.1  
KLTH0G09570g Chr7 complement(802806..803702) [897 bp, 298 aa] {O...    31   7.4  
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    31   9.2  

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/482 (100%), Positives = 482/482 (100%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180

Query: 181 NRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT 240
           NRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT
Sbjct: 181 NRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT 240

Query: 241 THLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD 300
           THLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD
Sbjct: 241 THLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD 300

Query: 301 KFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGK 360
           KFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGK
Sbjct: 301 KFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGK 360

Query: 361 LSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSS 420
           LSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSS
Sbjct: 361 LSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSS 420

Query: 421 DTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSYEI 480
           DTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSYEI
Sbjct: 421 DTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSYEI 480

Query: 481 RY 482
           RY
Sbjct: 481 RY 482

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/484 (77%), Positives = 422/484 (87%), Gaps = 10/484 (2%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+AI I+S+RGELIV+K   +SLK+SISDIFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           GSDSLW+V VSR+NANSGAIWEFLYK N I+D Y LTKE  LKE+FM CYEILD V+  G
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGD--SSSTLSMPKFLT 178
           GIP+DTEL S+ SK++VKPPK  SG     P   T+++     PG   S+S LSMPKFLT
Sbjct: 121 GIPMDTELGSIASKISVKPPK--SGGTSSEPKSSTVANF----PGSNLSTSNLSMPKFLT 174

Query: 179 RNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238
           RNNRSMSQDLG+NYPSN  WRP+GIKYKKNEV L VNEKI+ILVSRDGSILK+YVDGTID
Sbjct: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
           +TTHLSG PICQFGLNDS SVEFGD    + ++F NKKA+PKAAAG VMLEDCKFHQCVS
Sbjct: 235 MTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS 294

Query: 299 LDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFP 358
           LDKFNK+R+IKFVPPDG+MELMKYCVRDNLNLPFK+TP+VT    G+T++YR+TLKSLFP
Sbjct: 295 LDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRITLKSLFP 352

Query: 359 GKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVP 418
            KLSAKDV+L IPVPPGTVDC+IN+SNGKCKF  EE+AM+W+F KY GLTENTLSAVTVP
Sbjct: 353 NKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVP 412

Query: 419 SSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSY 478
           +SDTTQLT+QQWPRPPMSL FEIMMFSNSGLVVRYF+VSDKDE+YR  KWIKYISKSGSY
Sbjct: 413 TSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSY 472

Query: 479 EIRY 482
           E+RY
Sbjct: 473 EVRY 476

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/496 (66%), Positives = 399/496 (80%), Gaps = 19/496 (3%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MIS +L++SSRGEL++ K  K+SLK+SISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
             D+LWLV ++RSNANS AIWEFLYKL+ +M+ Y L +E  LKE FM  +E+LD +L   
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPD---LLTMSSLNLSTPGDSSSTLSMPKFL 177
           GIP+DTELNSVI++M+VKP + + G LLD PD   +L+ SS   S+ G+    L  PKFL
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGG-LLDSPDGNDVLSSSSSPTSSAGE----LHFPKFL 175

Query: 178 TRNNRSM--SQDLGSNYPSN--LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYV 233
           T+ + S     D  S++  N  ++WRP GI +KK+EV L VNE+I+ILVSRDGSILKSYV
Sbjct: 176 TKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYV 235

Query: 234 DGTIDLTTHLSGMPICQFGLNDSLSVEFGDDS--ISEVE-----DFANKKAIPKAAAGRV 286
           DGTID+TTHLSG PIC+FGLNDSL ++  D+   +++ +     DF NK  IPKAAAG V
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSV 295

Query: 287 MLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNT 346
           +LEDCKFH+CVSLDKFN++ +I+FVPPDGSMELMKY VRDN+NLPFKVTPIVT   R N 
Sbjct: 296 LLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNE 355

Query: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406
           IDYR+TLKSLFPGKLSAKDV L IPVPP TVDC+I+VSNG CKFVPEE+AMIW+F KY G
Sbjct: 356 IDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNG 415

Query: 407 LTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTA 466
           LTENTLSAVTV +SDTTQL +QQW RPP+SL FE+MMFSNSGLVVRYF +S KD ++R  
Sbjct: 416 LTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 467 KWIKYISKSGSYEIRY 482
           KWIKYISK+GSYE+RY
Sbjct: 476 KWIKYISKAGSYEVRY 491

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/482 (66%), Positives = 391/482 (81%), Gaps = 13/482 (2%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+ +L+++ +GELIV+K  KS+ K+SISDIFR+QVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
             D LWLVAV+RSNANSGAIWEFLYK + +++ +GL  E TLKE FM CYE+LD +L   
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           G+P+DTEL+SV +KM+ KP             L +++S + S+  +SSS LS+ KFL RN
Sbjct: 121 GVPLDTELSSVSAKMSTKP-------------LHSINSPSDSSLDNSSSPLSISKFLNRN 167

Query: 181 NRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT 240
           NRSMS D  +  PSN  WRP+GIKYKKNE+ LN+NEKISILVS+D +ILK+YVDGT+DLT
Sbjct: 168 NRSMSVDTMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLT 227

Query: 241 THLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD 300
           +HLSG P CQFGLNDSLSV+  +   S+   F N++ IP+A AG V+LEDCKFH+CVSLD
Sbjct: 228 SHLSGTPTCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLD 287

Query: 301 KFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGK 360
           KFN+DR+IKFVPPDG +ELMKY VRDN+NLPFKVTP V +      +DYR+TLKSLFP K
Sbjct: 288 KFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSK 347

Query: 361 LSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSS 420
           LSA DV L+IPVP  TVDC++NVSNGKC+FVPEES +IWKF KY GLTEN LSAVTV S+
Sbjct: 348 LSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSN 407

Query: 421 DTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSYEI 480
           DTTQL +QQW RPP+SL+FEIMMFSNSGLVVRY K+ +KD++YRT KWIKYIS+SGSYE+
Sbjct: 408 DTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEV 467

Query: 481 RY 482
           RY
Sbjct: 468 RY 469

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 397/496 (80%), Gaps = 19/496 (3%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MIS +LI+SSRGEL++ K  K+SLK+SISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
             D+LWLV ++RSNANS AIWEFLYKL+ +M+ Y L +E  LKE FM  +E+LD +L   
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPD---LLTMSSLNLSTPGDSSSTLSMPKFL 177
           GIP+DTELNSVI++M+VKP +  +G LLD PD   +L+ SS   S  G+    L  PKFL
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRN-TGGLLDSPDGNDMLSSSSSPSSVSGE----LHFPKFL 175

Query: 178 TRNNRSM--SQDLGSNY--PSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYV 233
            +++ S     D  S++   + ++WRP GI +KK+EV L VNE+++ILVSRDGSILKSYV
Sbjct: 176 KKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 234 DGTIDLTTHLSGMPICQFGLNDSLSVEFGDDS--ISEVE-----DFANKKAIPKAAAGRV 286
           DGTID+TTHLSG PIC+FGLNDSL ++  D+   +++ +     +F +K  I KAAAG V
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSV 295

Query: 287 MLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNT 346
           +LEDCKFH+CVSLDKFNK+  I+FVPPDGSMELMKY VRDN+NLPFK+TPIVT   R N 
Sbjct: 296 LLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNE 355

Query: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406
           IDYR+TLKSLFPGKLSAKDV+L IPVPP TVDC+I+VSNG CKFVPEE+AM+W+F KY G
Sbjct: 356 IDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNG 415

Query: 407 LTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTA 466
           LTENTLSAVTV +SDTTQL +QQW RPPMSL+FE+MMFSNSGLVVRYF +  KD ++R  
Sbjct: 416 LTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAV 475

Query: 467 KWIKYISKSGSYEIRY 482
           KWIKYIS+SGSYE+RY
Sbjct: 476 KWIKYISRSGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/493 (64%), Positives = 391/493 (79%), Gaps = 13/493 (2%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MIS +L++SSRGELI+ K  K+SLK+SISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
             D+LWLV ++RSNANS AIWEFLYKL+ +M+ Y L +E  LKE FM  +E+LD +L   
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           GIP+DTELNSVI++M+VKP + + G LL+ PD + M S   S        L  PKFL + 
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGG-LLESPDSIDMLSSTSSPS-SVGGELHFPKFLKKR 178

Query: 181 NRSM--SQDLGSNYP--SNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
           + S     D  S++   + ++WRP GI +KK+EV L VNE+++ILVSRDGSILKSYVDGT
Sbjct: 179 SSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDS--ISEVED-----FANKKAIPKAAAGRVMLE 289
           ID+TTHLSG P+C+FGLNDSL ++  D    +S+ +      F NK   PKAAAG V+LE
Sbjct: 239 IDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVLLE 298

Query: 290 DCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDY 349
           DCKFH+CVS+DKFNK+ +I+FVPPDGSMELMKY VRDN+NLPFK+TPIV    R N +DY
Sbjct: 299 DCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDY 358

Query: 350 RVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTE 409
           R+TLKSLFPGKLSAKDV L IPVPP TVDC+I+VSNG CKFVPEE+AMIW+F K+ GLTE
Sbjct: 359 RITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTE 418

Query: 410 NTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469
           NTLSAVTV +SDTTQL++QQW RPPMSL+FE+MMFSNSGLVVRYF +S +D ++R  KWI
Sbjct: 419 NTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKWI 478

Query: 470 KYISKSGSYEIRY 482
           KYISKSGSYE+RY
Sbjct: 479 KYISKSGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/495 (64%), Positives = 388/495 (78%), Gaps = 17/495 (3%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MIS +L++SSRGELI+ K  K+SLK+SISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
             D+LWLV ++RSNANS AIWEFLYKL+ +M+ Y L +E  LKE FM  +E+LD +L   
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNL--LDRPDLLTMSSLNLSTPGDSSSTLSMPKFLT 178
           GIP+DTELNSV+++M+VKP +   G L   D  D+L+ SS   S  G+    L  PKFL 
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGE----LHFPKFLK 176

Query: 179 RNNRSMSQDLGSN---YPSN-LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
           +++ S      S    Y SN ++WR  GI +KK+EV L VNE+++ILVSRDGSILKSYVD
Sbjct: 177 KSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVD 236

Query: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGDD-------SISEVEDFANKKAIPKAAAGRVM 287
           GTID+ THL+G P+C+FGLNDSL ++  D+             DF NK  +PKAAAG V+
Sbjct: 237 GTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVL 296

Query: 288 LEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTI 347
           LEDCKFH+CVS++KFNK+ +I+F+PPDGSMELMKY VRDN+NLPFK+TPIV+   R N I
Sbjct: 297 LEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEI 356

Query: 348 DYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGL 407
           DYR+TLKSLFPGKLSAKDV L IPVPP TVDC+I+VSNG CKFVPEE+AMIW+F KY GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGL 416

Query: 408 TENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAK 467
           TENTLSA TV +SDTTQL+ QQW RPPMSL+FE+MMFSNSGLVVRYF +S KD ++R  K
Sbjct: 417 TENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVK 476

Query: 468 WIKYISKSGSYEIRY 482
           WIKYISKSGSYE+RY
Sbjct: 477 WIKYISKSGSYEVRY 491

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/489 (63%), Positives = 381/489 (77%), Gaps = 21/489 (4%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MISA+L+FSSRGELIV+K  K++LK+SISDIFRIQVINNLDVRSPILTLGSTTF HIRS+
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  -GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEE 119
              D LWLV+V+RSN N GA+WEFLYK + ++++YGL  E  LKE FM CYE+LD +L E
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 120 GGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTR 179
            G P+DT+  +VI KM+VKP K+            T+ +  +S    +S+   +PKFL R
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKE------------TIENFAISVQNKNSTLPKIPKFLRR 168

Query: 180 NNRSMSQDLGSN------YPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYV 233
            +  ++Q+  +N          L WRP GI +KKNE+ L VNEKISILVS++GSILKSYV
Sbjct: 169 TSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYV 228

Query: 234 DGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKF 293
           DGTIDL THLSG P+CQFGLNDSLSV+  DD     +   NKKAIPKAAAG V+LEDCKF
Sbjct: 229 DGTIDLVTHLSGTPVCQFGLNDSLSVK-NDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKF 287

Query: 294 HQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTL 353
           HQCVSL+KF+KDR+IKFVPPDGSMELMKY VR N+NLPFKV+PIVT    G  ++YR+TL
Sbjct: 288 HQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL 347

Query: 354 KSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLS 413
           KSLFP KL+AK+V+++IPVPP T+DC+I+VSNG CKF PEE AM+W F KY GLTENTLS
Sbjct: 348 KSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLS 407

Query: 414 AVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473
           AVT+ S D  +L +QQW +PP+SL+FEIMMFSNSGLVVRYF + +  ERY+T KWI+Y+S
Sbjct: 408 AVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SERYKTVKWIRYVS 466

Query: 474 KSGSYEIRY 482
           KSGSYEIRY
Sbjct: 467 KSGSYEIRY 475

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/485 (64%), Positives = 382/485 (78%), Gaps = 22/485 (4%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M+SA+ IFS RGEL+++K ++SS+ KS+S+IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           G+  LW+VAVSRSNA+S AIWEFLYKL+ +++ +GL  E  LKE+FM CYE+LD VLE+G
Sbjct: 61  GN--LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDG 118

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFL-TR 179
            +PVDTEL+SV SKM+VKP                +++   S  G ++  L + +FL  R
Sbjct: 119 -VPVDTELSSVASKMSVKPSASAE----------RINTFIESGNGGTNRILPVAQFLRAR 167

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239
           ++ S   D  S  PSN+ WR +GIKYKKNEV LNVNE+ISILVS+DGSILKSYVDGT++ 
Sbjct: 168 SSSSNLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227

Query: 240 TTHLSGMPICQFGLNDSLSVE--FGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCV 297
           TTHLSGMP+C+FGLNDSLSV   FGD+         NKKAIPKAAAG VMLEDCKFHQCV
Sbjct: 228 TTHLSGMPVCRFGLNDSLSVSTPFGDNE----SPTTNKKAIPKAAAGSVMLEDCKFHQCV 283

Query: 298 SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLF 357
            LDKF  +R I F+PPDGS ELMKY VR+NLNLPFK+TP+VT + + N+IDYRVT+KSLF
Sbjct: 284 QLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVT-LFKANSIDYRVTIKSLF 342

Query: 358 PGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417
           P KL+AKDV LRIPVPP TVDC I+ SNG+CKFVPEESA+IWKF+KY GLTEN+LSA  V
Sbjct: 343 PSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAV 402

Query: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477
           P  D+  L + QW +PPMSL FEI+MFSNSGLVVR+F VS+ D  Y+  KWIKY+SKSG+
Sbjct: 403 PMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA 461

Query: 478 YEIRY 482
           YE+RY
Sbjct: 462 YEVRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/485 (64%), Positives = 385/485 (79%), Gaps = 21/485 (4%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M++A+ I+S RGEL+++K +K S++KS+S+IFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
            + +LW+VAVSRSNA+S AIWEFLY+LN +++ + L  E  LKE FM CYE+LD VLE+G
Sbjct: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDG 118

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLT-R 179
            +PVDTEL+SV SKM+VKP   +        D   M + N    G ++  L + +FL  R
Sbjct: 119 -LPVDTELSSVASKMSVKPNAGV--------DNFNMFAEN--GHGGTNRILPVSQFLRGR 167

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239
            +    QD+ S  PSN+ WR +GIKYKKNEV LNVNE+ISILVS+DGSILKSYVDGT++ 
Sbjct: 168 PSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227

Query: 240 TTHLSGMPICQFGLNDSLSVE--FGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCV 297
           TTHLSGMP+C+FGLND+LSV   FGDD   +V    NKKAIPKAAAG VMLEDCKFHQCV
Sbjct: 228 TTHLSGMPVCRFGLNDALSVSTPFGDDDEYQV---TNKKAIPKAAAGSVMLEDCKFHQCV 284

Query: 298 SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLF 357
            LDKF  +R I F+ PDGS ELMKY VR+NLNLPFKVTPIVT + R N+IDY++T+KSLF
Sbjct: 285 QLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVV-RSNSIDYQITIKSLF 343

Query: 358 PGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417
           P KL+AKDV LRIPVPP TV C I+ SNGKCKFVPEESA++WKF+KY GLTEN++SA  V
Sbjct: 344 PSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAV 403

Query: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477
           P  D+T L ++QWPRPP+SL FEI+MFSNSGLVVR+F VS++D  Y+  KWIKY+SKSG+
Sbjct: 404 PMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA 462

Query: 478 YEIRY 482
           YE+RY
Sbjct: 463 YEVRY 467

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/493 (62%), Positives = 383/493 (77%), Gaps = 22/493 (4%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M++A+ +FS +GEL+V+K ++ ++K+S+++IFRIQVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
            S +LW+VAV+RSNA+S AIWEFLYK N +++ YGL  E +LKE FM CYE+LD VLE  
Sbjct: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           G+PVDTEL+SV SKM+ +P   +  N L   D L MS+       +      MPKFL + 
Sbjct: 118 GVPVDTELSSVASKMSRRPVVSLENNPLT--DELLMSA-----AANVDLGFRMPKFLNKG 170

Query: 181 NRSMSQDL----GSNY--PSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
           +RS S       G  +  P    WR  GIKYKKNE+ L+VNE+I+ILVS+DGSILKSYVD
Sbjct: 171 SRSSSSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVD 230

Query: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGD-----DSISEVEDFANKKAIPKAAAGRVMLE 289
           G++DLTTHLSG P+CQFGLNDSLS++ G      D ISE E   NKKAIPKAAAG V LE
Sbjct: 231 GSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYE-VKNKKAIPKAAAGSVQLE 289

Query: 290 DCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDY 349
           DCKFHQCV L++FN DR+I+FVPPDGS ELM+Y VRDNLNLPFK+TPI +       ++Y
Sbjct: 290 DCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEY 349

Query: 350 RVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTE 409
           RV LKSLFP KL+AKDV LRIPVPPGTVDC+IN SNG+C+FVPEE+A++WKF KY GLTE
Sbjct: 350 RVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTE 409

Query: 410 NTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469
           NTLSA+TVP  + + L +QQW RPPMSL FEI+MFSNSGLVVR+FKVS++D  Y T KW+
Sbjct: 410 NTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWV 469

Query: 470 KYISKSGSYEIRY 482
           KYIS+SG+YE+RY
Sbjct: 470 KYISRSGAYEVRY 482

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/513 (61%), Positives = 392/513 (76%), Gaps = 53/513 (10%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+A+LIF++RGEL+V+K  K S+K+SI+DIFRIQVINNLDVRSPILTLGSTTFHHI+S 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVL-EE 119
             D+LW+VAVSR+N +S AIWEFLYKL+ ++D YGL  E  LKE FM  +E+LD ++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 120 GGIPVDTELNSVISKMTVKPPKQI---------------SGNLLDRPDLLTMSSLNLSTP 164
           GGIP+ TE + VIS+M+VKP K I               + N  + PDLL          
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLL---------- 170

Query: 165 GDSSSTLSMPKFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSR 224
                 +S PK L RN+ S+SQDL  +  ++  WRP GI +KKNEV+L+VNE+I+ILVS+
Sbjct: 171 ------MSGPKLLRRNSASLSQDL--SILTDFKWRPKGIVHKKNEVILHVNERINILVSK 222

Query: 225 DGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSV---------------EFGDDSISEV 269
           DGS+LK+YVDG+IDL THLSG PICQFGLNDSLSV                FGD +    
Sbjct: 223 DGSVLKAYVDGSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNF--- 279

Query: 270 EDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLN 329
            D  +KK +  A+ G V+LEDCKFHQCVSLDKF+KDR+IKFVPPDGSMELMKY VRDNLN
Sbjct: 280 -DKTDKKQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLN 338

Query: 330 LPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCK 389
           LPFKV+PIVT+   G  ++YR+T+KSLFPG+LSAK+V+L IPVPP T+DC+INV+NG CK
Sbjct: 339 LPFKVSPIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCK 398

Query: 390 FVPEESAMIWKFTKYTGLTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGL 449
           F+PEESAMIW+F K+ GLTENTLSAVT+P+ D TQL++QQW +PPMSL+FEI+MFSNSGL
Sbjct: 399 FIPEESAMIWRFNKFNGLTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGL 458

Query: 450 VVRYFKVSDKDERYRTAKWIKYISKSGSYEIRY 482
           VVRYF ++++D++Y+  KWIKYIS+SGSYEIRY
Sbjct: 459 VVRYFTITERDQKYKAVKWIKYISRSGSYEIRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/496 (62%), Positives = 384/496 (77%), Gaps = 24/496 (4%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+ ILI+S RGELIV+K  K +LK+SI+DIFRIQVINNLDVRSPILTLGSTTFHHIRS 
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  -GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEE 119
             SD+LWLVA +R+NANS AIWEFLYKL+ ++  YGL KE  LKE FM  +E+LD +L  
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 120 GGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTR 179
            GIP++TE + VI+KM+VKP K    N        T S L+       ++ +SMPKFL R
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNN--------TSSLLDGHLGSKGNNEISMPKFLKR 172

Query: 180 NNRSMSQDLGSNYPSN-LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238
           N+ S S D  SN+  N  SWRP  IK+KKNEV+L+VNEKI+ILV++DGSILK+YVDG+ID
Sbjct: 173 NDSSQSHD--SNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSID 230

Query: 239 LTTHLSGMPICQFGLNDSLSV-----EF-------GDDSISEVEDFANKKAIPKAAAGRV 286
           L T LSG P+CQFGLNDSL++     E+       G++  S ++   + K + KA+ G V
Sbjct: 231 LQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNV 290

Query: 287 MLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNT 346
           +LEDCKFHQCVSLDKF+++R+IKFVPPDGS+ELMKY +R+NLNLPFK+TPIVT+   G+ 
Sbjct: 291 ILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDA 350

Query: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406
           +DYR+ LKSLFPG+LSAK V L IPVPPG +DC I+VSNG CKFVP E+AM+WKF KY G
Sbjct: 351 LDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410

Query: 407 LTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTA 466
           LTENTLSAVTVPS +  Q T+QQW RPPMSL+FEI+MFSNSGLVVRYF +S+  + Y+  
Sbjct: 411 LTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAV 470

Query: 467 KWIKYISKSGSYEIRY 482
           KWIKY+SKSGSYE+R+
Sbjct: 471 KWIKYVSKSGSYEVRF 486

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 378/485 (77%), Gaps = 7/485 (1%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+A++IF+ RGEL+V K  KSS+K++ISDIFR+QVINN ++RSPILTLGSTTFH IR+ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
               LWLVAV+RSNA+SGAIWE+LYKLN +M+VYGLT E  LK+ F+ C+E+LD  L   
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           G+P+DTEL+SVI KMT+KP + ++ +  DR D+L  S   ++T G +S+ +SMPKFL+RN
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSA-DRSDILASS---VTTLGHNSTPISMPKFLSRN 176

Query: 181 -NRSMSQDLGSNY-PSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238
            NRS++Q+  S + PSN+ WR   IKYKKNE+++NV EKI++LV +D +IL++YVDGTID
Sbjct: 177 SNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTID 236

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFA-NKKAIPKAAAGRVMLEDCKFHQCV 297
           +T HLSGMP+CQ G+ND  +++ G+++    ED A N+ A+P  +  RV+LE  KFHQCV
Sbjct: 237 ITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQCV 296

Query: 298 SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLF 357
           +LDK+NKD VI F+PPDG  ELMKY V +NLNLPF++TP VT    G  + Y + LKSLF
Sbjct: 297 ALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSLF 356

Query: 358 PGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417
           P KLSA++V LRIPVPPGT+DC+IN S+GKCKF+PEE+ M+W F ++ G TEN L+A TV
Sbjct: 357 PRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQTV 416

Query: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477
           P+      +++QW RPPMSL+F+++MFSN+GL+VRY KV +K+  Y T KWIKYIS +GS
Sbjct: 417 PTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAGS 476

Query: 478 YEIRY 482
           YE+RY
Sbjct: 477 YEVRY 481

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/492 (56%), Positives = 362/492 (73%), Gaps = 29/492 (5%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+ +LI+SSRG+LIV   +KSSLK++ISDIF+IQVIN+L+++SPILTLGSTTFHHIRS 
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
               LW+VA++RSNANSG IWEFLYKL+ ++  Y L  E  L E FM  YE++D +L   
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
            +P++TEL+S+ SK++ + PK IS +  +                ++++ LS+PKFLTRN
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNE--------------KNNNNGLSIPKFLTRN 166

Query: 181 NRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT 240
           +RSMSQ+  +   S++ WRP GIKYKKNEV L VNEKI+ILVS+D +ILK+YVDG+IDL 
Sbjct: 167 SRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLV 226

Query: 241 THLSGMPICQFGLNDSLSV----------EFGDDSISEVEDFANKKAIPKAAAGRVMLED 290
           +HLSG PICQFGLND LS+          EF  D + + ED +  ++    ++  V +ED
Sbjct: 227 SHLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDD-EDLSTGRS----SSSSVKIED 281

Query: 291 CKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYR 350
           C FHQCVSLDKFN +R+I FVPPDGS ELM+Y VRD+LN+PFKVTP V+      ++ Y+
Sbjct: 282 CTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYK 341

Query: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410
           + LKSLFP  LSA D  L+IP+PPGTVDC+IN S+GKC F   ++  IWKF KY GLTEN
Sbjct: 342 IILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTEN 401

Query: 411 TLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIK 470
            L   TVPSS T  L++QQW RPPMS+NFEI+MFSNSGLVV+Y KV ++ ++YR  KWIK
Sbjct: 402 ELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIK 461

Query: 471 YISKSGSYEIRY 482
           Y+SKSGSYEIRY
Sbjct: 462 YVSKSGSYEIRY 473

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 358/493 (72%), Gaps = 30/493 (6%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI+A+L++S+RGELIV+K  K +LK+S+ DIFR+QVIN+LDVRSPILTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           G + LW+V+VSR+N NS A WEFLYK   ++  Y L  E  LKE FM  +E+LDT++E G
Sbjct: 61  G-EGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGG 119

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
           GIP +T+ + +IS M+VKP        +   D+   +    +T    +   + P+ L R 
Sbjct: 120 GIPSETDPHRIISAMSVKPA-------MSPVDVRADARQQQTTTSTGAFGHAFPQLLHR- 171

Query: 181 NRSMSQDLGSNYPSNLSWRPH----GIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
                    ++ P  +S  PH    G + K+NE+++ V E ISILVS+DGSILK+YVDG 
Sbjct: 172 ---------ASNPGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGG 222

Query: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDS----ISEVEDFANKKAIPKAAAGRVMLEDCK 292
           IDLTT L G  +CQFGLNDSLS +   +S    +   E       +  A  G V+L DCK
Sbjct: 223 IDLTTKLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCK 282

Query: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVT 352
           FHQCVSL++F++DR+I+F PP+G++ELMKY VRDNLNLPFKVT +V      N  DYRVT
Sbjct: 283 FHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTA-NNETDYRVT 341

Query: 353 LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTL 412
           +KSLFPGKLSAK+V++RIPVPPGT+DC+INVSNG CKF+PEE+AM+WKF KY GLTEN L
Sbjct: 342 IKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKL 401

Query: 413 SAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDK---DERYRTAKWI 469
           SA+TVP+ DTTQL +QQW RPP+SL+FEI+M+SN+GLVVRYF V DK   + +++T KWI
Sbjct: 402 SAITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWI 461

Query: 470 KYISKSGSYEIRY 482
           KY+S SGSYE+RY
Sbjct: 462 KYVSHSGSYEVRY 474

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 351/490 (71%), Gaps = 34/490 (6%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MISA+ ++S RG+LI++K +K ++K  +S+IFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           G   LWLV VSR N +S  IWEFLY  N +++VY +  E +L+ +FM CYEILD VL+ G
Sbjct: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNG 118

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180
            IP DTEL  ++  ++ KP   +S NLL   D+L                 + P +L + 
Sbjct: 119 -IPRDTELTHIMPYISKKP---LSENLLGSDDIL-----------------NTPSWLVKA 157

Query: 181 N-RSMS-QDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238
             R MS ++LG        WR  GI+YKKNEV L+V E ISILV++DG+ILKSYVDG++ 
Sbjct: 158 GARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217

Query: 239 LTTHLSGMPICQFGLNDSLS-----VEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKF 293
              HLSGMP+CQFG ND LS        G+D  +E E+    KAI  A  G V+LEDCKF
Sbjct: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEEN--GTKAIKNAITGSVILEDCKF 275

Query: 294 HQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTL 353
           HQCV LDKF+++RVI+FVPPDG  ELMKY VRDNLNLPFKVTP+VT++ +G +++YR+TL
Sbjct: 276 HQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTL-KGKSVEYRITL 334

Query: 354 KSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLS 413
           KSLFP KL AKDV L IP PP TV+ +INVS+GK KF+PEE+A++WK  KY GLTEN  S
Sbjct: 335 KSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFS 394

Query: 414 AVTVPSSD-TTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYI 472
           AV VP  +    L ++QW RPP+S+ FEI MFSNSGLVVRY KV +KD  Y T KW+KYI
Sbjct: 395 AVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYI 454

Query: 473 SKSGSYEIRY 482
           SKSG+YE+RY
Sbjct: 455 SKSGAYEVRY 464

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  491 bits (1263), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 254/492 (51%), Positives = 345/492 (70%), Gaps = 27/492 (5%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M+SAI I++++G+L+++K +K  +K+S++D+FR QVIN+  VRSPILTLGSTTF H+  +
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 61  GSDSL--WLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLE 118
            SD+L  WLVAVSRSN +S  IWE+L+KL  +M+ +G+  E  LK+ FM  YEIL+  LE
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 119 EGGIPVDTELNSVISKMTVKPPKQISGNLLDR-PDLLTMSSLNLSTPGDSSSTLSMPKFL 177
             GIP  T+L  +I +++ KP   I  N + + PDL    S         S+ L  PK  
Sbjct: 121 -NGIPQTTDLAQIIPRVSRKP---IENNTISKSPDLDDFLS--------GSNILKAPKLS 168

Query: 178 TRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTI 237
            R++ S++    S  P    WRP G+KYKKNEV L++NEKI+ILV +DGSI+KS+VDG++
Sbjct: 169 KRSSSSIALSSLSECP----WRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSV 224

Query: 238 DLTTHLSGMPICQFGLNDSLSVEFGDDS-ISEVE-----DFANKKAIPKAAAGRVMLEDC 291
           D  +HLSGMP+CQ GLND+ S+   + S +S VE     D  NKKAIP AAAG V+LEDC
Sbjct: 225 DCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDC 284

Query: 292 KFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRV 351
           KFHQCV L+K+  + VI+FVPPDG  +LM+Y V DN+N+PF V P V  I + +T++Y+V
Sbjct: 285 KFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNYKV 343

Query: 352 TLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENT 411
           TL+SLFP  +SAKDV+++IPVPP T+ C+ NVS GKCK+   E  M+WK+ KY G TENT
Sbjct: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403

Query: 412 LSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIK 470
           LS  V +P++      + +W RPP+S+ FEI+MFSNSGLVVR+ K  +    Y+  KWIK
Sbjct: 404 LSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIK 463

Query: 471 YISKSGSYEIRY 482
           YIS SG+YEIRY
Sbjct: 464 YISHSGAYEIRY 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 301/455 (66%), Gaps = 39/455 (8%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MI A  +F+ RG LIV+K +    K+S+S++FR+QVIN L++RSP+LTLGSTTF HIR+ 
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120
           G   LW+V V R NA+S AIWEFLY +N ++D Y +  E  L ++FM CYE+LD VL+  
Sbjct: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117

Query: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLS-TPGDSSSTLSMPKFLTR 179
           G+P DTEL+ ++  ++ KP    +G      D L  + L  + T   S  TL        
Sbjct: 118 GLPQDTELSHIVPLLSRKPA---TGESASGDDFLNSARLRRTGTKNVSVETLD------- 167

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239
                S+D+         WR  GIKYKKNEV L+V EK+S+LV+RDG+ILK+YVDGT+  
Sbjct: 168 ---HFSRDV-------CPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQC 217

Query: 240 TTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAG----RVMLEDCKFHQ 295
           T HLSGMP+C FG NDS S+          +    ++  P+         V+LEDCKFHQ
Sbjct: 218 TAHLSGMPLCHFGFNDSQSLR---------QRSPRRQYAPRVFGTDERESVVLEDCKFHQ 268

Query: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKS 355
           CV L+KF+++RVI+FVPPDG  ELMKY +RD+L  PFKVTP+V+ +    +I+YR+TL+S
Sbjct: 269 CVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNE-RSIEYRITLQS 327

Query: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAV 415
           LFP KLSAKDV L IP PP T+  ++NVS GKCKFVPEE+A+IWK  K+ GLTENTLSAV
Sbjct: 328 LFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAV 387

Query: 416 TVPSSDTTQLTV-QQWPRPPMSLNFEIMMFSNSGL 449
           T+         V  QWPRPP+S+  EIMMFS + L
Sbjct: 388 TIADEQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  425 bits (1092), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 322/489 (65%), Gaps = 68/489 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           MISAILI++ RGELIV+K  ++++K+SIS+IFRIQVINN +VRSPILTLGSTTFHHIRS 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  GSD----SLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTV 116
            +D     LWLV V+R+NANS AIWEFL KLN+I+  YG+T E  LK+ FM  +EILD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176
           L   GI  +T+L S++ KM+VKP  + +     +   L   +  L+TPG + S +     
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI----- 175

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
                           P+N     H   +KKNE+   VNE +++LVS+DGSILK+YVDG 
Sbjct: 176 ----------------PTN----RHD-AHKKNEIFFFVNESMNLLVSKDGSILKNYVDGK 214

Query: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQC 296
           I++ +HL+G P CQF        E  DD  +++ DF                   KF QC
Sbjct: 215 IEIKSHLNGNPTCQF--------ELVDDQ-TKITDF-------------------KFDQC 246

Query: 297 VSLDKFNKDRVIKFVPPDGSMELMKYCVRDN-LNLPFKVTPIVTSIGRGNTIDYRVTLKS 355
           +  +K  + R ++    DG +E++ Y VRD+ +N+PFK+TPIV+++   +T+DYR++LKS
Sbjct: 247 I--EKV-QSRTVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVK--DTVDYRISLKS 301

Query: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAV 415
           LFP  LSA DV L IPVPP T+DC+INVSNG CKF  E++A+IW F K+ G TENTLSA+
Sbjct: 302 LFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAI 361

Query: 416 TVPSSDTTQ-LTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDE-RYRTAKWIKYIS 473
           T+  +D  Q + ++ W RP + L FEI M+S SGL++R   ++DKD+ RY+ ++WIKYIS
Sbjct: 362 TI--ADGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYIS 419

Query: 474 KSGSYEIRY 482
           ++GSYE+R+
Sbjct: 420 RAGSYEMRF 428

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  207 bits (526), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 248/489 (50%), Gaps = 52/489 (10%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS---PILTLGSTTFHHI 57
           M S I    S+G+ I+++  K  +  +  D F + ++      S   P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDT 115
           + +    L+++ ++RS + N   ++ FLYK+  V+ +   + +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++ G IP  TE     +KM     KQ           +T  S  L      S  +  P 
Sbjct: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLMKSAKKSKNVIRPP 157

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
               N+              +SWRP GI YKKNE  L+V E I++L+++ G +L+S + G
Sbjct: 158 IALTNS--------------VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILG 203

Query: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295
            + + +HLSGMP  + GLND     F +     VED A+  +        + LED KFHQ
Sbjct: 204 KVKVKSHLSGMPDLKLGLNDKGI--FSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQ 261

Query: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKS 355
           CV L KF  +++I F+PPDG  ELM Y +   +  P     I   +   + I+     K+
Sbjct: 262 CVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKA 320

Query: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA- 414
               K +A +V + IPVP      +   S+G  K+ PE++A++WK   + G  E +++A 
Sbjct: 321 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQ 380

Query: 415 VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473
           + +PS SD  +  +++    P+ + F+I  F+ SG+ VRY K+++   +Y++  W++YI+
Sbjct: 381 LGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYIT 436

Query: 474 KSG-SYEIR 481
           +SG  Y IR
Sbjct: 437 QSGDDYTIR 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  206 bits (524), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/493 (28%), Positives = 257/493 (52%), Gaps = 63/493 (12%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M S +    S+G+ ++++  +  + +S  + F+  ++   +  S ++         H++ 
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQ-HLLLEREQESSVMPPCFHHNGIHYMY 59

Query: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTV 116
              +D ++++A++RS + N+  ++ F+YKL NV+ +     +E ++++N++  YE+LD +
Sbjct: 60  VQYND-VYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEM 118

Query: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176
           +++G +P  TE     +KM     KQ           +T  S  L+        ++ P  
Sbjct: 119 MDKG-VPQVTE-----TKML----KQ----------YITQKSFKLTRSAKKQKNVARP-- 156

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
                        +   +++SWRP GIKYKKNE  L+V E I++L+++ G +L+S + GT
Sbjct: 157 ------------PTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGT 204

Query: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQC 296
           + + + LSGMP  + GLND      G  + ++ ED        K     + LED KFHQC
Sbjct: 205 VKVRSRLSGMPDLKLGLNDK-----GIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQC 259

Query: 297 VSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYRV 351
           V L KF  +++I F+PPDG  +LM Y     L+ P K  P++       +  G+ I+   
Sbjct: 260 VRLSKFENEKIITFIPPDGEFDLMTY----RLSTPIK--PLIWCDVKVQVHSGSRIEIHC 313

Query: 352 TLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENT 411
             K+    K  A +V + IP+P          S G  K+VPE++A++WKF+ + G  E +
Sbjct: 314 RAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYS 373

Query: 412 LSA-VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469
           ++A + +PS SD     +++    P+ + F+I  F+ SG+ VRY K+ +   +Y +  W+
Sbjct: 374 MAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWV 429

Query: 470 KYISKSG-SYEIR 481
           +YI++SG  Y IR
Sbjct: 430 RYITQSGDDYTIR 442

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  202 bits (515), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 147/489 (30%), Positives = 247/489 (50%), Gaps = 55/489 (11%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SAI     +G  ++++  +  +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+      ++LVA++     N   ++ FLYK+ +V+ D     +E ++++N++  YE+LD
Sbjct: 60  IQHS---DIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            +++  GIP  TE     +KM     KQ           +T  S  L          + P
Sbjct: 117 ELMD-YGIPQITE-----TKML----KQ----------YITQKSFKLVKAAKKKQNAARP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                          S    ++SWR  GIKYKKNE  L++ E I++L+++ G IL+S + 
Sbjct: 157 --------------PSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL 202

Query: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFH 294
           G + + + LSGMP  + G+ND      G  S    ED  N  A  K    ++ LED KFH
Sbjct: 203 GVVKIKSRLSGMPDLKLGINDK-----GIFSKQLTEDDTNNNATSK-KQNKIELEDLKFH 256

Query: 295 QCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLK 354
           QCV L KF  +++I F+PPDG  ELM Y +  ++  P     +   +   + I+     K
Sbjct: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAK 315

Query: 355 SLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA 414
           +    K +A +V + IPVP          S+G  K+VPE+SA++WK   + G  E +++A
Sbjct: 316 AQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAA 375

Query: 415 -VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473
            + +PS+ +    VQ   + P+ + F+I  F+ SG+ VRY K+++   +Y++  W++YI+
Sbjct: 376 ELCLPSTSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 433

Query: 474 KSG-SYEIR 481
           +SG  Y IR
Sbjct: 434 QSGDDYTIR 442

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  202 bits (514), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 146/495 (29%), Positives = 248/495 (50%), Gaps = 70/495 (14%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M S I    ++G++I+++  +  +  S  + F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVYGLT-KEGTLKENFMNCYEILDT 115
           + +    ++++ +SRS + N   ++ FLYKL  ++  Y  T +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +L+ G IP  TE   +   +T K  K I                   +   S + +  P 
Sbjct: 118 MLDYG-IPQITETKMLKQYITQKSYKLIK------------------SAKKSKNVIRPPS 158

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
            LT++               +SWRP GI YKKNE  L+V E I++L++  G +L+S + G
Sbjct: 159 QLTKS---------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILG 203

Query: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295
            +++ + LSGMP  + GLND          I    + A+     +     + LED KFHQ
Sbjct: 204 KVNVRSRLSGMPDLKLGLNDK--------GIFTSVESASSSEATEGKKSNIELEDLKFHQ 255

Query: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYR 350
           CV L KF  +++I F+PPDG  ELM Y     L+ P K  P++       +   + I+  
Sbjct: 256 CVRLSKFENEKIITFIPPDGDFELMNY----RLSTPIK--PLIWCDAKIQVHSQSRIEIH 309

Query: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410
              K+    K +A +V + IPVP      +   S+G  K+VPE+SA++WK   + G  E 
Sbjct: 310 CRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEY 369

Query: 411 TLSA-VTVPSSDTTQLTVQQWPRP--PMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAK 467
           + +A + +PS     +T  + PR   P+ + F+I  F+ SG+ VRY K+++   +Y++  
Sbjct: 370 SFAAQLGLPS-----MTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYP 424

Query: 468 WIKYISKSG-SYEIR 481
           W++YI++SG  Y IR
Sbjct: 425 WVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  201 bits (510), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 147/493 (29%), Positives = 243/493 (49%), Gaps = 66/493 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M S I    + G++I+++  +  +  S  + F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDT 115
           + +    ++++ +SRS + N   ++ FLYKL  V+ +     +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +L+ G IP  TE   +   +T K  K I              S N+  P         P 
Sbjct: 118 MLDYG-IPQITETKMLKQYITQKSYKLIKS---------VKKSKNVVRP---------PA 158

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
            LT++               +SWRP GI YKKNE  L+V E I++L++  G +L+S + G
Sbjct: 159 QLTKS---------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILG 203

Query: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295
            + + + LSGMP  + GLND          I   E+  N           + LED +FHQ
Sbjct: 204 KVKVRSRLSGMPDLKLGLNDK--------GIFTSEEGGNNAEGGSGKKSNIELEDLQFHQ 255

Query: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYR 350
           CV L KF  +++I F+PPDG  +LM Y     L+ P K  P++       +   + I+  
Sbjct: 256 CVRLSKFENEKIISFIPPDGDFDLMNY----RLSTPIK--PLIWCDAKIQVHSQSRIEIH 309

Query: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410
              K+    K +A +V + IPVP      +   S+G  K+VPE+SA++W+   + G  E 
Sbjct: 310 CRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEY 369

Query: 411 TLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469
           + +A + +PS   T + V +  R P+ + F+I  F+ SG+ VRY KV +   +Y++  W+
Sbjct: 370 SFAAQLGLPS--MTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWV 426

Query: 470 KYISKSG-SYEIR 481
           +YI++SG  Y IR
Sbjct: 427 RYITQSGDDYTIR 439

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  197 bits (502), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 249/491 (50%), Gaps = 53/491 (10%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+    S+G  ++A+  +  +  S  + F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+ +    ++LVA++ S +AN+  I+ FLYKL +V+ +     +E ++++NF+  YE+LD
Sbjct: 91  IQHN---DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
             ++  GIP  TE     +KM     KQ           +T  S  L          + P
Sbjct: 148 ETMD-YGIPQITE-----TKML----KQ----------YITQKSFKLVKAAKKKRNAARP 187

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                N+              +SWR   IKYKKNE  L++ E I++L+++ G IL+S + 
Sbjct: 188 PEALTNS--------------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII 233

Query: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCK 292
           G + + + LSGMP  + G+ND    S    DDS++  E  +   +        + LED K
Sbjct: 234 GEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNN-EGASVASSTTDKKKNNIELEDLK 292

Query: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVT 352
           FHQCV L KF  +++I F+PPDG  ELM Y +  ++  P     +   +   + I+    
Sbjct: 293 FHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCR 351

Query: 353 LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTL 412
            K+    K +A +V + IPVP      E   S+G  K+VPE++ +IWK   + G  E ++
Sbjct: 352 AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSM 411

Query: 413 SA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
           SA + +PS    +   +   + P+ + F+I  F+ SG+ V+Y K+++   +Y++  W++Y
Sbjct: 412 SAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRY 468

Query: 472 ISKSG-SYEIR 481
           I++SG  Y IR
Sbjct: 469 ITQSGDDYTIR 479

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  196 bits (499), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 143/498 (28%), Positives = 249/498 (50%), Gaps = 71/498 (14%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVI---NNLDVRSPILTLGSTTFHHI 57
           M S I    ++G+L++++  K  +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDT 115
           + +    L+++ ++RS  AN   ++ FL+ L +V+ +   + +E ++K+NF+  YE+LD 
Sbjct: 61  QHN---DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           V++  GIP                  QI+   + R   +T  S  L         +  P 
Sbjct: 118 VMD-SGIP------------------QITDTKMLR-QYITQKSFKLIRSAKKKKNVVRP- 156

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
                         S+  + +SWRP GIKYKKNE  L+V E I++++++ G +L+S + G
Sbjct: 157 -------------PSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILG 203

Query: 236 TIDLTTHLSGMPICQFGLND----SLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDC 291
            + + + LSGMP  + GLND    + S E  +D  S       KK+        + LED 
Sbjct: 204 KVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSSQPSITRKKS-------NIELEDL 256

Query: 292 KFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNT 346
           KFHQCV L KF  +++I F+PPDG  ELM Y     L+ P K  P++       +   + 
Sbjct: 257 KFHQCVRLSKFENEKIITFIPPDGDFELMSY----RLSTPIK--PLIWCDAKIQVHSRSR 310

Query: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406
           ++     K+    K +A +V + IPVP      +   S+G  K+VPE++A++WK   + G
Sbjct: 311 VEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPG 370

Query: 407 LTENTLSA-VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYR 464
             + +++A + +PS +D      ++    P+ + F+I  F+ SG+ VRY K+++   +Y 
Sbjct: 371 GKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYN 426

Query: 465 TAKWIKYISKSGS-YEIR 481
           +  W++YI++SG  Y IR
Sbjct: 427 SYPWVRYITQSGEDYIIR 444

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  196 bits (497), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 255/512 (49%), Gaps = 70/512 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+      G+ ++++  +  +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+ +    L++VA+  S +AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 60  IQHN---DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            V++ G IP  TE     +KM     KQ           +T  S  L          + P
Sbjct: 117 EVMDYG-IPQITE-----TKML----KQ----------YITQKSFKLVKSAKKKRNATRP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                N+              +SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 157 PVALTNS--------------VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII 202

Query: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDD--------SISEVEDFANKK-AIPKAAA 283
           G + + + LSGMP  + G+ND    S    DD        + S+     +KK +I  ++A
Sbjct: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSA 262

Query: 284 G-----RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV 338
                  + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P     + 
Sbjct: 263 TNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVN 321

Query: 339 TSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMI 398
             +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+SA++
Sbjct: 322 VQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAIL 381

Query: 399 WKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRP-------PMSLNFEIMMFSNSGLV 450
           WK   + G  E ++SA + +PS    +   +  P+        P+ + F+I  F+ SG+ 
Sbjct: 382 WKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQ 441

Query: 451 VRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
           VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 442 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  194 bits (493), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 150/516 (29%), Positives = 256/516 (49%), Gaps = 75/516 (14%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+      G+ ++++  +  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+ +    L+LVA++ S +AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 60  IQHN---DLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            V++ G IP  TE     +KM     KQ           +T  S  L          + P
Sbjct: 117 EVMDYG-IPQITE-----TKML----KQ----------YITQKSFKLVKSAKKKRNATRP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                N+              +SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 157 PVALTNS--------------VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEII 202

Query: 235 GTIDLTTHLSGMPICQFGLND-SLSVEFGDDS--------------ISEVEDFANKKAIP 279
           G + + + LSGMP  + G+ND  +  ++ DDS               ++V D   K +I 
Sbjct: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDV-DTDKKPSIT 261

Query: 280 KAAAG-----RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKV 334
            ++        + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P   
Sbjct: 262 SSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIW 320

Query: 335 TPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEE 394
             +   +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+
Sbjct: 321 CDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEK 380

Query: 395 SAMIWKFTKYTGLTENTLSA-VTVPS-------SDTTQLTVQQWPRPPMSLNFEIMMFSN 446
           SA++WK   + G  E ++SA + +PS       S T      +  + P+ + F+I  F+ 
Sbjct: 381 SAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTT 440

Query: 447 SGLVVRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
           SG+ VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 441 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  193 bits (491), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 257/496 (51%), Gaps = 60/496 (12%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M+S I    + G+ I+A+  +  +  +  D F  Q++  L+  + ++   +     H++ 
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59

Query: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDTV 116
              SD +++VA++ S   N   I+ FL++L  +++ Y  +  E ++++NF+  YE+LD +
Sbjct: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118

Query: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176
           ++  GIP  TE     +KM  K   Q S  L+      +    N + P         P  
Sbjct: 119 MD-FGIPQITE-----TKMLKKYITQKSFKLIKT--STSKKKKNAARP---------PAE 161

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
           LT               +++SWRP GI YKKNE  L++ E I++LV++ G +L+S + G 
Sbjct: 162 LT---------------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGA 206

Query: 237 IDLTTHLSGMPICQFGLND-SLSVEFGDDSISEVEDFANKKAIPKAAAGR---VMLEDCK 292
           + + + LSGMP  + G+ND  +   + ++  + V+  ++   IP+    +   + LED K
Sbjct: 207 VRVRSRLSGMPDLKLGINDRGIFSNYLEE--NNVDGSSSSTPIPEGVEDKKPQIELEDLK 264

Query: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTI 347
           FHQCV L KF  +++I F+PPDG  +LM Y     L  P K  P++       +   + I
Sbjct: 265 FHQCVRLSKFENEKIITFIPPDGEFDLMNY----RLTTPIK--PLIWCDVNIQVHSKSRI 318

Query: 348 DYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGL 407
           +     K+    K  A +V + IPVP      +   S+G  K++PE++A++WK   + G 
Sbjct: 319 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGG 378

Query: 408 TENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTA 466
            E ++SA + +PS D  +       R P+ + F+I  F+ SG+ VRY KV++   +Y++ 
Sbjct: 379 KEYSMSAQLHLPSVDGVEPPKV---RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSY 435

Query: 467 KWIKYISKSGS-YEIR 481
            W++YI++SG  Y IR
Sbjct: 436 PWVRYITQSGEDYTIR 451

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  194 bits (492), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 149/513 (29%), Positives = 250/513 (48%), Gaps = 71/513 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+      G+ ++++  +  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+ +    L+LVA+  S  AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 60  IQHN---DLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            V++ G IP  TE     +KM     KQ           +T  S  L          + P
Sbjct: 117 EVMDYG-IPQITE-----TKML----KQ----------YITQKSFKLVKSAKKKRNATRP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                N+              +SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 157 PVALTNS--------------VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII 202

Query: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDDS-----ISEVEDFANKKAIPKAAAG--- 284
           G + + + LSGMP  + G+ND    S    +DS     +S      N     K +     
Sbjct: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSS 262

Query: 285 -------RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPI 337
                   + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P     +
Sbjct: 263 TTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDV 321

Query: 338 VTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAM 397
              +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+SA+
Sbjct: 322 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAI 381

Query: 398 IWKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRP-------PMSLNFEIMMFSNSGL 449
           +WK   + G  E ++SA + +PS  T++   +  P+        P+ + F+I  F+ SG+
Sbjct: 382 LWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGI 441

Query: 450 VVRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
            VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 442 QVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  193 bits (490), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 148/512 (28%), Positives = 256/512 (50%), Gaps = 77/512 (15%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+S+I    S+G+ ++++  +  +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115
           + +    L++VA++ S + N+  ++ FL+KL  +M  Y    +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++ G IP  TE     +KM     KQ           +T  S  L          + P 
Sbjct: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLVKAAKKKRNAARPP 157

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
               N+              +SWRP GIKYKKNE  L++ E I++L+++ G +L+S + G
Sbjct: 158 QALTNS--------------VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIG 203

Query: 236 TIDLTTHLSGMPICQFGLND---------SLSVEFGDDSISEVEDFANKKAIPKAAAGR- 285
            + + + LSGMP  + G+ND         S S     +  +  E  ++K + P+ + G+ 
Sbjct: 204 EVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQD 263

Query: 286 ---------VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTP 336
                    V LED KFHQCV L KF  +++I F+PPDG+ ELM Y     L  P K  P
Sbjct: 264 EGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSY----RLTTPIK--P 317

Query: 337 IV-----TSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFV 391
           ++       +   + ++     K+    K  A +V + IPVP          S+G  K+V
Sbjct: 318 LIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWV 377

Query: 392 PEESAMIWKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLV 450
           PE++A++WK   + G  E +++A + +PS D  +   +   + P+ + F+I  F+ SG+ 
Sbjct: 378 PEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQ 434

Query: 451 VRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
           VRY KV++   +Y++  W++YI++SG  Y IR
Sbjct: 435 VRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  192 bits (489), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 145/511 (28%), Positives = 256/511 (50%), Gaps = 77/511 (15%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+     +G+ ++++  +  +  S  D F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVYGLT-KEGTLKENFMNCYEILD 114
           I+ +    L+L A++ S  AN   I+ FL+K+  ++D Y  T +E ++++NF+  YE+LD
Sbjct: 60  IQHN---DLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            +++ G +P  TE     +KM  K               +T  S  L          + P
Sbjct: 117 EMMDYG-LPQITE-----TKMLKK--------------YITTKSFKLEKAHKKKRNAARP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                          +   +++SWRP GIKYKKNE  L++ E I++L+++ G +L+S + 
Sbjct: 157 P--------------TELTNSVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIV 202

Query: 235 GTIDLTTHLSGMPICQFGLND-SLSVEF-----------GDDSISEVEDFANKKAIPKAA 282
           G + + + LSGMP  + G+ND  +  ++           GDD   + +D  N+ +I    
Sbjct: 203 GNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAKNGDD--EDADDTNNESSIVSEG 260

Query: 283 AGR----VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV 338
           + +    + LED KFHQCV L KF  +++I F+PPDG  +LM Y       L   + P++
Sbjct: 261 SNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFDLMNY------RLSTSIKPLI 314

Query: 339 ---TSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEES 395
               SI +   I+     K+    K  A +V + IPVP          S+GK K++PE++
Sbjct: 315 WCDVSI-QTYRIEIHCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKN 373

Query: 396 AMIWKFTKYTGLTENTLSA-VTVPS---SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVV 451
            ++WK + + G  E +++A + +PS    D     V    + P+ + F+I  F+ SG+ V
Sbjct: 374 LLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQV 433

Query: 452 RYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
           RY KV++   +Y+T  W++YI++SG  Y IR
Sbjct: 434 RYLKVNEPKLQYKTYPWVRYITQSGDDYTIR 464

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  191 bits (484), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 254/495 (51%), Gaps = 55/495 (11%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVIN---NLDVRSPILTLGSTTFHHI 57
           M SAI    ++G  ++++  +  +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYK-LNVIMDVYGLTKEGTLKENFMNCYEILDT 115
           + +    L+LVA++ S + N+  I+ FL+K + V+ +     +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++  GIP  TE            PK +   +  +   L  ++          ++L+   
Sbjct: 118 MMD-YGIPQITE------------PKMLKQYITQKSFKLKKAAKKKRNAARPPTSLT--- 161

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
                             +++SWRP GIK+KKNE  L++ E I++L+++ G +L+S + G
Sbjct: 162 ------------------NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIG 203

Query: 236 TIDLTTHLSGMPICQFGLND----SLSVEFGDDS---ISEVEDFANKKAIPKAAAGRVML 288
            + + + LSGMP  + G+ND    S  +E GD++   I+  +   ++    K  +  + L
Sbjct: 204 EVKVKSKLSGMPDLKLGINDKGLFSKYLE-GDENGVPIAPDDSSVDESKPKKKRSNNMEL 262

Query: 289 EDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTID 348
           ED KFHQCV L KF  ++ I F+PPDG  ELM Y +   +  P     +       + I+
Sbjct: 263 EDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIE 321

Query: 349 YRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLT 408
                K+    K +A +V + IPVP          S+G  K+VPE++A++WK   + G  
Sbjct: 322 IFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDK 381

Query: 409 ENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAK 467
           E +++A + +PS++  + + +   + P+ + F+I  F+ SG+ VRY K+ +K+ +Y++  
Sbjct: 382 EYSMAAEMGLPSTNAGEESEKL--KRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYP 439

Query: 468 WIKYISKSG-SYEIR 481
           W++YI+KSG  Y IR
Sbjct: 440 WVRYITKSGDDYTIR 454

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  189 bits (479), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 140/502 (27%), Positives = 243/502 (48%), Gaps = 64/502 (12%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M SA+     +G+ ++++  K  +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVYGLT-KEGTLKENFMNCYEILDT 115
           + +    L++VA++ S   N   ++ FL+KL  ++  Y  T +E ++++NF+  YE++D 
Sbjct: 61  QHN---DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++ G IP  TE            P+ +          +T  S  L          + P 
Sbjct: 118 MMDYG-IPQITE------------PRMLK-------KYITQKSFKLEKAHKKKRNAARPP 157

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
                         S   +++SWR  GIKYKKNE  L++ E I++L+++ G +L+S + G
Sbjct: 158 --------------SELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIG 203

Query: 236 TIDLTTHLSGMPICQFGLND-----------SLSVEFGDDSISEVEDFANKKAIPKAAAG 284
            + + + LSGMP  + G+ND           ++ V   D    E      + +I      
Sbjct: 204 AVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQ--EHGSGVAESSITNDGKK 261

Query: 285 R---VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSI 341
           R   + LED KFHQCV L KF  +++I F+PPDG  +LM Y +  ++  P     +   +
Sbjct: 262 RKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQV 320

Query: 342 GRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKF 401
              + I+ R   K+    K  A +V + IPVP          S+G  K+VPE+SA++WK 
Sbjct: 321 HSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKI 380

Query: 402 TKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKD 460
             + G  E  + A + +PS D+ +   +   + P+ + FEI  F+ SG+ VRY K+++  
Sbjct: 381 KSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPK 437

Query: 461 ERYRTAKWIKYISKSG-SYEIR 481
            +Y++  W++YI++SG  Y IR
Sbjct: 438 LQYKSYPWVRYITQSGDDYTIR 459

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 146/513 (28%), Positives = 247/513 (48%), Gaps = 71/513 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA+      G+ ++++  +  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114
           I+ +    L+LVA+  S  AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 60  IQHN---DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
            V++ G IP   E     +KM     KQ           +T  S  L          + P
Sbjct: 117 EVMDYG-IPQICE-----TKML----KQ----------YITQKSFKLVKSAKKKRNATRP 156

Query: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
                N+              +SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 157 PVALTNS--------------VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII 202

Query: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDD-------SISEVEDFANKKAIPKAAAG- 284
           G + + + LSGMP  + G+ND    S    DD       S +  ++  +    P   +  
Sbjct: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSS 262

Query: 285 -------RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPI 337
                   + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P     +
Sbjct: 263 TTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDV 321

Query: 338 VTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAM 397
              +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+SA+
Sbjct: 322 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAI 381

Query: 398 IWKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRP-------PMSLNFEIMMFSNSGL 449
           +WK   + G  E ++SA + +PS        +  P+        P+ + F+I  F+ SG+
Sbjct: 382 LWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGI 441

Query: 450 VVRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481
            VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 442 QVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 136/489 (27%), Positives = 244/489 (49%), Gaps = 55/489 (11%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M S I    S+G+L++++  K  +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115
           + +    L+++ +++S + N   ++ +L+KL  +++ Y  + +E ++K+NF+  YE+LD 
Sbjct: 61  QHN---DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++ G IP                  QI+   + R   +T  S  L         +  P 
Sbjct: 118 MMDHG-IP------------------QITDTKMLR-QYITQKSFKLIRSAKKKKNVVRPP 157

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
               N+              +SWRP GI YKKNE  L+V E I++L+++ G +L+S + G
Sbjct: 158 ATLTNS--------------VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILG 203

Query: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295
            + + + LSGMP  + GLND     F      + E+ A+     K+    + LED KFHQ
Sbjct: 204 KVKVKSRLSGMPDLKLGLNDKGI--FAQGDDDDDEEGASGGTKKKS---NIELEDLKFHQ 258

Query: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKS 355
           CV L KF  +++I F+PPDG  ELM Y +   +  P     +   +   + I+     K+
Sbjct: 259 CVRLTKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKA 317

Query: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA- 414
               K +A +V + IPVP      +   S+G  K+VP ++A++WK   + G  + +++A 
Sbjct: 318 QIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAE 377

Query: 415 VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473
           + +PS SD +   +++    P+ + F+I  F+ SG+ VRY K+++   +Y +  W++YI+
Sbjct: 378 MGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYIT 433

Query: 474 KSG-SYEIR 481
           +SG  Y IR
Sbjct: 434 QSGDDYTIR 442

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 57/494 (11%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M+S +    + G+ I+++  +  +  S  D F  Q++   +  S ++   L     H++ 
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59

Query: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTV 116
              SD +++VA++ S   N   I+ FL++L +V+ D     +E ++++NF+  YE+LD +
Sbjct: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118

Query: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176
           ++  GIP  TE     +KM     KQ           +T  S  L          + P  
Sbjct: 119 MDY-GIPQITE-----TKML----KQ----------YITQKSFKLIKAAKKKRNAARPPV 158

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
              N              ++SWR  GIKYKKNE  L++ E I++L+++ G +L+S + G 
Sbjct: 159 ALTN--------------SVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGE 204

Query: 237 IDLTTHLSGMPICQFGLND----SLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCK 292
           + + + LSGMP  + G+ND    S  +E  ++  S+     N  +        + LED K
Sbjct: 205 VKVKSRLSGMPDLKLGINDKGIFSKYLE-NEEDFSKPVQIINDDSTTNGKKSNIELEDLK 263

Query: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVT 352
           FHQCV L KF  +++I F+PPDG  ELM Y +   +  P     I   +   + I+    
Sbjct: 264 FHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCR 322

Query: 353 LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTL 412
            K+    K  A +V + IPVP          S+G  K++PE++A++WK   + G  E ++
Sbjct: 323 AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSM 382

Query: 413 SA-VTVPSSDTTQLTVQQWP---RPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKW 468
           +A + +PS D  +      P   + P+ + F+I  F+ SG+ VRY K+++   +Y++  W
Sbjct: 383 TAQLGLPSVDGIE------PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPW 436

Query: 469 IKYISKSG-SYEIR 481
           ++YI++SG  Y IR
Sbjct: 437 VRYITQSGDDYTIR 450

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  184 bits (467), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 144/492 (29%), Positives = 248/492 (50%), Gaps = 63/492 (12%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M+S I     +G  I+++  +  +  S  D F   ++ +L+  S ++   L      ++ 
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 59  SDGSDSLWLVAVSRSNA-NSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTV 116
            +  D L++VA+S S A N+  ++ FL+KL   + D     +E ++++NF+  YE+LD +
Sbjct: 60  IEHED-LYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176
           ++ G IP  TE   +   +T K  K I                         +T   P  
Sbjct: 119 MDYG-IPQITETKMLKQYITQKSFKLIKAV------------------KKVKATARPPTG 159

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236
           LT               +++SWR  GI YKKNE  L++ E I++++++ G +L+S + G 
Sbjct: 160 LT---------------NSVSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQ 204

Query: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQC 296
           + + + LSGMP  + G+ND   +   D    E +  A KK   K++A    LED KFHQC
Sbjct: 205 VIVRSRLSGMPDLKLGINDK-GIFTRDPETGESQVTAGKK---KSSAE---LEDLKFHQC 257

Query: 297 VSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYRV 351
           V L KF  +++I F+PPDG  ELM Y     L  P K  P++       +   + I+   
Sbjct: 258 VRLSKFENEKIITFIPPDGEFELMSY----RLTTPVK--PLIWCDVNVQVHSKSRIEIHC 311

Query: 352 TLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENT 411
             K+    K  A +V + IPVP          S+G  K+VPE++A++WK   + G  E +
Sbjct: 312 RAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYS 371

Query: 412 LSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIK 470
           ++A + +PS +  +    ++ R P+ + F+I  F+ SG+ VRY K+++   +Y++  W++
Sbjct: 372 MAAQMGLPSINGVEKP--KFKR-PVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 428

Query: 471 YISKSG-SYEIR 481
           YI+++G  Y IR
Sbjct: 429 YITQNGDDYTIR 440

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  184 bits (466), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 242/491 (49%), Gaps = 68/491 (13%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+SA+     +G  I+++  +  +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSDGSDSLWLVAVSRSNA-NSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115
           + +    L++VA++ S A N   ++ FL+KL  +++ Y    +E ++++NF+  YE+LD 
Sbjct: 61  QHN---DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117

Query: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           +++ G IP  TE     +KM     KQ           +T  S  L      S     P 
Sbjct: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLMKAVKKSKAAPRPP 157

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235
               N+              +SWR   I +KKNE  L++ E I++L+++ G +L+S + G
Sbjct: 158 TEVTNS--------------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIG 203

Query: 236 TIDLTTHLSGMPICQFGLND----SLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDC 291
            I + + LSGMP  + G+ND    S  VE   D ++       KK         + LED 
Sbjct: 204 QIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT-------NIELEDL 256

Query: 292 KFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNT 346
           KFHQCV L KF  +++I F+PPDG+ ELM Y     L++P K  P++       +   + 
Sbjct: 257 KFHQCVRLSKFENEKIITFIPPDGAFELMNY----RLSMPVK--PLIWCDVNVQVHSQSR 310

Query: 347 IDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTG 406
           I+     ++    +  A  V + IPVP          ++G  K+VP+++A++WK   +TG
Sbjct: 311 IEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTG 370

Query: 407 LTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRT 465
             E ++SA + +PS +      +   + P+ + F+I  F+ SG+ VRY K+++    Y++
Sbjct: 371 GKEYSMSAQMGLPSINALD---KPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKS 427

Query: 466 AKWIKYISKSG 476
             W++YI++SG
Sbjct: 428 YPWVRYITQSG 438

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  103 bits (257), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 113/483 (23%), Positives = 203/483 (42%), Gaps = 95/483 (19%)

Query: 45  PILTLGSTTFHHIRSDGS---DSLWLVAVS---RSNANSGAIWEFLYKLNVIMDVYGLTK 98
           P+       F +IR DG     ++ LVA +   +S+ N  AI  +L     ++  Y  ++
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQ 103

Query: 99  E---GTLKENFMNCYEILDTVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLT 155
           +     + +NF   YE+LD  L+  G+P  T+ N +   + V+         ++  D L 
Sbjct: 104 KLNRWLIVDNFHLIYELLDESLD-FGVPQLTDYNIIQDYIKVQ---------VNLHDELA 153

Query: 156 MSSLNLSTPGDSSSTLSMPKFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVN 215
            SS  +S   D             +   M+  +     S +SWRP GI Y KNE  L+V 
Sbjct: 154 DSSKKISKKEDLHG-------FEDDESYMNSFIARTTTSAISWRPKGIHYTKNEFFLDVI 206

Query: 216 EKISILVSRDGS-ILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFAN 274
           E+I   +  + S I K++V G I   ++LSGMP  + GL+   S                
Sbjct: 207 EEIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITS---------------- 250

Query: 275 KKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKV 334
             ++PK       + + KFHQCVSL+   K+ ++ F+PPDG  +L +Y ++ ++  P  +
Sbjct: 251 --SLPKEREQ--FMNNAKFHQCVSLEDLQKN-IVSFIPPDGEFQLCEYKLKRHVRDPPVI 305

Query: 335 TPIVTSIGRGN----TIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVS------ 384
             +   + +       I   +T+ + F  + S   +++RIP+     + +I+++      
Sbjct: 306 KLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFK 365

Query: 385 --NGKCKFVPEESAMIWKF---------TKYTGLTENTLSAVTVPSSDTTQLTVQQWPRP 433
              G   F   +  ++W+          T+++   E  L           +L     P P
Sbjct: 366 CDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDP-P 424

Query: 434 PM-------------------------SLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKW 468
           P+                         S+ FEI  ++ SGL V+Y K+ +   +Y +  W
Sbjct: 425 PLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPW 484

Query: 469 IKY 471
           ++Y
Sbjct: 485 VRY 487

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 111/491 (22%), Positives = 200/491 (40%), Gaps = 101/491 (20%)

Query: 43  RSPILTLGSTTFHHIRSDGSDSLWLVAVSRSNA--NSGAIWEFLYKLNVIMDVY----GL 96
           R P++      + +I  DG   L+ V+VS      N   I  +L   + ++  Y     +
Sbjct: 41  RGPVIYSKGIIYIYILRDG---LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKV 97

Query: 97  TKEGTLKENFMNCYEILDTVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTM 156
            + G + +NF   YE+ D  L+ G IP  T+ N       ++   +I  N+   P     
Sbjct: 98  DRTGII-DNFNLIYELFDESLDYG-IPQLTDYN------IIRDSIKIEANVPKVPSNSQA 149

Query: 157 SSLNLSTPGDSSSTLSMPKFLTRNNRSMSQDLGS----NYPSNLSWRPHGIKYKKNEVLL 212
            S   S P    S  +  K      R   Q + S         +SWRP GI Y KNE+ +
Sbjct: 150 DSDEESGPEILQSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFV 209

Query: 213 NVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVED 271
           ++ E+ S L+  ++  + +++V G I+  ++LSGMPI +  +N  L              
Sbjct: 210 DIIERQSYLMDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLK------------- 256

Query: 272 FANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLP 331
                         + L   KFHQCVSL+  +    I+F+PPDG  +L +Y ++ ++N  
Sbjct: 257 -----------DKDLFLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN-- 303

Query: 332 FKVTPIVTSIG-------RGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVS 384
              +PI+  I        + + +   VT++  F  + SA  + + IP      + +I+++
Sbjct: 304 --DSPIIKLIDYKINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLT 361

Query: 385 --------NGKCKFVPEESAMIWKF---------TKYTGLTENTLSAVTVPSSDTTQLTV 427
                   +G   F   +  ++W           T Y+   E  L      +    Q+  
Sbjct: 362 KAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKK 421

Query: 428 QQWPRP---------------------------PMSLNFEIMMFSNSGLVVRYFKVSDKD 460
              P P                            ++  FE+  +++SGL V Y K+S+++
Sbjct: 422 SMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEEN 481

Query: 461 ERYRTAKWIKY 471
            +Y++  W++Y
Sbjct: 482 LKYQSFSWVRY 492

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 129/532 (24%), Positives = 219/532 (41%), Gaps = 104/532 (19%)

Query: 1   MISAILIFSSRGELIVAKTMKS--SLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIR 58
           MIS + I     +L+  + +K   SL + +    R         +SPIL      +  I+
Sbjct: 1   MISCLFILDEELQLLTVRLLKPVPSLLEPLEWFIR------HPKKSPILQNMDYDYIFIQ 54

Query: 59  SDGSDSLWLVAVSR--SNANSGAIWEFLYKLNVIMDVY---GLTKEGTLKENFMNCYEIL 113
            DG   L+ +++S   +N     ++ +L +L+++   Y    L K   +  NF   +E++
Sbjct: 55  RDG---LYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNK-VLITGNFHLIHELI 110

Query: 114 DTVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSM 173
           D  +   G P  T+ N +   + V+  K       D P+  T  +   +T  +       
Sbjct: 111 DESIF-MGTPQLTDYNIIRDYIKVQVVK-------DSPEPATREATVTNTKKNKKKDSKK 162

Query: 174 PKFLTR--NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKS 231
            +  T   +   M+  +     S +SWRP GI Y KNE  L+V E +  LV      +KS
Sbjct: 163 KEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKS 222

Query: 232 -YVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLED 290
             V G I   ++LSGMP+   GLN  L+        SE E F  +               
Sbjct: 223 NTVYGYIQCRSYLSGMPMLTIGLN-KLN--------SENEYFMRR--------------- 258

Query: 291 CKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLP---------FKVTPIVTSI 341
             FHQCV+LD+   D++I F PPDG  +L  Y +  N++ P          K+ P  T  
Sbjct: 259 ANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKD 318

Query: 342 GRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVS--------NGKCKFVPE 393
           G    I   VT+ + F  + S   +++++P+     D ++++S         GK  F   
Sbjct: 319 GLDRLI-LAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNIT 377

Query: 394 ESAMIWKFTKYTG---------LTENTLSAVTVPSSDTTQLTVQQWPRP----------- 433
           +  ++W+  K  G          +E  L      +    QL+    P+P           
Sbjct: 378 DDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLY 437

Query: 434 --------PMS------LNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
                   P S      + FEI  ++ SGL V + K+ +K  ++++  W++Y
Sbjct: 438 QQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 94.0 bits (232), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 114/538 (21%), Positives = 227/538 (42%), Gaps = 112/538 (20%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M S+I +   +   ++ K+ KS ++   +  +R + +  +    P++      F  I  D
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS-VQHPEAFAYRFKEVYKVS-NVPVIYHKGIVFISICRD 58

Query: 61  GSDSLWLVAVS----RSNANSGAIW--EFLYKLNVIMDVYGLTKEGTLKENFMNCYEILD 114
           G   L+ V++S    RS+  S  ++  +F   L   + V  L +   + +NF   YE+LD
Sbjct: 59  G---LYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIV-DNFNLIYELLD 114

Query: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174
             L+  GIP  T+ N +   + ++P      N+   P +   +S +  +  + S+     
Sbjct: 115 ESLD-FGIPQLTDFNIIRDSIKIQP------NIPPDPKIARSNSDDDESEQEESNVAETQ 167

Query: 175 KFLTRNNRSMSQD--------LGSNYPSNLSWRPHGIKYKKNEVLLNVNE-KISILVSRD 225
           +   ++N+   QD        +       +SWRP GI Y KNE+ ++V E +  ++  + 
Sbjct: 168 E---KSNKHGFQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKH 224

Query: 226 GSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGR 285
             + K+++ G I   ++LSGMP+ +  +N  L          + + F             
Sbjct: 225 HQVRKNFIFGRIICRSYLSGMPVVKICINKMLK---------DRDQF------------- 262

Query: 286 VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIG--- 342
             L   KFHQCVSL+  +    I+F+PPDG  +L +Y ++ +++     +P++  I    
Sbjct: 263 --LSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHIS----DSPVIKLIEYKV 316

Query: 343 ----RGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNG---KCKFVP--- 392
               + + +   + ++  F  + SA  + +R+P+       +I+++     KC F     
Sbjct: 317 VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILF 376

Query: 393 --EESAMIWKFTKYTGLTENTLSAVTVP---------SSDTTQLTVQQWPRPPM------ 435
              +  ++WK     G    T  ++ V            +  +L     P PP+      
Sbjct: 377 NLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDP-PPLREGVRM 435

Query: 436 ----------------------SLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
                                 +  FE+  F++SGL V Y K+ ++  +Y++  W++Y
Sbjct: 436 EELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 91.7 bits (226), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 111/446 (24%), Positives = 175/446 (39%), Gaps = 130/446 (29%)

Query: 101 TLKENFMNCYEILDTVLEEGGIPVDTELNSV--ISKMTVKPPKQISGNLLDRPDLLTMSS 158
            +++NF   +E+++   + G I V T  N +    K+ V  P   S N        T S 
Sbjct: 103 NVRDNFHLIFEVIEESSDYGIIQV-TNYNIIHDFIKVEVIKPDDDSEN--------TASE 153

Query: 159 LNLSTPGDSSSTLSMPKFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKI 218
            +   PGD   T      L    R+M+        S +SWRP GI Y KNE  L+V EK+
Sbjct: 154 KHELPPGDQDETFINSYIL----RTMT--------SAVSWRPKGIHYGKNEFFLDVIEKL 201

Query: 219 SILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKA 277
             ++   +G +  + ++GTI   ++LSGMP    GLN                     K 
Sbjct: 202 EFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGLN---------------------KL 240

Query: 278 IPKAAAGRVMLEDCKFHQCVSLDKFNKDR--VIKFVPPDGSMELMKYCVRDNLNLPFKVT 335
           + K       ++  KFH+CV L    K+   VIKF+PPDG  EL  Y     LN P    
Sbjct: 241 MQKNVH---FMKRLKFHECVDLHTLIKEESPVIKFIPPDGEFELCNY----KLNRPLLDE 293

Query: 336 PIV--TSIG-----RGNT-----IDYRVTLKSLFPGKLSAKDVSLRIPV----------- 372
           P++   S G     R N      +  +  + + F  + SAK++ ++IP+           
Sbjct: 294 PVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDL 353

Query: 373 --PP---------------GTVDCEINVSNG---------KCKFVPEESAMIWKFTKYTG 406
             PP               G++  +IN   G         KC F       IW    +  
Sbjct: 354 EKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYGLKCMF------EIWDRQIHEA 407

Query: 407 LTENTLSAVTVPSSDTTQLTVQQWPR---------------------PPMSLNFEIMMFS 445
           L     +++  P   T     + W +                       ++++FEI  ++
Sbjct: 408 LEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVDKFALIAMSFEIPYYA 467

Query: 446 NSGLVVRYFKVSDKDERYRTAKWIKY 471
            SGL V YFK+ +    Y++  W++Y
Sbjct: 468 VSGLKVEYFKIEEPQLNYQSFPWVRY 493

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 135/341 (39%), Gaps = 88/341 (25%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILK-SYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI+Y KNE  L+V EK+   +    +I+K + + G I   + LSGMP  +  LN
Sbjct: 223 VSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLN 282

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPD 314
             +                           +  L  CKFHQCV  D  ++ +V++FVPPD
Sbjct: 283 KII------------------------YQDKQFLSSCKFHQCVMPDSVDEGKVLEFVPPD 318

Query: 315 GSMELMKYCVRDNLN-LP------FKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVS 367
           G   L KY ++ ++N LP      ++V P +        +   VT++S F    S   ++
Sbjct: 319 GDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKY----KLKLFVTIESTFKKTNSTTKLN 374

Query: 368 LRIPVPPGTVDCEINVS--------NGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPS 419
           ++IP+       +I++S         GK  F   +  ++W+     G             
Sbjct: 375 IKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFAL 434

Query: 420 SDTTQLTVQQWP-----RPP-------------------------------------MSL 437
            +  +   QQ        PP                                     + +
Sbjct: 435 FNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKM 494

Query: 438 NFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY--ISKSG 476
           +FEI   ++SGL V Y K+ + + +Y+   W++Y  IS  G
Sbjct: 495 DFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDG 535

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 142/331 (42%), Gaps = 84/331 (25%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  L+V EK+  L   ++  + K+ + G I   ++LSGMP  +  LN
Sbjct: 236 VSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN 295

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPD 314
                                K + + A     +   KFHQCV+L+  N ++ ++F+PPD
Sbjct: 296 ---------------------KLLQRDAQ---FMSHSKFHQCVALETLN-EKELEFIPPD 330

Query: 315 GSMELMKYCVRDNLN-------LPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVS 367
           G   L +Y ++ ++N         F++ P +        +   +T+++ F  + S   ++
Sbjct: 331 GEFILCEYELKRHVNDTPILKITSFEIKPQLKKF----KLRILLTIETHFKTRNSTSILN 386

Query: 368 LRIPVPPGTVDCEINVSN--------GKCKFVPEESAMIWKF---------TKYTGLTEN 410
           ++IP+     D  I++S         G+  F   +  ++W+          T+++ + E 
Sbjct: 387 VKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEF 446

Query: 411 TL--------------SAVTVP----------------SSDTTQLTVQQWPRPPMSLNFE 440
           +L               ++  P                S    ++ V+      + ++FE
Sbjct: 447 SLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFE 506

Query: 441 IMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
           I   + SGL V Y K+ ++  +Y++  W++Y
Sbjct: 507 IPYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/330 (22%), Positives = 134/330 (40%), Gaps = 74/330 (22%)

Query: 194 SNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILK-SYVDGTIDLTTHLSGMPICQFG 252
           S +SWRP GI Y KNE  L+V E++  L+  + + ++ + V G I+  ++LSGMP    G
Sbjct: 183 SAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRLNQVHGAINCRSYLSGMPQLTVG 242

Query: 253 LNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVP 312
           LN           +++  DF ++                 FHQCV L++   DR I FVP
Sbjct: 243 LNKM---------VAQDRDFTSQ---------------VHFHQCVDLERLATDRHITFVP 278

Query: 313 PDGSMELMKYCVRDNLNLP--FKVTPIVTSI------GRGNTIDYRVTLKSLFPGKLSAK 364
           PDG  +L  Y +    N     K+     ++         + +   V++ + F  + +  
Sbjct: 279 PDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATS 338

Query: 365 DVSLRIPVPPGTVDCEINVS--------NGKCKFVPEESAMIWKFTK---------YTGL 407
            + +R+P+       ++++S         G   F   +  ++W   K         +T  
Sbjct: 339 VLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQ 398

Query: 408 TENTLSAVTVPSSDTTQLTVQQWPRPP------------------------MSLNFEIMM 443
           ++  L      S    QL+    P P                         + ++FE+  
Sbjct: 399 SQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPY 458

Query: 444 FSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473
            + SGL V + K+ +   +Y++  WI+Y S
Sbjct: 459 HTISGLKVEFLKILEPQLQYQSFPWIRYKS 488

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 144/368 (39%), Gaps = 101/368 (27%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTID 238
           N+R M+  +       +SWR  GI Y KNE  L+V EK+   +  + G I K+ + G I 
Sbjct: 234 NDRYMNSYIAKTTIMPISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEII 293

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
             ++LSGMP  +  +N  L  +                           L + KFHQCVS
Sbjct: 294 CRSYLSGMPKLKISINKILKQDVQ------------------------FLSNVKFHQCVS 329

Query: 299 LD----------------KFNKDR-------VIKFVPPDGSMELMKY----CVRDNLNLP 331
           LD                K N++         I+F+PPDG   L KY     V+D   + 
Sbjct: 330 LDSIRARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIK 389

Query: 332 FKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNG---KC 388
            +   I+  + +   I   V +++ F    S   ++LRIP+        I++S     KC
Sbjct: 390 LRNFEIIPKLHKF-KIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKC 448

Query: 389 K-----FVPEESAMIWKF-TKYTGLTENTLSAVTV------------------------- 417
           +     F   +  ++W+  T   G  ENTLS +                           
Sbjct: 449 EQGTVLFNLSDKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPL 508

Query: 418 --------------PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERY 463
                            D+ +++ ++     ++++FE+   + SGL + Y K+ +   +Y
Sbjct: 509 REGPKLEELYKKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQY 568

Query: 464 RTAKWIKY 471
           ++  W++Y
Sbjct: 569 QSFPWVRY 576

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 139/351 (39%), Gaps = 103/351 (29%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  L+V E +  L++ +D  I ++ + G I   ++LSGMP  +  LN
Sbjct: 225 VSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN 284

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFN-KD-------- 305
             L     DD                    +  L   KFHQCVSL+  N KD        
Sbjct: 285 KILQ----DD--------------------KQFLGHAKFHQCVSLNSINIKDLEKDLEGP 320

Query: 306 -----------RVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIG---RGNTIDYRV 351
                      + I+F+PPDG   L +Y +R ++  P    P++       + N   +RV
Sbjct: 321 NDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDP----PVINMTSFDIKPNFKKFRV 376

Query: 352 T----LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSN--------GKCKFVPEESAMIW 399
                +++ F  + S   ++++IP+     D +I++S         GK  F   E  +IW
Sbjct: 377 QISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIW 436

Query: 400 KF-----------------------TKYTGLTENTLSAVTVP----------------SS 420
           +                         +Y  L E    ++  P                 +
Sbjct: 437 EIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHEN 496

Query: 421 DTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
           +  + T  +     + + FEI   + SGL V Y K+ +   +Y++  W++Y
Sbjct: 497 EDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 117/546 (21%), Positives = 217/546 (39%), Gaps = 108/546 (19%)

Query: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60
           M S I I     E +++K +K+    ++  I R+          P+++  S  F HI+  
Sbjct: 1   MSSCIFITDENLEPLISKNIKAI--PNLQGILRLFKSVYTPESQPVISASSFHFVHIKRS 58

Query: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVY----GLTKEGTLKENFMNCYEILDTV 116
               + ++    ++AN   I  FL + + ++  Y     L K   L +N +   E++D  
Sbjct: 59  SLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVL-DNVLLIMELIDES 117

Query: 117 LEEGGIPV-DTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175
           ++ G I + D  +     ++ V  P+  + + L   D  T    N  T   S    ++ K
Sbjct: 118 IDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKP-NLYK 176

Query: 176 FL-----------TRNNRSMSQDLGSNYPSNL--------SWRPHGIKYKKNEVLLNVNE 216
           FL             +  +   D+  +Y S +        SWR  GI Y +NE  L+V E
Sbjct: 177 FLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVVE 236

Query: 217 KISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANK 275
           ++  L+    G I K+ + G I   ++LSGMP  +   N           +S+ ++    
Sbjct: 237 QVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN----------KLSQKDE---- 282

Query: 276 KAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLN------ 329
                       +   KFHQCV+    N ++ I+F+PPDG   L +Y ++ ++       
Sbjct: 283 ----------QFISHSKFHQCVTWPSSN-EKEIEFIPPDGDFVLCQYELKRHVKDQPMLK 331

Query: 330 -LPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVS---- 384
            + F V P +    +   I    T+++ F  + S   ++L+IP+     + +I++     
Sbjct: 332 LVSFGVKPKL----KKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPAR 387

Query: 385 ----NGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV----------------------- 417
               +GK  F   +  ++W      G   +T  ++                         
Sbjct: 388 FKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNP 447

Query: 418 -PSSDTTQL-----TVQQWPRPP------MSLNFEIMMFSNSGLVVRYFKVSDKDERYRT 465
            P  D  +L      V     P       +S+ FEI   + SGL V Y K+ ++  +Y++
Sbjct: 448 PPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQS 507

Query: 466 AKWIKY 471
             W++Y
Sbjct: 508 FPWVRY 513

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 84/376 (22%), Positives = 145/376 (38%), Gaps = 112/376 (29%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTID 238
           N+  ++ D+       +SWR  GI Y KNE  L+V E++  L+    G I K+ + G I 
Sbjct: 237 NDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIV 296

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
             ++LSGMP  +  +N  L+ +                  P+       + +  FHQCVS
Sbjct: 297 CRSYLSGMPKLKISINKILNRD------------------PQ------FMSNSNFHQCVS 332

Query: 299 LDKFN-------------------KDRVIKFVPPDGSMELMKYCVRDNL-NLP------F 332
           LD  N                     R I+FVPPDG   L +Y ++ ++ + P      F
Sbjct: 333 LDSINTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDF 392

Query: 333 KVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVS-------- 384
           ++ P +    + + I     +++ F    S   ++++IP+     D +I++S        
Sbjct: 393 EIKPKL----KKSKIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKAN 448

Query: 385 NGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSSDTTQ----------LTVQQWPR-- 432
           NGK  F   +  ++W+     G  E   S       D +              +++ R  
Sbjct: 449 NGKVVFNLSDDFLLWEIQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQ 508

Query: 433 ---------PPM----------------------------SLNFEIMMFSNSGLVVRYFK 455
                    PP+                            S++FEI   + SGL V Y K
Sbjct: 509 EEMKTSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLK 568

Query: 456 VSDKDERYRTAKWIKY 471
           V +   +Y++  W++Y
Sbjct: 569 VEEPQLQYQSFPWVRY 584

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/351 (21%), Positives = 139/351 (39%), Gaps = 97/351 (27%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSIL-KSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  LNV EK+   +    +++ K+ + G I     LSGMP  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKF--NKDRVIKFVP 312
             ++           ED             +  L +CKFHQCVSL     +  + ++FVP
Sbjct: 313 KIVN-----------ED-------------KQFLANCKFHQCVSLASLESSDHKDVEFVP 348

Query: 313 PDGSMELMKYCVRDNLN-------LPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKD 365
           PDG   L +Y ++ ++        + F+V P +            +T+++ F    +   
Sbjct: 349 PDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLL----LTIETHFKTTNATSK 404

Query: 366 VSLRIPVPPGTVDCEINVSNG---KCK-----FVPEESAMIWKFTKYTGLTENTLSAVTV 417
           ++LR+P+     +  +++S     KC      F   +  ++W+    +G    T  ++ V
Sbjct: 405 LALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGV 464

Query: 418 PSS-------DTTQLTVQQWPRPP------------------------------------ 434
             +       D  Q  ++    PP                                    
Sbjct: 465 EFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQP 524

Query: 435 --------MSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477
                   ++++FE+   ++SGL V Y K+ +    Y++  W++Y + S +
Sbjct: 525 RTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 143/379 (37%), Gaps = 117/379 (30%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTID 238
           N+  ++ D+       +SWR  GI Y KNE  L+V E++  L+    G I K+ + G I 
Sbjct: 236 NDLYINGDIAKTIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIV 295

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
              +LSGMP  +  +N  L+ +                  P+       + + KFHQCVS
Sbjct: 296 CRCYLSGMPKLKISINKLLNRD------------------PQ------FMSNSKFHQCVS 331

Query: 299 LDKFN------------------KDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTS 340
           LD  N                    + I+F+PPDG   L +Y ++ ++    K  P++  
Sbjct: 332 LDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHV----KDAPMIKL 387

Query: 341 IG-------RGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSN-------- 385
            G       +   I     +++ F    S   ++++IP+     D +I++S         
Sbjct: 388 QGFEIKPKLKKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANL 447

Query: 386 GKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSSD---TTQLTVQQWP----------- 431
           GK  F   +  ++W+     G  E      TVP  D   T    V ++P           
Sbjct: 448 GKVVFNLSDDFLLWEIGTMKGHRERNTG--TVPQEDDASTLASMVAEFPLFNQEEYDRLQ 505

Query: 432 -------RPP--------------------------------MSLNFEIMMFSNSGLVVR 452
                   PP                                +S++FEI   + SGL V 
Sbjct: 506 EELKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVE 565

Query: 453 YFKVSDKDERYRTAKWIKY 471
           Y KV +   +Y++  W++Y
Sbjct: 566 YLKVEEPQLQYQSFPWVRY 584

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 138/338 (40%), Gaps = 86/338 (25%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  L+V EK+  L+    G I K+ + G I    +LSGMP  +  LN
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKD--------- 305
                      I   E F               + + KFHQCVS++   ++         
Sbjct: 276 ---------KLIKNDEQF---------------ISNSKFHQCVSINSLKREINNEEEENT 311

Query: 306 ---RVIKFVPPDGSMELMKYCVRDNL-NLP-FKVTPI-VTSIGRGNTIDYRVTLKSLFPG 359
              + I+F+PPDG   L KY ++ ++ ++P  K++ I +    +   I   VT+++ F  
Sbjct: 312 YHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKK 371

Query: 360 KLSAKDVSLRIPVPPGTVDCEINVSN--------GKCKFVPEESAMIWKFTKY---TGLT 408
           + S   ++++IP+       +I+++         G+  F   +  +IW+        G +
Sbjct: 372 QNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGES 431

Query: 409 ENTLSA----VTVPSSDTTQLTVQQWPRPP------------------------------ 434
           +N + A          D  Q  ++    PP                              
Sbjct: 432 KNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQ 491

Query: 435 -MSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
            +++ FE+   + SGL V Y K+ +    Y++  W++Y
Sbjct: 492 LLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 102/234 (43%), Gaps = 37/234 (15%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  L+V EK   ++  ++  I K+ + G I     LSGMP  +  LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPD 314
             L                           +  L   +FHQCVSL+   +++ I+F+PPD
Sbjct: 347 KLLQ------------------------KDQQFLSQLRFHQCVSLETI-QNKEIEFIPPD 381

Query: 315 GSMELMKYCVRDNLNLPFKVTPIVTSIG---RGNTIDYRVTLKSLFPGKLSAKDVSLRIP 371
           G   L +Y ++ ++  P  +  I   I    +   I   +++ + F  + S   ++L+IP
Sbjct: 382 GEFILCEYELKRHVKDPPNIKLISFEIKPKLKKFKIQINLSITTFFKVQNSTSILNLKIP 441

Query: 372 VPPGTVDCEINVSN--------GKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417
           +     D +I++          G+ KF   +  ++W+     G     + A+T 
Sbjct: 442 LEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMTA 495

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 435 MSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
           ++++FEI  ++ SGL V Y K+ ++   Y++  W++Y
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 148/380 (38%), Gaps = 116/380 (30%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTID 238
           N+  ++ D+       +SWR  GI Y KNE  L+V E++  L+    G I K+ + G I 
Sbjct: 242 NDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIV 301

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
              +LSGMP  +  +N  L+ +                  P+       + +  FHQCVS
Sbjct: 302 CRCYLSGMPKLKISINKILNRD------------------PQ------FMSNSSFHQCVS 337

Query: 299 LDKFN---KD-----------------RVIKFVPPDGSMELMKYCVRDNL-NLP------ 331
           LD  N   KD                 R I+F+PPDG   L +Y ++ ++ + P      
Sbjct: 338 LDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKD 397

Query: 332 FKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSN------ 385
           F++ P +        I     +++ F    S   +++RIP+     + +I++S       
Sbjct: 398 FEIKPKLKKFK----IQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKA 453

Query: 386 --GKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSSD-----TTQLTVQQWP------- 431
             GK  F   +  ++W+     G  E++ +  +  +SD     T    V ++P       
Sbjct: 454 NIGKVVFNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEY 513

Query: 432 -----------RPP-----------------------------MSLNFEIMMFSNSGLVV 451
                       PP                             ++++FEI   + SGL V
Sbjct: 514 DRLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKV 573

Query: 452 RYFKVSDKDERYRTAKWIKY 471
            Y KV +   +Y++  W++Y
Sbjct: 574 EYLKVEEPQLQYQSFPWVRY 593

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 99/243 (40%), Gaps = 66/243 (27%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVSRD-GSILKSYVDGTIDLTTHLSGMPICQFGLN 254
           +SWR  GI Y KNE  L+V EK+  LV  + G + +S + G I   ++LSGMP  +  LN
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD-------------- 300
             L                           +  +   +FHQCVSLD              
Sbjct: 309 KLLQ------------------------NDKQFISQVQFHQCVSLDSIEKVIKYAEEHSD 344

Query: 301 --------KFNKDRVIKFVPPDGSMELMKYCVRDNLNLP-------FKVTPIVTSIGRGN 345
                   + N +  I+F+PPDG   L  Y ++ ++  P       F++TP      +  
Sbjct: 345 ELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITP----KWKKY 400

Query: 346 TIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINV--------SNGKCKFVPEESAM 397
            +     +++ F    S   + ++IP+     D +I++        SNG+  +   +  +
Sbjct: 401 KLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFL 460

Query: 398 IWK 400
           +W+
Sbjct: 461 LWE 463

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 435 MSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471
           +S++FEI   + SGL V Y K+ +   +Y++  W++Y
Sbjct: 550 LSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRY 586

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/380 (21%), Positives = 145/380 (38%), Gaps = 112/380 (29%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS-RDGSILKSYVDGTID 238
           N+  ++ D+       +SWR  GI Y KNE  L+V E++  L+    G I K+ + G I 
Sbjct: 244 NDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIV 303

Query: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298
              +LSGMP  +  +N  L                N+ A          L +  FHQCVS
Sbjct: 304 CRCYLSGMPKLKISINKIL----------------NRDA--------QFLSNSSFHQCVS 339

Query: 299 LD----------KFNKD---------RVIKFVPPDGSMELMKYCVRDNL-NLP------F 332
           LD          K + D         + ++FVPPDG   L +Y ++ ++ + P      F
Sbjct: 340 LDSIKTIEKREEKEDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDF 399

Query: 333 KVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSN------- 385
           ++ P +        I     +++ F    S   ++++IP+     +  I++S        
Sbjct: 400 QIKPKLKKFK----IQIETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSN 455

Query: 386 -GKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSSDTTQLT--VQQWP----------- 431
            GK  F   +  ++W+     G  E+  +  +   +D       V ++P           
Sbjct: 456 IGKVVFNLSDDFLLWEIQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQ 515

Query: 432 -------RPP-----------------------------MSLNFEIMMFSNSGLVVRYFK 455
                   PP                             ++++FEI   + SGL + Y K
Sbjct: 516 EEKKTSMNPPPLRTGPRLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLK 575

Query: 456 VSDKDERYRTAKWIKYISKS 475
           V +   +Y++  W++Y + S
Sbjct: 576 VEEPQLQYQSFPWVRYKTTS 595

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 121/299 (40%), Gaps = 80/299 (26%)

Query: 149 DRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKN 208
           +R D  T + + L T G+ ++ + M  ++ +          +  P  +SWR  GI Y KN
Sbjct: 259 NRQDTDTDTDIELGTLGEGNNDIYMNSYIAKT---------TIMP--ISWRTKGIHYAKN 307

Query: 209 EVLLNVNEKISILVS-RDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSIS 267
           E  L+V EK+   +    G I K+ + G I    +LSGMP  +  +N  L     +DS  
Sbjct: 308 EFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISINKILQ----NDS-- 361

Query: 268 EVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKF------------------------- 302
                               L +  FHQCVSLD                           
Sbjct: 362 ------------------QFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENHDER 403

Query: 303 NKDRVIKFVPPDGSMELMKYCVRDNL-NLP------FKVTPIVTSIGRGNTIDYRVTLKS 355
           ++ + I+F+PPDG   L KY ++ ++ +LP      F + P ++       +   V +++
Sbjct: 404 DRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKY----KLKIHVIIET 459

Query: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVS--------NGKCKFVPEESAMIWKFTKYTG 406
            F    +   ++L+IP+     +  I++S         GK  F   ++ +IW+     G
Sbjct: 460 HFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKG 518

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 406 GLTENTLSAVTVPSSDTTQLTVQQWPRPP--MSLNFEIMMFSNSGLVVRYFKVSDKDERY 463
           G  E T +       +     +++  R P  + ++FEI  ++ SGL + Y K+ +   +Y
Sbjct: 593 GSQEATGTHARKTKEERKDKDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQY 652

Query: 464 RTAKWIKY 471
           ++  W++Y
Sbjct: 653 QSFPWVRY 660

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 39/172 (22%)

Query: 194 SNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGL 253
           S + WR  GI Y  NE+ ++++E+I+ +V + G +L  ++ G IDL  HLSG P+ +  L
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 254 NDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFN--------KD 305
                    D  +S +                    +  FH+C+  DK N        K 
Sbjct: 267 G------LLDHKLSHL--------------------NTTFHRCILEDKANSINDLIAGKF 300

Query: 306 RVIKFVPPDGSMELMKYC---VRDNLNLPFKVTPIVTSIG-RGNTIDYRVTL 353
             + FVPPDG   L +Y    V+ + NL      + +S+G R +  + RVT+
Sbjct: 301 TKLTFVPPDGRTRLCQYTLPLVKRDSNLGIIDVNLQSSLGKRLDEFEVRVTV 352

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 134/315 (42%), Gaps = 66/315 (20%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILV------SRDGSILKSYVDGTIDLTTHLSGMPICQF 251
           WR   IK  +NE+ ++V E + + +      S    +L  Y++G++ + + + G+P+   
Sbjct: 175 WRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPM--- 231

Query: 252 GLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKF--NKDRVIK 309
                L V FG        DF  K  IPK            FH CV +++F  N   +IK
Sbjct: 232 -----LEVSFGGC------DF--KDIIPK------------FHDCVEVNEFLTNDGNIIK 266

Query: 310 FVPPDGSMELMKYCV-----RDNLNLPFKVTPIVTSIGRGNTID-YRVTL---KSLFPGK 360
           F+PPDG  +LM+Y +      DNL     ++   T+ G GN+ D + +TL   KS    K
Sbjct: 267 FIPPDGKFQLMEYSMALSSFNDNL-----ISCNFTN-GLGNSNDEFEITLNINKSNKVPK 320

Query: 361 LSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPSS 420
           ++   V L      G    +I + N   +F   ++  I+     TG        V   + 
Sbjct: 321 INNLQVCLNFENREGQSKVKI-LRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVEEETK 379

Query: 421 DTTQLTVQQWPRPPMS-----LNFEIMMFSNSGLVVRYFKVSDKD---------ERYRTA 466
           +     +    R  +S     L   IM F   G +    +VS  +         +R +  
Sbjct: 380 NEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQQLF 439

Query: 467 KWIKYISKSGSYEIR 481
           K +KY++K+ +YEIR
Sbjct: 440 KGVKYVTKTSNYEIR 454

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 131/311 (42%), Gaps = 69/311 (22%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILVSRD---GSI--LKSYVDGTIDLTTHLSGMPICQFG 252
           WR  G+KY  NE+ ++V E + +++ ++   G +  ++  +DG +D  +HLSG P+    
Sbjct: 188 WRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPV--IA 245

Query: 253 LNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFN-KDRVIKFV 311
           LN  L                +   +P              HQC  LD +  +   ++FV
Sbjct: 246 LNLRLR--------------GHDLGMP------------ALHQCC-LDSYQGRPDQLRFV 278

Query: 312 PPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSL---------FPGKLS 362
           PPDG  +LM Y +  +L+     + + ++IG  +  DYR  L  L           G   
Sbjct: 279 PPDGKFQLMHYSI--DLDSLQSKSKLFSNIGLVSP-DYRTELGDLGDEFEVNLNIAGSQH 335

Query: 363 AK---DVSLRIPVPPGTVDCEINV---SNGKCKFVPEESAMIWKFTKYTGLTENTLSAVT 416
           AK   D+ + +   P   +C+I V   ++G  +     +   W F K T     TL  + 
Sbjct: 336 AKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKET--PTGTLPVLR 393

Query: 417 VPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKD------ERYRTAKWIK 470
               + T+  V+       +L   +  ++N G +    KV   D      +  +  K +K
Sbjct: 394 GCLENATREQVR-------ALQLSV-SYTNRGELPSGIKVDSVDILSGLSKNIKPFKGVK 445

Query: 471 YISKSGSYEIR 481
           YI+K+G + +R
Sbjct: 446 YIAKTGDFHLR 456

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 121/310 (39%), Gaps = 67/310 (21%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILV---SRDGSI--LKSYVDGTIDLTTHLSGMPICQFG 252
           WR  G+KY  NE+ ++V E I +++    + G +  ++  +DG +D  +HL+G P+    
Sbjct: 188 WRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVALK 247

Query: 253 LNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVP 312
           LN       G D             +P              H C           ++FVP
Sbjct: 248 LN-----LHGHD-----------LGVP------------ALHPCCQAQYTGSPENLQFVP 279

Query: 313 PDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSL---------FPGKLSA 363
           PDG   LM+Y +  +L      + + +++G   ++DY V L  L           G    
Sbjct: 280 PDGKFRLMQYTI--DLEALQTKSKLFSNMGL-VSLDYFVGLGDLRDEFEIKVNIAGSQHV 336

Query: 364 K---DVSLRIPVPPGTVDCEINV---SNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417
           K   D+ + I     T DC I     ++G  +   E +   W F K     E     V V
Sbjct: 337 KLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDK-----ETPTGTVPV 391

Query: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKD------ERYRTAKWIKY 471
                   T +Q     ++++     +SN G +    KV   D      +  +  K +KY
Sbjct: 392 FRGCLENATPEQIKTLSLAIS-----YSNKGSLPSGIKVGAVDIISGLPKNTKPFKGVKY 446

Query: 472 ISKSGSYEIR 481
           ++++G + +R
Sbjct: 447 VARTGQFNLR 456

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 34/149 (22%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILVSRDGS------------------ILKSYVDGTIDL 239
           WR   +KY  NE+ ++V E+I ++  R  S                  ++++ + G +++
Sbjct: 258 WRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELNV 317

Query: 240 TTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSL 299
            ++LS  P+ +  L D     + D        ++      +   G  M     FH CV +
Sbjct: 318 RSYLSDNPMVEVTLVDR---NYSDQKTG----WSENDLFKQLNLGLPM-----FHDCVEI 365

Query: 300 D---KFNKD-RVIKFVPPDGSMELMKYCV 324
           D     N+D R IKF+PPDG   LMKY +
Sbjct: 366 DYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 133/342 (38%), Gaps = 73/342 (21%)

Query: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDG--------- 226
           F++ +   +  D  S     + WR  G+KY  NE+ +++ E I ++  + G         
Sbjct: 191 FVSDSLNRLENDTSSREDDVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSK 250

Query: 227 -SILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGR 285
             ++   ++G   +  +LSG P     L+ +                 N   +P      
Sbjct: 251 LEMICGTINGQASVKCYLSGNPTVDLQLDLA----------------GNDLGVP------ 288

Query: 286 VMLEDCKFHQCVSLDKFNK--DRVIKFVPPDGSMELMKYCVRDNLNLP-------FKVTP 336
                  FH+CV LD      +  ++F+PPDG   LM+Y +  +L+ P       F  T 
Sbjct: 289 ------AFHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSI--DLDTPRIQQTRRFNHTV 340

Query: 337 IVTSIG----RGNTIDYRVTLKSLFPGKLSAKDVSLRIPV-------PPGTVDCEINV-S 384
            + +I      GN  D      ++   +  A    LRI V            D +I V  
Sbjct: 341 GLVTIDFADQLGNKTDEFEITVNISNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLR 400

Query: 385 NGKCKF----VPEESAMIWKFTKYTGLTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFE 440
           N   +F    VP + +  W F K T      +    V S++   L VQ+     ++ ++ 
Sbjct: 401 NTHGRFDNSVVPGQGS--WIFDKDTPTGTLPVLRGCVESTEPRLLRVQR-----VTASYS 453

Query: 441 IMMFSNSGLVVRYFKVSD-KDERYRTAKWIKYISKSGSYEIR 481
           +     SG+ V+   +     +  R  K +KY +K+G +EIR
Sbjct: 454 LSGQLASGIRVKAINIGQLTTKSNRPFKGVKYATKTGDFEIR 495

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 118/313 (37%), Gaps = 73/313 (23%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILVSRDGS---ILKSYVDGTIDLTTHLSGMPICQFGLN 254
           WR    +Y  NE+ +++ E ++  + + GS   ++   + G ID+  +LSG P  Q  L 
Sbjct: 142 WRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKLR 201

Query: 255 DSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPD 314
            S                      P        L++   H+CV L +      + FVPPD
Sbjct: 202 TS--------------------GHP--------LDNSALHRCVELGEAGV-ATMNFVPPD 232

Query: 315 GSMELMKYCV---------RDNLNLPFKVTPIVTSIGR-----------GNTI------D 348
           G   L +Y +         R   NL      + + +G+           GN+       D
Sbjct: 233 GRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIED 292

Query: 349 YRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLT 408
            R+T+   FP    A  + +            +  ++G  +        +W F K T + 
Sbjct: 293 LRITV--YFPDISDAAKIKI------------LRTTHGGWESDLSRVRGVWAFDKQTAVG 338

Query: 409 ENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKW 468
              +    V + ++T      +P   +++++  +    SG+ V    +SD     +  K 
Sbjct: 339 SVPVLRGCVENPESTPHAPPVFPS-HLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKG 397

Query: 469 IKYISKSGSYEIR 481
           +KY S++G Y +R
Sbjct: 398 VKYTSRAGDYIVR 410

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 63/151 (41%), Gaps = 48/151 (31%)

Query: 194 SNLSWRPHGIKYKKNEVLLNVNEKISIL----VSRDGSILKS----------YVDGTIDL 239
           +N  WR   +K+  NE+ +++ E + ++    + R   + +S          Y+ GT  +
Sbjct: 199 ANAPWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYV 258

Query: 240 TTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSL 299
            + L+G P+ +  L  S     G+D                       +    FH+CV +
Sbjct: 259 QSFLNGNPLVELQLELS-----GND-----------------------IGHPSFHECVDI 290

Query: 300 DKFNKD------RVIKFVPPDGSMELMKYCV 324
           D++ K+        +KF+PPDG   LM Y +
Sbjct: 291 DEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 133/331 (40%), Gaps = 74/331 (22%)

Query: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVS--RDGSIL---KSYVD 234
           N+R  S    +N    + WR  G+KY  NE+ +++ E ++I+++  R+ + L      +D
Sbjct: 188 NSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSID 247

Query: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFH 294
           G +    +LS  P+ +  LN +                 +   IP             FH
Sbjct: 248 GEVGFKCYLSENPLVELDLNTN----------------GHDLGIP------------AFH 279

Query: 295 QCVSLDKFN-KDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTL 353
           +CV  +  +     ++F+PPDG   LM+Y +  +L+       I++++G   ++DY   L
Sbjct: 280 RCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI--DLDSLRNRNKILSNLGLV-SVDYHTGL 336

Query: 354 ---KSLFPGKLS---------AKDVSLRIPVPPGTVDCEINV-SNGKCKFVPEESAM--- 397
              K  F  K++          +D+ + +   P   D +I +  N    F   E+ +   
Sbjct: 337 GPKKDEFEIKVTVALSRNVKHVEDLKIDVHFDPLREDGKIKILRNTHGGF---ENGINNK 393

Query: 398 -IWKFTKYTGLTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKV 456
             W F K     E  +    V        T   WP+      +  M +SN G +    +V
Sbjct: 394 GTWTFDK-----ETPVGVFPVLRGCIEGCTEPTWPK------YLSMSYSNKGQLPSGIRV 442

Query: 457 SDKD------ERYRTAKWIKYISKSGSYEIR 481
           +  +         +  K +KYI+K G Y +R
Sbjct: 443 NSVNILSGFPAGVKPFKGVKYITKIGDYVVR 473

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 88/231 (38%), Gaps = 67/231 (29%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISI-----LVSRDG-------------------SILKSYV 233
           WR   IK  KNE+ +++ E I +     + +R G                    ++  Y+
Sbjct: 261 WRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNGYI 320

Query: 234 DGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKF 293
            G ID+ ++L+G PI +  LN                   N    P              
Sbjct: 321 TGVIDVRSYLNGNPIVEMKLNTC----------------GNDMGTPS------------L 352

Query: 294 HQCVSLD---KFNKDRV---IKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTI 347
           H CV L+     + D+V   +KF+PPDG   L +YCV  N N    V      IG  N  
Sbjct: 353 HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKNNKNAVGVNNRDIGLVN-- 410

Query: 348 DYRVTLKS-LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAM 397
              VT ++ L P +    +  +R+ +   T+   I     K KFV   SAM
Sbjct: 411 ---VTFENGLGPQR---DEFEVRLNIKGSTMVEHIEDLKLKLKFVLNHSAM 455

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 62/155 (40%), Gaps = 56/155 (36%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILV-------SRDG--------SILKSYVDGTIDLTTH 242
           WR +GIK  K E+ +++ E++ +          RDG         ++  ++ GTID+  +
Sbjct: 191 WRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCY 250

Query: 243 LSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLD-- 300
           L+G P        ++S+ F        +   N   IP             FH CV  +  
Sbjct: 251 LNGNP--------TVSLMF--------DTMGNDLGIPS------------FHACVEQEDQ 282

Query: 301 -----------KFNKDRVIKFVPPDGSMELMKYCV 324
                       F   R+++F+PPDG   L +Y +
Sbjct: 283 VQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVI 317

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 71/153 (46%), Gaps = 32/153 (20%)

Query: 186 QDLGSNYPSNLS--WRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTT-H 242
           QD+  N+ SN++  WR   + +  NE+ L++ E I +++        SY + T+ + T +
Sbjct: 192 QDM--NFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGN 248

Query: 243 LSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKF 302
           + G  + +  LN +  VE   D                  AG   LE    H+CV     
Sbjct: 249 IIGKALVKSVLNGNPIVEMKID-----------------MAGND-LESIFLHECVKSKDV 290

Query: 303 NKD------RVIKFVPPDGSMELMKYCVRDNLN 329
           +KD      ++IKF+PPDGS +L  Y +  NLN
Sbjct: 291 DKDQEFENTKLIKFLPPDGSFKLFDYNI--NLN 321

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 63/143 (44%), Gaps = 34/143 (23%)

Query: 198 WRPHGIKYKKNEVLLNVNEKISILVS---RDGSI--LKSYVDGTIDLTTHLSGMPICQFG 252
           WR   +KY  +E+ +++ E + ++     R+ S+  +   ++G +++ ++LSG P  +  
Sbjct: 194 WRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMD 253

Query: 253 LNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVP 312
           ++                            AG  M      HQCV + + +   +  F+P
Sbjct: 254 MD---------------------------LAGNEMYAP-SMHQCVEMPQGSPSSLC-FIP 284

Query: 313 PDGSMELMKYCVRDNLNLPFKVT 335
           PDG+  L+ Y +  ++N   KVT
Sbjct: 285 PDGNCNLLNYTIDLDMNPKVKVT 307

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 36/134 (26%)

Query: 198 WR-PHGIKYKKNEVLLNVNEKISILVSRDGS---ILKSYVDGTIDLTTHLSGMPICQFGL 253
           WR     K++ NE+ L++ E   ++  +  S   ++   + GT+D+ ++L+  P+    L
Sbjct: 201 WRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLVKL 260

Query: 254 NDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDK---FNKDRVIKF 310
           N                   N   IP              H+CV ++    F+    I F
Sbjct: 261 NT----------------MGNDIGIPS------------LHECVEINDGGVFSPSN-ITF 291

Query: 311 VPPDGSMELMKYCV 324
           +PPDG   L++YCV
Sbjct: 292 IPPDGKFRLLEYCV 305

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 94/246 (38%), Gaps = 62/246 (25%)

Query: 220 ILVSRDGSI--LKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKA 277
           I   R G +  ++  + G++D+   L+G P+ +  L     ++ G               
Sbjct: 267 IFGRRSGHLEYVRGNISGSVDMRCFLTGNPLVEIALKQG-GLDIG--------------- 310

Query: 278 IPKAAAGRVMLEDCKFHQCV---SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKV 334
           IP             FH CV   SL K  K   + F+PPDG   LM+Y    N+NL    
Sbjct: 311 IPG------------FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGK 354

Query: 335 TPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEE 394
              V  +   +  D+  TL   F       +V+L I             S+   K + + 
Sbjct: 355 RHSVGLV-HADIEDHLGTLGDEF-------EVTLNIS------------SSTSVKHIEDM 394

Query: 395 SAMIWKFTKYTGLTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYF 454
             M+     Y GL+       T  SSD  + +V+Q+   P+ +    +   +SG+  R  
Sbjct: 395 EVML-----YFGLSHGNRKKDTHLSSDEEEFSVEQFRIKPLQITHGRLENMSSGVHKRSK 449

Query: 455 KVSDKD 460
            V DK+
Sbjct: 450 WVFDKE 455

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%)

Query: 208 NEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVE 260
           N +L+ +NE I+  ++RDG+I  S + G ++L  + + +   Q  L DS++V+
Sbjct: 286 NGILITINETINAEITRDGNISSSELKGVLELRINDASLAHSQLALLDSINVK 338

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 36/61 (59%)

Query: 199 RPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLS 258
            P  IK + N +L+++ E I+  +SRDG++  + + G ++L  +   +   +  L+DS++
Sbjct: 268 EPEEIKPENNGILISIKETINAEISRDGAVRSTELKGVMELRINDESLAHSKVTLSDSVN 327

Query: 259 V 259
           V
Sbjct: 328 V 328

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 29  SDIFRIQVINNLDVRSPILTLGSTTFHHIRSDGSDSLWLVAVSRSNANSGAIWEFLYKL 87
           SDI+++   N ++    I  LG T+FH +R++  D L      R N+ +GA W FL KL
Sbjct: 107 SDIYKVSDKNGVEKVMKIHRLGRTSFHTVRNN-RDYL------RKNSKNGANWMFLSKL 158

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 67/179 (37%), Gaps = 54/179 (30%)

Query: 172 SMPKFLTRN--NRSMSQDLGSNYPSNLS-------------------WRPHGIKYKKNEV 210
           S  K LTR   NR  S  LGS+  SN++                   WR   +    NE+
Sbjct: 150 SATKTLTRTIKNRESSNFLGSSNSSNINGGPTINRSSDSPLDAQVVPWRIPNLSNVNNEI 209

Query: 211 LLNVNEKISILV--SRDGS--ILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSI 266
            +++ E +++ +  SR  S  +    + G IDL  +L G P  Q  L+            
Sbjct: 210 YVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQINLH------------ 257

Query: 267 SEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS-LDKFNKDRVIKFVPPDGSMELMKYCV 324
                          +AG    +    H+C+           ++F+PPDG   L++Y +
Sbjct: 258 ---------------SAGHA-FKPSALHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 51/132 (38%), Gaps = 33/132 (25%)

Query: 198 WR-PHGIKYKKNEVLLNVNEKISILVSRDGS---ILKSYVDGTIDLTTHLSGMPICQFGL 253
           WR     K++ NE+ +++ E   ++  +  S   +L   + G +D+ ++L+  P+    L
Sbjct: 201 WRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAVKL 260

Query: 254 NDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSL-DKFNKDRVIKFVP 312
           N                   N   IP              H CV + D       I F+P
Sbjct: 261 NT----------------MGNDIGIPS------------LHDCVEINDGVFSPSNITFIP 292

Query: 313 PDGSMELMKYCV 324
           PDG   L++Y V
Sbjct: 293 PDGKFRLLEYSV 304

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 182 RSMSQDLGSNYPSNLSWRPH----GIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTI 237
           RS S    S+ P     +PH     IK   N +L+ +NE I+  + RDGSI  S + G +
Sbjct: 250 RSASNTGASHVP-----KPHRQREEIKRTNNGILILINETINAELQRDGSITSSELKGVL 304

Query: 238 DLTTHLSGMPICQFGLNDSLSVE 260
           +L  +   +   +  L +S+ V+
Sbjct: 305 ELRVNDPALSHSKIALVESMDVK 327

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 44/174 (25%)

Query: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGI-KYKKNEVLLNVNEKISILVSRDGSILK---SY 232
           ++R N S+ +D        + WR     K++ NE+ +++ E   +++ +  + L+     
Sbjct: 185 MSRGNISLVED-----EDIVPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGD 239

Query: 233 VDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCK 292
           + G +D+ ++L+  P+    LN                   N+  IP             
Sbjct: 240 ICGAVDVRSYLNDNPLVSVKLNT----------------MGNEIGIPS------------ 271

Query: 293 FHQCVSLD---KFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPI-VTSIG 342
            H+CV ++   +F     I F+PPDG   L++Y +  NL+   K + I + SIG
Sbjct: 272 LHECVEINDDGEFTPSN-ITFIPPDGKFRLLEYSI--NLDSQLKKSGIRMNSIG 322

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 186 QDLGSNYPSNLSWR-----PHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLT 240
           +++G++  S+ + R     P   K   N +L+++ E ++  ++RDG+I  S + G ++L 
Sbjct: 253 RNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISSSELKGVLELR 312

Query: 241 THLSGMPICQFGLNDSLSV 259
            +   +   +  L+DS+ V
Sbjct: 313 VNDRSLAHAKLTLDDSVDV 331

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%)

Query: 196 LSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLND 255
           L   P   K   N +L+++ E +   +SRDGSIL S + G ++L  +   +   +  L  
Sbjct: 267 LPKEPEEDKPDNNGILISIKETVGAEISRDGSILSSELKGVLELRINDESLAHAKLQLTS 326

Query: 256 SLSV 259
           +++V
Sbjct: 327 NVNV 330

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 177 LTRNNRS--MSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234
           L++ N+   MS    SN        P   K   N +L+ + E ++  +SRDG+I  S + 
Sbjct: 250 LSKGNKGPGMSSIRSSNAARPAYQEPEEEKPVNNGILITIKETVNAEISRDGAITSSELK 309

Query: 235 GTIDLTTHLSGMPICQFGLNDSLSV 259
           G ++L  + + +   +  L D++ V
Sbjct: 310 GVMELRINKAELGHAKLTLTDNVDV 334

>KAFR0G01240 Chr7 complement(280112..281788) [1677 bp, 558 aa] {ON}
           Anc_1.31 YDR518W
          Length = 558

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 22/147 (14%)

Query: 179 RNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEV-LLNVNEKISILVSRDGSILKSYVDGTI 237
            N R M  DLG  Y   +++        +N V  L++ ++  I V  D S    Y     
Sbjct: 285 ENYRDMFNDLGKTYRGKINFIALNSNIAQNHVKFLDLKQQYPIFVIHDSSTNFRYA---- 340

Query: 238 DLTTHLSGMPICQF----GLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRV-MLEDCK 292
                L  +P  ++      N+ + VE  DD +  VEDFAN +A P   +  V  ++D  
Sbjct: 341 -----LPQLPDDEYLELIKRNEMVHVE-KDDILKLVEDFANGEATPIMKSEEVPTVQDGL 394

Query: 293 FHQCVS------LDKFNKDRVIKFVPP 313
            ++ VS      +    +D ++++  P
Sbjct: 395 VYKLVSQTHDEIVHNPERDVIVRYYAP 421

>TBLA0D00200 Chr4 complement(47585..50932) [3348 bp, 1115 aa] {ON}
           Anc_2.92 YNL163C
          Length = 1115

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 102 LKENFMNCY-EILDTVLEEGGIPVDTEL--NSVISKMTVKPPKQISGNLL 148
           LKENF+  + E+LD + E+G   +D EL  +  I K+ V  P++I  N+L
Sbjct: 833 LKENFIKKFQEVLDKIKEQGN-DIDVELRNDDFIKKIVVFGPRRIGSNIL 881

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 57/150 (38%), Gaps = 41/150 (27%)

Query: 356 LFPGKLSAKDVSLRIPVPPGT------VDCEINVSNGKCKFVPEESAMIWKFTKYTGLTE 409
           L P    +    +++ + PGT      VD E+ VS+    F+P  +  +  F  Y  + E
Sbjct: 192 LIPDSKHSGAFHVKLRLLPGTHRFRFVVDNELRVSD----FLPTATDQMGNFVNYIEVRE 247

Query: 410 NTLSA------------VTVPSSDTTQLTVQQW------------------PRPPMSLNF 439
               A            +  P+SD + + +Q                    PRPP     
Sbjct: 248 PEKKATDGKRKSKKEYSIQAPTSDRSSIALQIGKDPDDFGDGYTRFHEDFSPRPPQEYTA 307

Query: 440 EI-MMFSNSGLVVRYFKVSDKDERYRTAKW 468
           +I  +FS+  ++ RY+   D+++ +    W
Sbjct: 308 DIPAVFSDPSVMERYYYTLDREQNHNDTSW 337

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 199 RPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLS 258
            P   K + N +L+ + E I+  ++RDG I  S + G ++L  +   +   +  L DS+ 
Sbjct: 276 EPEEDKPQNNGILITIKETINAEITRDGVISSSELKGVMELRINDPELAQAKIKLADSMD 335

Query: 259 V 259
           V
Sbjct: 336 V 336

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 203 IKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239
           +K   N +L++V E IS  +SRDGS+  S + G ++L
Sbjct: 279 VKKINNGILVSVKETISAEISRDGSVTTSELKGVLEL 315

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 33/55 (60%)

Query: 206 KKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVE 260
           + N +L+ +NE ++  ++RDG++  S + G+++L  +   +      L DS++V+
Sbjct: 284 ENNGILIQINETVNSEINRDGTVQSSELKGSLELRINDPELAHATIKLADSMNVK 338

>KLTH0G09570g Chr7 complement(802806..803702) [897 bp, 298 aa] {ON}
           weakly similar to uniprot|P40476 Saccharomyces
           cerevisiae YIL117C PRM5 Pheromone-regulated protein
           predicted to have 1 transmembrane segment induced during
           cell integrity signaling
          Length = 298

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 125 DTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRNNRSM 184
           D E +  +SK    P  +    LLDRPD     S  LS   DSS++L+   + +  +++ 
Sbjct: 133 DPEKSGFLSKAVHTPQSRSVARLLDRPD-FQQPSPALSN-QDSSTSLAQEFYSSIRDQTA 190

Query: 185 SQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSIL 229
           +Q+  S + S      +  + +K+ VL N+N  +S LVS  G+ L
Sbjct: 191 AQNRKSLFISPTVEIVN--QQRKSAVLQNMNNSVSSLVSDSGAEL 233

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 77/187 (41%), Gaps = 25/187 (13%)

Query: 206 KKNEVLLNVNEKISILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDS 265
           + N +L+++ E I+   SRDG+I  S + G ++L  +   +      L DS+ V   D S
Sbjct: 339 ENNGILISIKEVINAEFSRDGTIHSSELKGVLELRINDHDLSHSNLKLADSIDVR--DKS 396

Query: 266 ISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKY--- 322
                 F     I K A     L        +SL    +D+   F   D S+ ++++   
Sbjct: 397 FQ----FKTHPNIDKQAFLSSKL--------ISL----RDKSKAFPANDQSLGVLRWRKI 440

Query: 323 -CVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEI 381
               D+  +P  +T  V+        D  +  +S+   +L+  DV   IPV P     +I
Sbjct: 441 APAEDDSLVPLTLTTWVSPSESQQGFDVIIEYESVLESELA--DVVFTIPVFPQE-PVDI 497

Query: 382 NVSNGKC 388
           N  +  C
Sbjct: 498 NTDSSTC 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,105,119
Number of extensions: 2342621
Number of successful extensions: 7795
Number of sequences better than 10.0: 110
Number of HSP's gapped: 7845
Number of HSP's successfully gapped: 144
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)