Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D043503.186ON55655627680.0
ZYRO0A04994g3.186ON6086068901e-112
YDL013W (SLX5)3.186ON6195888021e-98
Smik_4.2213.186ON6195617924e-97
Suva_4.2363.186ON6305727561e-91
Skud_4.2403.186ON6196327541e-91
NCAS0I019103.186ON6135337392e-89
SAKL0C07964g3.186ON6236327028e-84
AER213C3.186ON5575956854e-82
NDAI0A065103.186ON7125746885e-81
Kwal_27.98243.186ON5853686543e-77
Kpol_1036.523.186ON5915256361e-74
KLTH0E15884g3.186ON5866056342e-74
TBLA0F007203.186ON6493596225e-72
KLLA0C04411g3.186ON6075415855e-67
KAFR0A012203.186ON6472185753e-65
KNAG0J012703.186ON5475145544e-63
CAGL0K01881g3.186ON5062454842e-53
TPHA0A043703.186ON6642564641e-49
Skud_12.992.411ON117156761.5
KAFR0G022006.124ON50152697.1
Skud_8.555.586ON53564698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04350
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...  1070   0.0  
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   347   e-112
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   313   1e-98
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   309   4e-97
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   295   1e-91
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   295   1e-91
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   289   2e-89
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   275   8e-84
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   268   4e-82
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   269   5e-81
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   256   3e-77
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   249   1e-74
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   248   2e-74
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   244   5e-72
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   229   5e-67
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   226   3e-65
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   218   4e-63
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   191   2e-53
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   183   1e-49
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    34   1.5  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    31   7.1  
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    31   8.4  

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/556 (93%), Positives = 520/556 (93%)

Query: 1   MVGGSANYVGPSDPVSNSDDVILIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVV 60
           MVGGSANYVGPSDPVSNSDDVILIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVV
Sbjct: 1   MVGGSANYVGPSDPVSNSDDVILIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVV 60

Query: 61  SRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDELIFVQEQ 120
           SRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDELIFVQEQ
Sbjct: 61  SRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDELIFVQEQ 120

Query: 121 TRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTXXXXXXXXXXXXXXXN 180
           TRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQT               N
Sbjct: 121 TRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTRVARRQPMRRAARRAN 180

Query: 181 HSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENV 240
           HSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENV
Sbjct: 181 HSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENV 240

Query: 241 DPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVR 300
           DPLTWQDCRYDLERLFMDY         QIGQNMPGYRSPPNRTQGNADLLRRLGPLGVR
Sbjct: 241 DPLTWQDCRYDLERLFMDYRRMMARRAAQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVR 300

Query: 301 IGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQER 360
           IGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQER
Sbjct: 301 IGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQER 360

Query: 361 DAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESA 420
           DAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESA
Sbjct: 361 DAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESA 420

Query: 421 IAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTE 480
           IAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTE
Sbjct: 421 IAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTE 480

Query: 481 RALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGC 540
           RALSMKTFVASCGHTFCGRCVVRIENARTH            GPLHPDNYGPRLCPATGC
Sbjct: 481 RALSMKTFVASCGHTFCGRCVVRIENARTHSKSSKKELSKFKGPLHPDNYGPRLCPATGC 540

Query: 541 KQNIRLGRTKMREAFF 556
           KQNIRLGRTKMREAFF
Sbjct: 541 KQNIRLGRTKMREAFF 556

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  347 bits (890), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 231/606 (38%), Positives = 323/606 (53%), Gaps = 87/606 (14%)

Query: 19  DDVILIESDDEQ-HSSRDSGL--------RSSTTRDTMS--PNSNGSNQSEVVSRESSRN 67
           +D I+IESD E+    RD           R    RD ++   NS G+N +   S+++  +
Sbjct: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNGGS 81

Query: 68  ADSVS--------------PMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDE 113
            D V+              P+GS AEY+DL+   A N  Q  + V D   +   +++DD 
Sbjct: 82  DDEVAIVGEINNTRGNEEGPIGSDAEYVDLD---ADNGPQV-IEVNDNNRNNNENSDDDG 137

Query: 114 LIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTXXXXXXXXX 173
           L+ VQE+T    + LNLPG   ++I A+  DRP RRSFE Q  +R  R            
Sbjct: 138 LVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQDRTRRQAMERSARRASR 197

Query: 174 ----XXXXXXNHSMNGY-------------------ESDDGGLTSNRNQINYD-----PE 205
                     + S NG                     S    +T  R+Q+  D     P 
Sbjct: 198 LLFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEERSRLRNITRRRDQMRSDAMQGNPV 257

Query: 206 FAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXX 265
              ++ R+DS+P D+RSAF+HAQ++ EF SI+++V PLT Q+C  +L  LF +Y      
Sbjct: 258 LMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRS---- 313

Query: 266 XXXQIGQNMPGYRSPPNRTQGNADLLRRLGP---------------LGVRIGIGTGMGES 310
              ++ QN        NR Q N    RRL                   + +G+G G GES
Sbjct: 314 ---RMVQNWA-----TNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGGGFGES 365

Query: 311 LTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEK 370
           L +YIL     G GS        G+   M+EE  TQSI++ IQEREE+E D++TK  MEK
Sbjct: 366 LANYILM-NANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEK 424

Query: 371 TRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVC 430
           T+ Q+++++++   LP+GYSASFDT P  ++L+ + DG ++ +VV+D+S   +W+E+ VC
Sbjct: 425 TQDQQQSYVQRAMELPDGYSASFDTEPK-IKLDIVRDGKEETVVVKDDSVSDQWQEVPVC 483

Query: 431 CLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVA 490
            LCGVELGVG+PD+F GI+  DR +SF+ LV KY  HCPYQ+L   +  +R LS +TFVA
Sbjct: 484 TLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVA 543

Query: 491 SCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTK 550
            CGHT+CGRC  RI+NAR              G  HPDNYGP++CPA GCK  IR  R K
Sbjct: 544 PCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRT-RGK 602

Query: 551 MREAFF 556
           MREAFF
Sbjct: 603 MREAFF 608

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 207/588 (35%), Positives = 295/588 (50%), Gaps = 84/588 (14%)

Query: 23  LIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYID 82
            + SD    +S+ + + +S+ R    P+   +N    + RE  R      P+  +A Y+D
Sbjct: 62  FVRSDSRSRNSQRTHITASSER----PDFQANNDDITIIREVGRFFGDDGPIDPSAHYVD 117

Query: 83  LEMEPAGNEEQDDMIVYDERLSTPRDAE-----------------DDELIFVQEQTRPST 125
           L+ EP             E L TPR  +                 DD L  V+E+T    
Sbjct: 118 LDQEPGS-----------ETLETPRTIQVDNTNGYLNDNGNNNESDDGLTIVEERTTRPR 166

Query: 126 IQLNLPGRNPMRITATEYDRPARRSFEQQ----ASNRQLRHQTXXXXXXXXXXXXXXXNH 181
           + LNLPG   + +TAT  D P RRSFE Q    AS RQL  ++               + 
Sbjct: 167 VTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDE 226

Query: 182 SMNGYESDDGGL------------------------------TSNRNQINYDPEFAAIQR 211
               +  D   L                               S+   I+      +I+ 
Sbjct: 227 D---WTDDTHNLPEAIQRARRESRMRMSRRIAERQRRVQQQRVSSDENISTSIRLQSIRE 283

Query: 212 RLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIG 271
           R+ SY  DIRSAF  A++++EF SI++NV P+T Q+C  +L  LF ++         Q+ 
Sbjct: 284 RIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRN-------QLL 336

Query: 272 QNMPGYRSPPNRTQG---NADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRM 328
           QN    R    + +    + + L R      R+     + ES+T+Y+   G  G+ S R+
Sbjct: 337 QNWAIDRVRNTQEEALRLHREALERQERTAGRVFHRGTLRESITNYLNFNGEDGFLS-RL 395

Query: 329 IGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEG 388
              P   D   +EE  TQ+I++ IQEREE+ERD   K+ M KTR+Q+E F  +  +LPEG
Sbjct: 396 WSGPALSD--ADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEG 453

Query: 389 YSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGI 448
           YSASFDTTP  ++L+   +G ++ I+V D+      E+I VCCLCG ELGVG+PDDFTGI
Sbjct: 454 YSASFDTTPK-MKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGI 512

Query: 449 SADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENAR 508
           S  DR +SF+ LV+KY  HCPYQ+L   +  +R LS +TF+ASCGH FCGRC  RI+NA+
Sbjct: 513 SQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAK 572

Query: 509 THXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
                         G  HPDNYGP+LCPA  CK+ IR  R +++E +F
Sbjct: 573 KKSKMPKKKLAQLKGSAHPDNYGPKLCPADSCKKLIR-SRGRLKEVYF 619

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  309 bits (792), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 208/561 (37%), Positives = 292/561 (52%), Gaps = 58/561 (10%)

Query: 39  RSSTTRDTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNE--EQDDM 96
           R  TT  +   N+ G+N    + RE  R      P+  +A Y+DL+ EP G+E  E    
Sbjct: 74  RIHTTTTSEYSNTQGNNDDVTIIREVGRFFGDEGPIDPSAHYVDLDEEP-GSETLEAPRT 132

Query: 97  IVYDERLSTPRDAEDDE-----LIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSF 151
           I  D       D+ DD      L  V+E+T    I LNLPG   + + AT  D P RRSF
Sbjct: 133 IRVDNANGYLNDSHDDNENDDGLTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRSF 192

Query: 152 EQQ----ASNRQLRHQTXXXXXX---------------------XXXXXXXXXNHSMNGY 186
           E Q    AS RQL  ++                                    +H     
Sbjct: 193 EFQEDLAASRRQLLRRSATRARSLFVDRSDENDEDWTEHTHSLPETIQRARRESHMRMNR 252

Query: 187 ESDDGGLTSNRNQINYDP------EFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENV 240
              +  L + + +I+ D          +I+ R+ SY  D+RSAF HA++++EF SI++NV
Sbjct: 253 RIAERQLMAQQQRISRDENTSTSFRLQSIRERIQSYTPDVRSAFHHAESLHEFRSILQNV 312

Query: 241 DPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGYRSPPNRTQGNADLLRR--LGPLG 298
            P+T Q+C  +L  LF ++         Q+ QN    R     TQ  A  L R  L   G
Sbjct: 313 APVTLQECEEELMALFTEFRN-------QLLQNWAIERV--RNTQEEALRLHREALERQG 363

Query: 299 VRIGIGTGMG---ESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQER 355
              G     G   ES+ +Y+   G  G+ S R+    G   +  +EE  TQ+I++ IQER
Sbjct: 364 RTTGRNFHRGVFRESIANYLNFNGDDGFLS-RLWS--GSVLNDADEERHTQNIIDMIQER 420

Query: 356 EEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVV 415
           EE+ERD   K+ M KT++Q+E F  +  +LPEGYSASFDTTP  ++L+ + +G ++ I+V
Sbjct: 421 EERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTTPK-MKLDIMKNGKEETIIV 479

Query: 416 EDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTS 475
            D+      ++I VCCLCG ELGVG+PDDFTG+S  DR +SF+ LV+KY  HCPYQ+L  
Sbjct: 480 TDDDLAKTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGISFEGLVSKYKFHCPYQTLAR 539

Query: 476 ANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLC 535
            +  +R LS +TF+ASCGH +CGRC  RI+NA+              G  HPDNYGP+LC
Sbjct: 540 PSVLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPKKKLAQLKGSAHPDNYGPKLC 599

Query: 536 PATGCKQNIRLGRTKMREAFF 556
           PA  CK+ IR  R K++E +F
Sbjct: 600 PAESCKKLIR-SRGKLKEVYF 619

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 201/572 (35%), Positives = 290/572 (50%), Gaps = 69/572 (12%)

Query: 39  RSSTTRDTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIV 98
           R  TT  +  P++        + RE  R      P+  +A Y+DL+ EP     +   I+
Sbjct: 74  RIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRII 133

Query: 99  ------------YDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRP 146
                        +E  +   +  DD L  V+E+T    I LNLPG   + + AT  D P
Sbjct: 134 QVNNTNGYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGGERLEVNATPRDIP 193

Query: 147 ARRSFEQQ----ASNRQLRHQTXXXXXXXXXXXXXXXNHSMNGYESDDGGL--------- 193
            RRSFE Q    AS RQL  ++               + +   +  +   L         
Sbjct: 194 IRRSFEFQEDLAASRRQLLRRSAARARNLFVERSDEDDENDEEWTENTNDLPETIQRARR 253

Query: 194 ------------------------TSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQN 229
                                    SN N +       +I+ R+ +Y  DIRSAF HA++
Sbjct: 254 ESHMRMSRRVAERQHRIRAQQQRMVSNEN-MGTAIRLQSIRERIQAYVPDIRSAFHHAES 312

Query: 230 MNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGYRSPPNRTQGNAD 289
           ++EF SI++NV P+T Q+C  +L  LF ++         Q+ QN    R     TQ  A 
Sbjct: 313 LHEFRSILQNVAPVTLQECEGELMALFTEFRN-------QLLQNWAIDRV--RNTQEEAL 363

Query: 290 LLRRLGPLGVRIGIGTGMG-----ESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEAR 344
            L R    G     G  +      ES++ Y+   G  G+ + R+ G P    +  +EE  
Sbjct: 364 RLHREALEGQERVAGGALHHGPYRESISSYLNFNGEDGFLT-RLWGGP--VLNEADEERH 420

Query: 345 TQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEP 404
           TQ+I++ IQEREE+ERD   K+ M KT++Q++ F E+  NLPEGYSASFDTTP  ++L+ 
Sbjct: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPK-MKLDI 479

Query: 405 LNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKY 464
           + +G ++ I V D+      E+++VCCLCGVELGVG+PDDF G+S  DR +SF+ LV++Y
Sbjct: 480 MKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRY 539

Query: 465 CSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGP 524
             HCPYQ+L   +  +R LS +TFVASCGHT+CGRC  RI+NA+              G 
Sbjct: 540 KFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELKGS 599

Query: 525 LHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
            HPDNYGP+LCPA  CK+ IR  R +++E +F
Sbjct: 600 AHPDNYGPKLCPADSCKKLIR-SRGRLKEVYF 630

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  295 bits (754), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 210/632 (33%), Positives = 304/632 (48%), Gaps = 89/632 (14%)

Query: 1   MVGGSANYVGPSDPVSN--SDDVILIESDDEQHSS-------------------RDS--- 36
           M GG         P  N   D VILIESD E+ +S                   RD+   
Sbjct: 1   MHGGDGRTKSDHTPSVNHPDDSVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALNR 60

Query: 37  -------GLRSSTTRDTMSPNSN---GSNQSEVVSRESSRNADSVSPMGSTAEYIDLEME 86
                  G+       T  PN +     N    + RE  R      P+  +A ++DL+ E
Sbjct: 61  FVRSDSVGINPQRIHTTARPNRSDPQNDNDDVTIVREVGRFFGDDGPIDPSAHFVDLDHE 120

Query: 87  PAGNE-------EQDDMIVYDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRIT 139
           P           + D++  Y        D  DD L  V+E+T    + LNLPG   + + 
Sbjct: 121 PDSETLETPTTLQVDNINGYLNDNFNDNDNNDDGLTIVEERTTRPRVTLNLPGGERLEVN 180

Query: 140 ATEYDRPARRSFEQQ----ASNRQLRHQTXXXXXXXXXXXXXXXNHSMN----------- 184
           AT  D P RRSFE Q     S RQL  ++               +               
Sbjct: 181 ATTTDMPIRRSFEFQDDLAVSRRQLLRRSAARARTLFVDRSDENDEEWTEDTDNVPEAIQ 240

Query: 185 -----------------GYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHA 227
                               +    + SN N +N    F +I+ R+ +Y  DIRSAF HA
Sbjct: 241 RARRESHMRMSRRIAERQLRAQQHRMASNEN-MNTSIRFQSIRERIQAYAPDIRSAFYHA 299

Query: 228 QNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGYRSPPNRTQG- 286
           ++++EF SI++NV P+T Q+C  +L  LF ++         Q+ Q+    R    + +  
Sbjct: 300 ESLHEFRSILQNVAPVTLQECEGELMALFTEFRN-------QLLQDWAIDRVRNTQEEAL 352

Query: 287 --NADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEAR 344
             + + L R      R+       ES+T+Y+   G  G+ + R+ G+P   D   +EE  
Sbjct: 353 RLHREALERQERATGRVFHRGPFRESITNYLNFSGENGFLT-RLWGSPVLND--ADEERH 409

Query: 345 TQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEP 404
           TQ+I++ IQEREE+ERD   K+ M KT++Q+E F ++   LPEGYSASFDTTP  ++L+ 
Sbjct: 410 TQNIIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTTPK-MKLDI 468

Query: 405 LNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKY 464
           + +  ++ I V D+      E I VCCLCGVELGVG+PDDF G++  DR +SF+ LV+KY
Sbjct: 469 MKNDKEETITVTDDDLARTLEVIPVCCLCGVELGVGIPDDFIGMNQKDRGISFEGLVSKY 528

Query: 465 CSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGP 524
             HCPYQ+L   +  +R LS +TF+A+CGH +CGRC  RI+NA+              G 
Sbjct: 529 KFHCPYQTLARPSMLDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKKKLASLRGS 588

Query: 525 LHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
            HPDNYGP+ CPA  CK+ IR  R +++E +F
Sbjct: 589 AHPDNYGPKFCPAESCKKPIR-SRGRLKEVYF 619

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 273/533 (51%), Gaps = 68/533 (12%)

Query: 72  SPMGSTAEYIDLEME-PAGN----EEQDDMIVYDERLSTPRDAEDDELIFVQEQTRPSTI 126
           +P+   AE+IDL+ E P  N      +   I+     S P+  +DD+L+  QE+T   T+
Sbjct: 101 APINPDAEFIDLDQEVPYANATIPRPRTIQIITP---SPPQQQQDDDLVITQERTMRPTV 157

Query: 127 QLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTXXXXXXXXXXXXXXXNHSMNGY 186
            LNLPG   +++ AT  D+ AR SFE Q +    R Q                +H     
Sbjct: 158 TLNLPGGQTLQVDATPTDQLARSSFEWQENIPLARRQLLRRSTNRANSLFFHDDHE---S 214

Query: 187 ESDDGGLTSNRNQI----------------------NYDPEFAAIQRRLDSYPLDIRSAF 224
           ++D+G +    N I                      + +P    ++ R+++Y  DI+SAF
Sbjct: 215 DNDNGSVPLPPNVIRLRQRQQQQNREEPPPPPPPQDDANPIMTRLRTRINTYSPDIQSAF 274

Query: 225 LHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXX------------------ 266
            HA +++EF+SI++NV PLT Q+C  +L  LF  Y                         
Sbjct: 275 NHAHSLHEFTSILQNVAPLTLQECGDELLSLFTQYRSQLMVNWATRRVRSSQQNTSSSNH 334

Query: 267 ---XXQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGY 323
                +  +     R  PN    N +L R    L  ++GI  G  E    Y        Y
Sbjct: 335 RQRNLRNLRRNGALRVTPNANGFNVNLARLF--LMNQLGINNGNDED--QYFTG----AY 386

Query: 324 GSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCK 383
            S     + G  DD  E++ +TQ+I+N IQ REEQE D +TKS M +T+ Q++ F ++  
Sbjct: 387 NSEDDADHNG--DD--EDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKRAN 442

Query: 384 NLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPD 443
            LPE YSA+F+T P T++L+   +G ++ I+VED  A   + E+  C LCGVELGVG+P 
Sbjct: 443 ELPENYSANFNTEP-TMKLDIKKNGKEETIIVEDNDAAKNYIEVPACTLCGVELGVGIPK 501

Query: 444 DFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVR 503
           DF GI+  DR  SF+ LV+KY  HCPYQSL   +  ++ LS + F+ASCGHTFCGRC  R
Sbjct: 502 DFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMASCGHTFCGRCYAR 561

Query: 504 IENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
           I+NA++             G  HPDNYGPR+CPA  C+  +R+ +TKMRE FF
Sbjct: 562 IDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPADSCRSLLRV-KTKMREVFF 613

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  275 bits (702), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 200/632 (31%), Positives = 297/632 (46%), Gaps = 102/632 (16%)

Query: 4   GSANYVGPSDPVSNSDDVILIESDDEQHSSRDSGL---------RSSTTRDTMSP--NSN 52
           G   +  PS P   + DVI IESD E+                 R +  RD+++   NS 
Sbjct: 15  GLEQHAPPSAP---TQDVIEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLNSQ 71

Query: 53  GSNQSEVVSRESSRNA-------------DSVSPMGSTAEYIDLEMEPA----------- 88
           G N++   + E   +              D   P+G  A+++DL                
Sbjct: 72  GENRNTRAALEPDDDEDDDDLQVVGETMLDRHGPIGEDADFVDLSSFGGGDTGSGGSGDN 131

Query: 89  --GNEEQDDMIVYDERLSTPRDAED--DELIFVQEQTRPSTIQLNLPGRNPMRITATEYD 144
             G   +  +I    R ST  +  D  D++  ++E+T      LNLPG   +RI+ T  D
Sbjct: 132 RNGVPTRTAII----RHSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTAD 187

Query: 145 RPARRSFE-QQAS----------------NRQLRHQTXXXXXXXXXXXXXXXNHS----- 182
           +P RRSF+ QQ S                NR  R  T                 +     
Sbjct: 188 QPVRRSFQNQQPSRTRAVSAAAAARRRLLNRTARSATNLFFSSGQGPQDGYSEENDPDYI 247

Query: 183 ---------MNGYESDDGGLTSNRNQINY---DP----EFAAIQRRLDSYPLDIRSAFLH 226
                     N        L   R Q      DP    E  A++ R++ YPLDI+SAF H
Sbjct: 248 PAGVRQLRQQNAMRDRQASLEQRREQQRLNGMDPGANAELTALRSRINGYPLDIQSAFDH 307

Query: 227 AQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGYRSPPNRTQG 286
           AQ++ EF  II++V+P   ++ + +L  L+  Y         Q  +    YR    R Q 
Sbjct: 308 AQSLYEFEGIIQSVEPRMNENRKQELRELYSRYRGHVMHSWAQNRRRT--YREQAARAQQ 365

Query: 287 NA--DLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEAR 344
               +  +R   L  ++        SLT +++      +G F   G         +EE  
Sbjct: 366 TRAREQEQRQRELENQVFHNR---HSLTEFLI---ARAFGPFHWGGQQA------DEEIE 413

Query: 345 TQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEP 404
           TQ+I+  IQ REE+E+D + K  ME T+ Q++ F+ + + +PEGYSASFDT P  +++  
Sbjct: 414 TQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPK-MKIAM 472

Query: 405 LNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKY 464
             +G ++ + V D+ A  ++E++  CCLCG+ELGVG+PD+F+GI+ +DR +SF+ LV KY
Sbjct: 473 TRNGREEEVTVTDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKY 532

Query: 465 CSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGP 524
             HCPYQSL   +  +R LS +T+VASCGHTFCGRC  R++NAR +            G 
Sbjct: 533 GFHCPYQSLARPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGA 592

Query: 525 LHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
            HPDNYGP+ CPA GC   +R  + +M+E FF
Sbjct: 593 SHPDNYGPKTCPAEGCSMQLR-SKGRMKEVFF 623

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  268 bits (685), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 189/595 (31%), Positives = 286/595 (48%), Gaps = 89/595 (14%)

Query: 12  SDPVSNSDDVILIESDDEQ-------------------HSSRDSGLR-SSTTRDTMSPNS 51
           +DP +  + VI IESD E+                   +  RD+  R  S +    +   
Sbjct: 2   TDPNAARNAVIEIESDPEEDQRIINQYRQTRLVPDRRLNRPRDAANRFVSVSGRVAAAAG 61

Query: 52  NGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAED 111
            G ++ E+V+       D   P+ STA+++DL+ +   +     M++  +         D
Sbjct: 62  EGDDEVEIVNEVY---LDDEGPIDSTADFVDLDEQQGPSSS---MVINHD------GGGD 109

Query: 112 DELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTXXXXXXX 171
           D++  ++E+T   T  LNLP    +RI+ + +DRP RRSFE Q + R             
Sbjct: 110 DDVAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQRTAR------------- 156

Query: 172 XXXXXXXXNHSMNGYESDDGGLTSNRNQIN--YDPEFAAIQRR----------------- 212
                     +   + +++ G  S R   +  Y P+    QR+                 
Sbjct: 157 ANMLRRAARSAQRLFMNENDGEPSEREASDREYLPQSVLRQRQQALMQERLQRQREHARQ 216

Query: 213 --------LDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXX 264
                   +D+   ++RS F HA+ ++E  +++      T      DL +L+M +     
Sbjct: 217 HEHIADPQVDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQI 276

Query: 265 XX-XXQIGQNMP--GYRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIF 321
                Q  Q       R   +    +A   R   P      +      S T Y+L   + 
Sbjct: 277 NNWARQRAQEFRHGSAREADHAQDDSASRARLRNP-----ALNAQRRNSFTSYVLARSLG 331

Query: 322 GYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEK 381
           G+G +     P  F  G ++E  TQ+I++ IQ REE++ D++ +  ME T+SQ++ F+ +
Sbjct: 332 GFGVW-----PNDFF-GDDDEV-TQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVAR 384

Query: 382 CKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGL 441
            + LPEGY ASFD TP  +++    +G  + +VV D+ A   + E+ VCCLCGVELG+G+
Sbjct: 385 AQRLPEGYYASFDPTPK-MKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLCGVELGLGI 443

Query: 442 PDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCV 501
           PDDF GISA DR +SF+ LV+KY  HCPYQ+L   +  +R LS KTFVA CGHTFCGRC 
Sbjct: 444 PDDFAGISAVDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCF 503

Query: 502 VRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
            RI NA+              GP HPDNYGPR+CPA GC+  +R  R KMRE FF
Sbjct: 504 ARINNAKRFSKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRT-RGKMREVFF 557

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  269 bits (688), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 191/574 (33%), Positives = 267/574 (46%), Gaps = 106/574 (18%)

Query: 67  NADSVSPMGSTAEYIDLEMEP----------AGNEEQDDMIVYDERLSTPRDAEDDELIF 116
           N + + P+  TAEY+DL+ EP                      +       D +DDE++ 
Sbjct: 161 NINEIGPIDPTAEYVDLDAEPEYITNSRPRTIIINNNSSNNNIENSNGDANDDDDDEVMI 220

Query: 117 VQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASN------RQLRHQTXXXXXX 170
           ++E+T   T+ LNLPG   +RI A   +RP R SFE    N      RQL  +       
Sbjct: 221 LEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESLNENIVPLSRRQLLRRATRRATN 280

Query: 171 XXXXXXXXXNHSMNGYESDDGGL------------------------------------- 193
                    N S N  ++D+  L                                     
Sbjct: 281 SLFFHGSDENESDN--DTDEVSLPASILGMRQRARMMAMQERQRQRQGQGQGHSAPDTSG 338

Query: 194 ------TSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQD 247
                 ++NRN IN       ++ R+ +YP D+R AF HAQ++ EF+SI+++V P T+ +
Sbjct: 339 NSVDNTSTNRNLIN-------LRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAE 391

Query: 248 CRYDLERLFMDYXXXXXXXXXQIGQNMPGY--RSPPNRTQGNADLLRRLGPLGVRIGIGT 305
           C  DL  LF  Y           GQ M  +  R      + N  LLR      VR  I  
Sbjct: 392 CSDDLISLFTQYR----------GQVMADWTLRRIRQSQRDNERLLRERHAR-VRSTIRA 440

Query: 306 G---MGESLTHYILEPGI-FGYGSFRMIGNPGGFDDGMEEE------------------- 342
                G +L  + L   +  GYG      +    D G+ EE                   
Sbjct: 441 NNRHFGSNLASFFLMNQLGLGYGDVGAADDEDDGDYGIGEEDNDTGRAAGAYGYEYEDDD 500

Query: 343 ARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRL 402
           A TQ+I+N IQ RE+ ERD++TK  M KT+ Q++ F ++   LPEGYS+SF T P  V++
Sbjct: 501 AHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEP-KVKM 559

Query: 403 EPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVT 462
               +G  + +++ED      W ++  C LCGVELGVG+P DF G S  D  +SF+ LV+
Sbjct: 560 TVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVS 619

Query: 463 KYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXX 522
           KY  HCPYQSL+  +  +R LS K +VASCGHTFCGRC VRI+NA++             
Sbjct: 620 KYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNAKSKSKLPKKKLAELK 679

Query: 523 GPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
           G  HPDNYGP+ CP   CK  +R  R +MRE +F
Sbjct: 680 GSSHPDNYGPKTCPGPSCKTLLR-SRGRMREIYF 712

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  256 bits (654), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 207/368 (56%), Gaps = 37/368 (10%)

Query: 204 PEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXX 263
           PE +A++ +++  P ++RSAF HAQ+++EF SI++++D   +   + DL  LF +Y    
Sbjct: 240 PELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANL 299

Query: 264 XXXXXQIGQNMPGYRSPPNRTQGNAD---------------LLRRLGPLGVRIGIGTGMG 308
                      PG RS  +      D               + +   P+  R+ +G    
Sbjct: 300 LRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMHMGY--- 356

Query: 309 ESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNM 368
           ++ TH     GI GYG              ++EE +TQ+I+  IQEREEQE +A+ +  M
Sbjct: 357 DARTH----GGIMGYGE-------------VDEEQQTQNIIQMIQEREEQEYEARKRKYM 399

Query: 369 EKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIA 428
           E T+S++  ++EK   LPEGYS+SFDTTP  + +    +G ++ + V D+ A A + ++ 
Sbjct: 400 EDTKSKQLGYLEKAVKLPEGYSSSFDTTPK-MNITIKKNGKEEELTVTDDQAAAFYMDLP 458

Query: 429 VCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTF 488
            C LCGVELGVG+PD+F G+S  DR +SF+ L  KY  HCPYQ+L+  +  +R LS +T+
Sbjct: 459 SCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTY 518

Query: 489 VASCGHTFCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGR 548
           VA+CGH+FCGRC  RI+NAR+             G  HPDNYGP+ CPA  C   +R  R
Sbjct: 519 VAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLR-NR 577

Query: 549 TKMREAFF 556
            KMRE +F
Sbjct: 578 GKMREVYF 585

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 79  EYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDE-LIFVQEQTRPSTIQLNLPGRNPMR 137
           EY+DL+    G+  Q            P+ A  +E L+ ++E+T   +  LNLPG   +R
Sbjct: 93  EYVDLDRSGEGSLGQ----------RRPQAASSEEDLVILEERTSSPSFVLNLPGGEYLR 142

Query: 138 ITATEYDRPARRSFEQQA 155
           I  +  D+P RRSF+ QA
Sbjct: 143 INGSPLDQPVRRSFQAQA 160

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 173/525 (32%), Positives = 249/525 (47%), Gaps = 40/525 (7%)

Query: 48  SPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLS--- 104
           S N + +N    + RE +R+        S  EY+DL+ EP   E      + D R S   
Sbjct: 91  SGNDSANNDDITIVREINRSPRRERRNESVTEYVDLDHEPEDVEPIGTSNL-DGRSSGSN 149

Query: 105 -TPRDAED---DELIFVQEQT-RPS--TIQLNLPGRNPMRITATEYDRPARRSFEQQASN 157
              RD  +   D+LI + EQ  +PS  +I L +PGR  M +     D P R SFE Q   
Sbjct: 150 VNDRDRNNSNIDDLIIISEQHPQPSANSIFLTIPGRQLMELQVASTDIPTRSSFEYQNDR 209

Query: 158 RQLRHQTXXXXXXXXXXXXXXXNHSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYP 217
           R +R                   +  N +      L         +PE   I R +  Y 
Sbjct: 210 RPVR-------LGNSGRPRINRQYMQNSFSRVRRQLLGILRVRQSNPEIDEIAREISLYH 262

Query: 218 LDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIGQNMPGY 277
            +IRSAF+HA + NEF +IIE    L   D   DL     D              ++   
Sbjct: 263 TNIRSAFIHANSFNEFMAIIEVAPRLGITDDLVDLYLRLEDLRNRTHQANSLFVPDIDNI 322

Query: 278 RSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGG--- 334
            S    T+ +                   +   +T+  +E         R+ GN GG   
Sbjct: 323 SSNSETTRYDEGW--------------NPVTHPVTNRFIEDSFHSPMIRRIFGNYGGRHH 368

Query: 335 --FDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSAS 392
             +DD  +EE RTQSI+  IQEREE E+D +TK   E T+ +++ F  +   LP+GYS+S
Sbjct: 369 QDYDDD-DEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATELPDGYSSS 427

Query: 393 FDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADD 452
           F+T P   +++   +G   ++ V D++   +WEEI +CCLCGV L  G+PD+F G+S +D
Sbjct: 428 FNTEPK-AKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEGIPDEFQGMSNED 486

Query: 453 RHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXX 512
           R L F+EL  KY S CPYQ L   + ++R  S + +VA+CGHT+CGRC  RI+N++    
Sbjct: 487 RFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQNSKEKSK 546

Query: 513 XXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGR-TKMREAFF 556
                     G  HPDNYGP+ CP T C + +R+ R    REA+F
Sbjct: 547 LPKSQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  248 bits (634), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 191/605 (31%), Positives = 293/605 (48%), Gaps = 93/605 (15%)

Query: 14  PVSNSDDVILIESDDEQHS--------SRDSGLRSSTTRDTMSPNSNGSNQSEVVSRESS 65
           P  + +DVI IESD E  +        + D G    +  D + P+ N  N SEV    ++
Sbjct: 13  PECSQNDVIEIESDTEDETQVLPGTLEAPDIGQMHGSLVDDL-PSQN--NASEVFC--NT 67

Query: 66  RNADSVSPMGSTAEYIDLEMEP-AGN---EEQDDMIVYDERLSTPRDAEDDELIFVQEQT 121
            + D +  +G T    +    P  GN      + + V   R   P  A +++L+ ++E+ 
Sbjct: 68  EDDDEIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPSAAGEEDLVILEERN 127

Query: 122 RPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTXXXXXXXXXXXXXXXNH 181
              +  LNLPG   ++I+ +  D+P RRSF+ Q +    RH                   
Sbjct: 128 NSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGN----RHTNSANGRRRLLRRTARRAS 183

Query: 182 SMNGYESD--DGG--------------LTSNRNQINY------------------DPEFA 207
           S+  + SD  D G              L   RN +                    DPE  
Sbjct: 184 SLFLHPSDEEDEGFAYENTDLLPTGVRLRRQRNSMMQRRPNPPRRQLLGTGDDVDDPELL 243

Query: 208 AIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXX 267
           +++ +++S+P ++RSAF HAQ+++EF SI+++VD  +++  + +L  LF           
Sbjct: 244 SLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFT---------- 293

Query: 268 XQIGQNMPGYRSPPNRTQGNADLLRRL----GPLGVRIGIGTGMGESLTHYILEPGIFG- 322
                    YR    R+  N D LRR       +  R    T    +L +     GI   
Sbjct: 294 --------VYRGHVMRSWAN-DRLRRARDAASGMNTRTTDRTSQAHNLRYSPTLAGIIAR 344

Query: 323 -----YGSFRMIGNPG------GFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKT 371
                 G   M   PG       ++D  +EE +TQ+I+  IQEREE+E +++ +  ME T
Sbjct: 345 TFNPILGHMHMAYEPGLGTGMAAYNDA-DEERQTQNIIQMIQEREEREFESRKRKYMEDT 403

Query: 372 RSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCC 431
           + ++  +++K   LP+GYSASFDTTP  + +  + +G  + + V D+ A A + +I  CC
Sbjct: 404 KPKQSGYLQKAAKLPDGYSASFDTTPR-MNISIMKNGQNEELTVVDDHADALYMDIPACC 462

Query: 432 LCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVAS 491
           LCGVELGVG+PD F G+  +DR +SF+ L  KY  HCPYQ+L+  +  +R LS +T+VA 
Sbjct: 463 LCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQ 522

Query: 492 CGHTFCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKM 551
           CGH+FCGRC  RI+NAR+             G  +PDNYGP+ CPA  C   +R  R KM
Sbjct: 523 CGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLR-SRGKM 581

Query: 552 REAFF 556
           RE +F
Sbjct: 582 REVYF 586

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  244 bits (622), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 200/359 (55%), Gaps = 29/359 (8%)

Query: 201 NYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYX 260
           N  P  A ++RR+++YP D+RS F HA  +NEF +++++  P+T +D R DL  +F  Y 
Sbjct: 317 NESPIMAELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYR 376

Query: 261 XXXXXXXXQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGI 320
                    + QN    R   N ++ N+           R    T M     H     G 
Sbjct: 377 G-------NLTQNWMINRM--NSSRDNS----------ARTASSTPMRNMPAHTRFVQGF 417

Query: 321 FGYGSFRMIGNPGGFDDG---MEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEEN 377
                  ++G  G F  G    +EEA TQ+I+  I+ERE  ERD++ K  M+KT+ Q+E+
Sbjct: 418 L----HSIMGLGGDFPYGGTESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQED 473

Query: 378 FIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVEL 437
           F  K K LP+G+SASF   P  + +    D +K+ IV  DE    E+EE+ VCCLCGVEL
Sbjct: 474 FENKAKYLPKGFSASFSLVPKKI-ISIDGDDSKREIVT-DEFLAEEYEELPVCCLCGVEL 531

Query: 438 GVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFC 497
           GVG+PD F GI+ ++  +SFD LV KY   CPY +L++    +R LS +T+VASCGH+FC
Sbjct: 532 GVGIPDSFRGITPEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFC 591

Query: 498 GRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
           GRCV RI +A+              GP +PD YGP+ CPAT C   +R  + +MRE +F
Sbjct: 592 GRCVRRINHAKESGKISKQKLKELVGPENPDIYGPKTCPATDCTGKLRR-KGQMREVYF 649

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 8/96 (8%)

Query: 68  ADSVSPMGSTAEYIDLEMEPA----GNEEQDDMIVYDERLSTPRDAED----DELIFVQE 119
            D   P+  + EY+DL+ E       N      ++ D         +D    D+L+ VQE
Sbjct: 143 VDPSGPLNPSTEYVDLDNEAEYSSNNNYGHSRTLIVDGDNDNADVIDDGNGADDLVIVQE 202

Query: 120 QTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQA 155
           +T   T+ L LPG   ++I A   DRP R SF  Q 
Sbjct: 203 RTSAPTVTLTLPGNRSIQINAAPTDRPVRSSFGWQG 238

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  229 bits (585), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 168/541 (31%), Positives = 252/541 (46%), Gaps = 75/541 (13%)

Query: 73  PMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDELIFVQEQTRPS--TIQLNL 130
           P+   AEYI+L+   A N   +  +V D R        DD+L+ V+E+ + S   + L L
Sbjct: 85  PINDDAEYINLDNYRASN---NGTVVVDHREG------DDDLMLVEERIQESGRPVLLQL 135

Query: 131 PGRNPMRITATEYDRPARRSFEQQASN---------RQLRHQTXXXXXXXXXXXXXXXNH 181
           P    +++ A+  + P  RSF+ Q            R + H T               + 
Sbjct: 136 PAGQTLQVDASWNELPVGRSFQNQVYRNPNQLRRLRRHIDHATAMFMGGYNQSGTGDSDF 195

Query: 182 SMNGYESDDGGLTSNRNQINYDPEFAAIQRR--------------LDSYPLDIRSAFLHA 227
           S N  +     + + RNQ          + R              +DS   D+RS F  +
Sbjct: 196 SDNDADYIPPDIVNERNQYTMQTRMREQRERQNQMQRLQRAADETIDSLDPDLRSLFFES 255

Query: 228 QNMNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQIG----------QNMPGY 277
           Q++++F    E +    +   R  LE+L   Y                      QN    
Sbjct: 256 QSLSQFR---EGLARFNFPPAR--LEQLLGQYRDFRARAMQSWAEGRRTRSMSYQNRNSL 310

Query: 278 RSPPNRTQGNADLLRRLGPLG----------VRIGIG-----------TGMGESLTHYIL 316
           R  P RT+         G  G          +  G+            TG  +SL   I 
Sbjct: 311 R--PQRTRSGTQQNHSRGSNGDSRDNALYQQMLFGMPDDDENMDGNNFTGTTQSLQRIIS 368

Query: 317 EPGIFGYGSFRM-IGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQE 375
                 +G+    +G   GF +  ++ A T+ I+  IQEREE++   +TK   E T+SQ+
Sbjct: 369 NTMNRRFGNLPFGVGPEFGFYEDGDDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQ 428

Query: 376 ENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGV 435
           + +I+K  +LPEGYSASF+T P  + +   N+G ++ ++V D+ A   + ++ VC LCGV
Sbjct: 429 QKYIDKANSLPEGYSASFNTAPL-MSMTMENEGREETVMVTDDVAAKTYIDVPVCVLCGV 487

Query: 436 ELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHT 495
           ELGVG+PDD+ G+S +D+ +SF+ L + Y  HCPYQ+L      +R LS +T+V+SCGHT
Sbjct: 488 ELGVGIPDDWKGVSEEDKGVSFEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHT 547

Query: 496 FCGRCVVRIENARTHXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAF 555
           FCGRC VRI+NAR              GP HPDNYGP+ CPA GC  N+R  +  MRE +
Sbjct: 548 FCGRCQVRIKNARDISAKEKNKLKNSQGPSHPDNYGPKKCPAEGCNSNLR-KKGIMREVY 606

Query: 556 F 556
           F
Sbjct: 607 F 607

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  226 bits (575), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 108/218 (49%), Positives = 147/218 (67%), Gaps = 3/218 (1%)

Query: 340 EEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTT 399
           EE  RTQ+I+N IQEREE+E D++TK  M  T+SQ E   +K +NLP+GYSA+FD+TP T
Sbjct: 432 EEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKT 491

Query: 400 VRLEPLNDGNKQAIVVEDESAIAE-WEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFD 458
           V ++ + +G ++ I+V+D+ A+     E+ +C LCG ELG+G+PDDF GI  +DR LSF 
Sbjct: 492 V-VKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQ 550

Query: 459 ELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXX 518
            LV+KY S+CPYQSL   +  +R LS +TFVA CGH +CGRCV RI NA+ +        
Sbjct: 551 FLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKEL 610

Query: 519 XXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
               G  HP+NYGP+ CPA  CK  +R  R K+ E +F
Sbjct: 611 AKLIGSSHPENYGPKKCPADNCKGLLR-SRGKLSEVYF 647

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 99/232 (42%), Gaps = 48/232 (20%)

Query: 69  DSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPR-----------DAEDDELIFV 117
           D   P+   AEYIDL+ E       D         +TPR           + EDD L  +
Sbjct: 101 DPNGPIDPGAEYIDLDTE-------DQYASGHHGFNTPRIVVINGDSNNGNNEDDGLEII 153

Query: 118 QEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQAS----------NRQLRHQTXXX 167
           +E+T   T+ LNLPG   ++I A++ DRPA RSFE Q +              R ++   
Sbjct: 154 EERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPRRRLLRRSAGRIRSLFL 213

Query: 168 XXXXXXXXXXXXNHSMNGY------------ESDDGGLTSNRNQINYD-PEFAAIQRRLD 214
                           N Y            ++    L   R ++N   PE  +   R D
Sbjct: 214 NNSDDENNDTAAGRQNNRYLPSNIRRLRQEEQAQMRQLAQRRRRMNEQRPEMISGNPRFD 273

Query: 215 -------SYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDY 259
                  +Y  DIRSAF HAQ ++EF SI+EN+ P+T QDC  +L  L+ +Y
Sbjct: 274 EIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEY 325

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  218 bits (554), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 158/514 (30%), Positives = 236/514 (45%), Gaps = 87/514 (16%)

Query: 89  GNEEQDDMIVYDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPAR 148
           GN++ D++ V +ER + P                P+T +L LPGRN M I   + D P  
Sbjct: 75  GNDDTDEITVLEERPAPPP---------------PNTTELYLPGRNVMHIRTAQSDNPIP 119

Query: 149 RSFEQQASNRQLRH-------------------QTXXXXXXXXXXXXXXXNHSMNGYESD 189
            SF      R LR                    +                    + + +D
Sbjct: 120 TSF------RNLRRDDGGSGVGEELRRSRRLRERPRWGGRMTPRATERGQRRRRSLFVND 173

Query: 190 DGGLTSNRNQ-----INYDPEFAA---------------IQRRLDSYPLDIRSAFLHAQN 229
           DG   S   +     +  DPE+ +               I+ R++SYP +I+S F +AQ+
Sbjct: 174 DGEDISQNPRFMSMLMTMDPEYTSGNHPAALDEDPQRRRIRARINSYPPNIQSTFHYAQS 233

Query: 230 MNEFSSIIENVDPLTWQDCRYDLERLFMDYXXXXXXXXXQ-IGQNMPGYRSP------PN 282
           + EF+ I++N DP+T+ +CR DL  LF  Y         + +GQ       P        
Sbjct: 234 LPEFTYIVQNTDPITFAECRDDLTNLFSQYQSMQHDDRMRNVGQQGSRQSEPRHGTNYSQ 293

Query: 283 RTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEE 342
           R+  +    R   P   +        +SL      P I  +   R++G P       +EE
Sbjct: 294 RSAVSHSNNRYFYPEFNQYESDEARAQSLL-----PRIHDFLQMRLMGYPND-----DEE 343

Query: 343 ARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRL 402
             TQ+I++ IQERE+ ERD + K+  +K++   ++ +++ K+LP  YSASF         
Sbjct: 344 TTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEAKSLPSNYSASFHYP------ 397

Query: 403 EPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVT 462
              +  +K  I     S  AE EE++ C LCG ELGVG+PD F G SA+DR L F  L++
Sbjct: 398 ---SSPSKPQIPGGSTSETAESEEVSCCVLCGSELGVGIPDSFIGRSAEDRDLDFSSLIS 454

Query: 463 KYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHXXXXXXXXXXXX 522
           KY   CPYQSL   N  +R LS +TF++ CGH +CGRC  RI+NA+              
Sbjct: 455 KYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGRCFARIDNAKAKSKISKKELASLK 514

Query: 523 GPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556
           G  +P+ YGPR+C A GC   IR  + ++RE +F
Sbjct: 515 GCSNPNIYGPRICVADGCTAVIR-AKARLRELYF 547

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  191 bits (484), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 144/245 (58%), Gaps = 18/245 (7%)

Query: 315 ILEPGIFGYGSFRMIGNP--GGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTR 372
           +L   +  Y    + G P  G  DD   EEA+TQSI++ IQ+REE ERD + K    K+ 
Sbjct: 277 VLPQSMASYMHNHVYGTPITGSEDD---EEAQTQSIIDIIQQREESERDKRVKEYTRKSE 333

Query: 373 SQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCL 432
           SQ++ F E+ K LP GYSASF  TP  +R              ED S   + E++ VC L
Sbjct: 334 SQKKKFYEEAKQLPPGYSASF-ATPEVIR----------ENDDEDNSNNDDDEDMIVCNL 382

Query: 433 CGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASC 492
           CGVELG+G+P++FTGIS +D  LSF EL+ KY S CPYQSL   +  +R LS +T+V++C
Sbjct: 383 CGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNC 442

Query: 493 GHTFCGRCVVRIENART-HXXXXXXXXXXXXGPLHPDNYGPRLCPATGCKQNIRLGRTKM 551
           GH FCGRC  R  NAR+              G  HPDN+ P++CPA  CK  IR  + KM
Sbjct: 443 GHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIR-SKGKM 501

Query: 552 REAFF 556
           RE +F
Sbjct: 502 REVYF 506

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 74  MGSTAEYIDLEMEPAGNEEQDDM-IVYDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPG 132
           + +   YI+L+ E A ++  DD+  +    +    D ++D +  ++E+     + LNLPG
Sbjct: 77  ISTPVAYINLDDEAAHHDASDDIEFLGGNLVPNAGDNDEDAVTLLEERLADGLVPLNLPG 136

Query: 133 RNPMRITATEYDRPARRSFEQQASNRQLRH 162
              + + A   + P R SFE+   N QLR+
Sbjct: 137 GRRIIVNAANGEAPVRSSFERLMRNNQLRY 166

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 140/256 (54%), Gaps = 29/256 (11%)

Query: 328 MIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPE 387
           +  N   F      E  TQ ++  IQEREE+E D +T+   +K    ++   EK K +PE
Sbjct: 411 LFVNSNDFGYAQAGEQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPE 470

Query: 388 GYSASFDTTPTTVRLEPLNDGN--------KQAIVVEDESAIAEWE---EIAVCCLCGVE 436
           GYS+SF +T   V+L    D N        +Q + V+DE    + E   E+ VCCLCGVE
Sbjct: 471 GYSSSF-STEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVE 529

Query: 437 LGVGLPDDFTGISADDRHLS-FDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHT 495
           LG+G+P+ F GISA+D+ L  F ++ TKY   CPYQ++      +R LS +TF+++CGH 
Sbjct: 530 LGIGIPETFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHA 589

Query: 496 FCGRCVVRIENAR---------------THXXXXXXXXXXXXGPLHPDNYGPRLCPATGC 540
           FCGRC  RI  A+               T             G L+PDNYGP++CP + C
Sbjct: 590 FCGRCYNRIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDC 649

Query: 541 KQNIRLGRTKMREAFF 556
           K  IR  RTKMREA+F
Sbjct: 650 KYQIR-ARTKMREAYF 664

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 70/149 (46%), Gaps = 20/149 (13%)

Query: 18  SDDVILIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVV--SRESSRNADSVSPMG 75
           +DD + I SD E H  R   ++S    D    ++ GS++S ++  S +   + +    +G
Sbjct: 12  ADDFVTIVSDFE-HEPR---IQSVNNNDNQVTSTAGSSKSTIIEHSNDDHHDDNDDDEIG 67

Query: 76  STAEYIDLEMEPAGNEEQDDMIVYDER-----------LSTPRDAEDDELIFVQEQTRPS 124
             +E ++ +   A N+  DD+ V +ER            S   +  DD+L+ V EQ   +
Sbjct: 68  IISERVNFDT--ANNDNMDDLSVINEREVVDLDREPEITSVANNTNDDDLMIVGEQVIEN 125

Query: 125 -TIQLNLPGRNPMRITATEYDRPARRSFE 152
             I LNLPG     ++ T  D P R SFE
Sbjct: 126 PHILLNLPGGRTFELSTTTNDLPFRSSFE 154

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 447 GISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSM-KTFVASCGHTFCGRCV 501
             S ++   + ++L TKY  +   QSL  +  T   + + K     CGH+FC +C+
Sbjct: 888 SFSKEELEATIEKLRTKYPDNKSLQSLECSICTAEPIDLNKALFTECGHSFCEKCL 943

>KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.124
           YBR227C
          Length = 501

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 349 LNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEG--YSASFDTTPT 398
           +NA+++  ++ ++  TK++ EK RS+  NFIE  + LP G   SA   TTPT
Sbjct: 286 INALKDSNKKGKEEGTKNSEEKKRSKFGNFIEDVE-LPNGEKVSALSLTTPT 336

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 362 AQTKSNMEKTRSQEENFIE--KCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDES 419
           AQ   +   + S  EN IE   CK LPEGYS        T +++ +   + Q   +  E 
Sbjct: 288 AQCGEHFSTSESWVENHIEAGSCKGLPEGYSERIREKKKTSKMKMIKTSDGQTRFISSEE 347

Query: 420 AIAE 423
           ++ E
Sbjct: 348 SVLE 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,027,212
Number of extensions: 2525148
Number of successful extensions: 12481
Number of sequences better than 10.0: 163
Number of HSP's gapped: 12884
Number of HSP's successfully gapped: 203
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)